F351948

General Info

Members Datasets Scaffolds Average Seq Length
239 178 478 185

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10064044|Ga0157372_100640441
Length 212
Sequence MRRTRSSVSPIISDVLRQPELSVDFDMRISPASRPLRTRSRAEVLATLDAAFGTSNGPLGAHCIHELWMRGEFAAHIETALEKLWAHAAKSVPEWLPMRYVDWLPTLYEVTAHFRAERKGRSNIYLILLDYADRRDGPHGIYVGMSKYSPAQRFDQHKAGIRAAGSVLKRGLEVLTGPTLHLQSIARPAAARIEGELAGALRDAGLLVQGGH

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
107 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
126 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
127 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
128 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
129 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
130 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
131 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 10.88
Rhizosphere 81.17
Stem 0
Stem Tuber 0
Unclassified 29.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10064044 3300013307 Bacteria 4124
2 rootL2_10182150 3300003322 Bacteria 5088
3 rootH1_10240684 3300003323 Unclassified 1032
4 Ga0070676_10608718 3300005328 Bacteria 789
5 Ga0070690_100030322 3300005330 Bacteria 3360
6 Ga0070690_100059523 3300005330 Unclassified 2456
7 Ga0068869_100238772 3300005334 Unclassified 1447
8 Ga0070666_10101252 3300005335 Unclassified 1985
9 Ga0070682_100111024 3300005337 Bacteria 1827
10 Ga0068868_100037162 3300005338 Bacteria 3774
11 Ga0070689_100013327 3300005340 Bacteria 5946
12 Ga0070661_100266192 3300005344 Bacteria 1326
13 Ga0070669_100423781 3300005353 Bacteria 1093
14 Ga0070675_100164277 3300005354 Bacteria 1911
15 Ga0070671_100026864 3300005355 Bacteria 4735
16 Ga0070674_100148893 3300005356 Bacteria 1764
17 Ga0070673_100155317 3300005364 Bacteria 1941
18 Ga0070667_100013297 3300005367 Bacteria 6798
19 Ga0070709_10018605 3300005434 Bacteria 4004
20 Ga0070714_100224479 3300005435 Unclassified 1728
21 Ga0070713_100007209 3300005436 Bacteria 7783
22 Ga0070710_10068086 3300005437 Unclassified 2044
23 Ga0070701_10040976 3300005438 Bacteria 2357
24 Ga0070701_10057570 3300005438 Unclassified 2038
25 Ga0070711_100012676 3300005439 Bacteria 5274
26 Ga0070711_100300877 3300005439 Bacteria 1275
27 Ga0070700_100123226 3300005441 Unclassified 1740
28 Ga0070694_100010548 3300005444 Bacteria 5704
29 Ga0070708_100953373 3300005445 Bacteria 805
30 Ga0070678_100001413 3300005456 Bacteria 12800
31 Ga0070678_100070564 3300005456 Bacteria 2612
32 Ga0070672_100001688 3300005543 Bacteria 13770
33 Ga0070672_100467780 3300005543 Bacteria 1087
34 Ga0070665_100006349 3300005548 Bacteria 12059
35 Ga0070665_100012526 3300005548 Bacteria 8546
36 Ga0070665_100409536 3300005548 Bacteria 1364
37 Ga0070704_100615318 3300005549 Unclassified 956
38 Ga0068855_100273688 3300005563 Unclassified 1877
39 Ga0070664_100085450 3300005564 Bacteria 2725
40 Ga0068854_100203675 3300005578 Bacteria 1557
41 Ga0068856_100017426 3300005614 Bacteria 6960
42 Ga0070702_100159278 3300005615 Bacteria 1457
43 Ga0068864_100019363 3300005618 Bacteria 5691
44 Ga0068861_100009008 3300005719 Bacteria 6880
45 Ga0068861_100009094 3300005719 Bacteria 6849
46 Ga0068861_100115526 3300005719 Bacteria 2156
47 Ga0068863_100023607 3300005841 Bacteria 5872
48 Ga0068863_100612826 3300005841 Unclassified 1078
49 Ga0068858_100044107 3300005842 Bacteria 4134
50 Ga0068858_100637546 3300005842 Unclassified 1035
51 Ga0068860_100346843 3300005843 Bacteria 1460
52 Ga0068860_100429852 3300005843 Unclassified 1310
53 Ga0068860_101345729 3300005843 Unclassified 735
54 Ga0068862_100023066 3300005844 Bacteria 5212
55 Ga0068862_100710796 3300005844 Bacteria 974
56 Ga0070715_10000237 3300006163 Bacteria 13179
57 Ga0070716_100015821 3300006173 Bacteria 3885
58 Ga0070716_100129523 3300006173 Unclassified 1593
59 Ga0070712_100013542 3300006175 Bacteria 5213
60 Ga0097621_100031063 3300006237 Bacteria 4235
61 Ga0068871_100103905 3300006358 Bacteria 2383
62 Ga0068871_100178988 3300006358 Unclassified 1821
63 Ga0075430_100252170 3300006846 Bacteria 1462
64 Ga0068865_100015365 3300006881 Bacteria 4881
65 Ga0068865_100387927 3300006881 Bacteria 1141
66 Ga0068865_100535900 3300006881 Unclassified 981
67 Ga0099794_10027048 3300007265 Bacteria 2656
68 Ga0099795_10000036 3300007788 Bacteria 35735
69 Ga0099795_10033038 3300007788 Bacteria 1794
70 Ga0099795_10090675 3300007788 Unclassified 1184
71 Ga0105240_10036408 3300009093 Bacteria 6331
72 Ga0111539_10620242 3300009094 Bacteria 1259
73 Ga0105245_10005984 3300009098 Bacteria 10693
74 Ga0105241_10029248 3300009174 Bacteria 4109
75 Ga0105242_10029110 3300009176 Bacteria 4403
76 Ga0105248_10090676 3300009177 Bacteria 3442
77 Ga0105248_11226721 3300009177 Bacteria 848
78 Ga0105237_10041414 3300009545 Bacteria 4644
79 Ga0105237_10179824 3300009545 Bacteria 2115
80 Ga0105238_10147632 3300009551 Bacteria 2327
81 Ga0099796_10000035 3300010159 Bacteria 27877
82 Ga0099796_10001360 3300010159 Bacteria 4874
83 Ga0099796_10160710 3300010159 Bacteria 890
84 Ga0105239_10032745 3300010375 Bacteria 5712
85 Ga0157374_10037268 3300013296 Bacteria 4461
86 Ga0157378_10026775 3300013297 Bacteria 5084
87 Ga0157378_11251031 3300013297 Bacteria 782
88 Ga0163162_10412995 3300013306 Unclassified 1482
89 Ga0157375_10024819 3300013308 Bacteria 5556
90 Ga0157375_10139530 3300013308 Bacteria 2550
91 Ga0163163_10023228 3300014325 Bacteria 5883
92 Ga0157380_10077417 3300014326 Unclassified 2711
93 Ga0157380_11289673 3300014326 Unclassified 777
94 Ga0157379_10000883 3300014968 Bacteria 24275
95 Ga0157379_10012040 3300014968 Bacteria 7557
96 Ga0207696_1000327 3300025711 Bacteria 50417
97 Ga0207682_10003861 3300025893 Bacteria 6424
98 Ga0207642_10095568 3300025899 Unclassified 1479
99 Ga0207680_10017064 3300025903 Bacteria 3827
100 Ga0207699_10028602 3300025906 Bacteria 3100
101 Ga0207645_10059315 3300025907 Bacteria 2444
102 Ga0207643_10040705 3300025908 Bacteria 2617
103 Ga0207671_10731160 3300025914 Unclassified 786
104 Ga0207693_10000298 3300025915 Bacteria 46341
105 Ga0207663_10624890 3300025916 Unclassified 848
106 Ga0207662_10029363 3300025918 Bacteria 3185
107 Ga0207649_10292657 3300025920 Bacteria 1188
108 Ga0207687_10062540 3300025927 Bacteria 2633
109 Ga0207664_10466471 3300025929 Unclassified 1128
110 Ga0207644_10037799 3300025931 Bacteria 3398
111 Ga0207686_10168242 3300025934 Unclassified 1543
112 Ga0207669_10609086 3300025937 Bacteria 888
113 Ga0207669_11021751 3300025937 Unclassified 695
114 Ga0207704_10120197 3300025938 Bacteria 1796
115 Ga0207704_10714457 3300025938 Unclassified 831
116 Ga0207665_10091385 3300025939 Bacteria 2110
117 Ga0207691_10006335 3300025940 Bacteria 11428
118 Ga0207691_10006577 3300025940 Bacteria 11226
119 Ga0207691_10480616 3300025940 Bacteria 1056
120 Ga0207711_10050970 3300025941 Bacteria 3544
121 Ga0207689_10031858 3300025942 Bacteria 4385
122 Ga0207679_10049309 3300025945 Bacteria 3072
123 Ga0207679_10213246 3300025945 Bacteria 1620
124 Ga0207651_10345396 3300025960 Bacteria 1251
125 Ga0207712_10273875 3300025961 Unclassified 1374
126 Ga0207640_10703110 3300025981 Bacteria 867
127 Ga0207658_10378189 3300025986 Unclassified 1240
128 Ga0207703_10055017 3300026035 Bacteria 3238
129 Ga0207641_10935913 3300026088 Unclassified 861
130 Ga0207648_10457952 3300026089 Bacteria 1162
131 Ga0207676_10034777 3300026095 Unclassified 3817
132 Ga0207675_100009446 3300026118 Bacteria 9128
133 Ga0207675_100054953 3300026118 Bacteria 3715
134 Ga0207675_100335377 3300026118 Bacteria 1479
135 Ga0207683_10015981 3300026121 Bacteria 6387
136 Ga0209179_1000028 3300027512 Bacteria 35102
137 Ga0268266_10004547 3300028379 Bacteria 13255
138 Ga0268266_10395183 3300028379 Bacteria 1306
139 Ga0268266_11559141 3300028379 Unclassified 636
140 Ga0268265_10052637 3300028380 Bacteria 3080
141 Ga0268265_10151031 3300028380 Unclassified 1959
142 Ga0268264_10098971 3300028381 Bacteria 2530
143 Ga0307515_10211272 3300028794 Bacteria 1784
144 Ga0307511_10016444 3300030521 Bacteria 7130
145 Ga0307511_10242818 3300030521 Unclassified 876
146 Ga0265771_1003822 3300031010 Unclassified 887
147 Ga0265760_10000357 3300031090 Bacteria 12802
148 Ga0307513_10014444 3300031456 Bacteria 9636
149 Ga0307513_10029715 3300031456 Bacteria 6223
150 Ga0307513_10180208 3300031456 Bacteria 1977
151 Ga0307513_10241108 3300031456 Bacteria 1613
152 Ga0307513_10359095 3300031456 Unclassified 1202
153 Ga0307516_10001465 3300031730 Bacteria 32608
154 Ga0307405_10574565 3300031731 Unclassified 916
155 Ga0307406_10199573 3300031901 Bacteria 1471
156 Ga0307407_10236369 3300031903 Bacteria 1244
157 Ga0307412_10333590 3300031911 Bacteria 1211
158 Ga0307409_100055854 3300031995 Bacteria 3051
159 Ga0307416_100089487 3300032002 Bacteria 2636
160 Ga0307510_10002034 3300033180 Bacteria 22852
161 Ga0307510_10321178 3300033180 Unclassified 1005
162 Ga0373943_0562089 3300035170 Bacteria 670
163 Ga0373931_0509703 3300035691 Bacteria 777
164 Ga0373927_0060101 3300035695 Bacteria 2459
165 Ga0373927_0096264 3300035695 Bacteria 1924
166 Ga0373947_0014420 3300035725 Bacteria 4534
167 Ga0373937_0072297 3300036401 Bacteria 3181
168 Ga0373937_0150357 3300036401 Bacteria 2181
169 Ga0373925_0354186 3300037068 Bacteria 1192
170 Ga0436363_1169522 3300039450 Bacteria 2725
171 Ga0451791_0737340 3300041451 Bacteria 906
172 Ga0451798_0059503 3300041458 Bacteria 1587
173 Ga0451802_0321135 3300041460 Unclassified 810
174 Ga0451802_1304717 3300041460 Bacteria 1696
175 Ga0451804_0594376 3300041463 Unclassified 1037
176 Ga0451807_0297122 3300041486 Bacteria 3599
177 Ga0451807_0433581 3300041486 Bacteria 3552
178 Ga0451839_1108590 3300041496 Bacteria 1001
179 Ga0451841_0802128 3300041498 Bacteria 3357
180 Ga0451853_1212066 3300041512 Unclassified 1261
181 Ga0466966_0188996 3300044684 Bacteria 1248
182 Ga0466959_0080909 3300045049 Unclassified 2341
183 Ga0495590_0012326 3300046457 Unclassified 3174
184 Ga0495590_0054668 3300046457 Unclassified 1395
185 Ga0495590_0129051 3300046457 Bacteria 909
186 Ga0495638_0103364 3300046460 Unclassified 1701
187 Ga0495580_0068252 3300046472 Bacteria 2486
188 Ga0495580_0093976 3300046472 Bacteria 2086
189 Ga0495580_0264352 3300046472 Unclassified 1176
190 Ga0495639_0114650 3300046475 Unclassified 1281
191 Ga0495584_0044586 3300046491 Unclassified 2238
192 Ga0495585_0353739 3300046492 Unclassified 713
193 Ga0495630_0213085 3300046517 Bacteria 1474
194 Ga0495632_0103993 3300046519 Bacteria 1337
195 Ga0495634_0328772 3300046642 Unclassified 919
196 Ga0495625_0031377 3300046660 Bacteria 3954
197 Ga0495625_0035021 3300046660 Unclassified 3703
198 Ga0495625_0083745 3300046660 Bacteria 2216
199 Ga0495599_0553893 3300046678 Unclassified 673
200 Ga0495647_0031540 3300046681 Unclassified 1971
201 Ga0495658_0034169 3300046683 Bacteria 2788
202 Ga0495613_0527420 3300046689 Unclassified 793
203 Ga0495649_0177330 3300046694 Unclassified 1113
204 Ga0495600_0223586 3300046809 Bacteria 1204
205 Ga0495600_0697429 3300046809 Unclassified 611
206 Ga0495674_0032309 3300047319 Bacteria 4748
207 Ga0496100_0193894 3300048903 Unclassified 1476
208 Ga0496100_0829035 3300048903 Unclassified 725
209 Ga0496101_0007578 3300048904 Bacteria 7044
210 Ga0496102_0022173 3300048905 Bacteria 5626
211 Ga0496103_0021609 3300048906 Bacteria 3872
212 Ga0496104_0008756 3300048907 Bacteria 8997
213 Ga0496105_0025382 3300048908 Bacteria 4824
214 Ga0496105_0106421 3300048908 Bacteria 2315
215 Ga0496106_0004541 3300048909 Bacteria 10285
216 Ga0496107_0351750 3300048910 Unclassified 1096
217 Ga0496108_0210377 3300048911 Unclassified 1688
218 Ga0496109_0655688 3300048912 Unclassified 986
219 Ga0496110_0287124 3300048913 Unclassified 1498
220 Ga0496111_0275433 3300048914 Unclassified 1248
221 Ga0496112_0056029 3300048915 Bacteria 3879
222 Ga0496113_0150496 3300048916 Unclassified 1836
223 Ga0496114_0046935 3300048917 Bacteria 3590
224 Ga0496114_0190251 3300048917 Bacteria 1795
225 Ga0496115_0207707 3300048918 Unclassified 1617
226 Ga0496119_0375293 3300048922 Unclassified 683
227 Ga0501031_0388493 3300049568 Bacteria 903
228 Ga0501041_0329347 3300049577 Unclassified 964
229 Ga0501042_0614505 3300049578 Unclassified 790
230 Ga0501069_0123268 3300049585 Unclassified 1481
231 Ga0501069_0165434 3300049585 Bacteria 1275
232 Ga0501075_0118977 3300049591 Bacteria 2009
233 Ga0501080_0001009 3300049742 Bacteria 23148
234 Ga0501080_0252538 3300049742 Bacteria 1608
235 nmdc:mga08y16_654554_c1 3300050511 Bacteria 1054
236 Ga0495601_0405953 3300053077 Bacteria 883
237 Ga0500641_0002287 3300053096 Archaea 6798
238 Ga0501082_0247901 3300060353 Bacteria 1550
239 Ga0501082_0272042 3300060353 Unclassified 1474
240 Ga0157372_10064044
241 rootL2_10182150
242 rootH1_10240684
243 Ga0070676_10608718
244 Ga0070690_100030322
245 Ga0070690_100059523
246 Ga0068869_100238772
247 Ga0070666_10101252
248 Ga0070682_100111024
249 Ga0068868_100037162
250 Ga0070689_100013327
251 Ga0070661_100266192
252 Ga0070669_100423781
253 Ga0070675_100164277
254 Ga0070671_100026864
255 Ga0070674_100148893
256 Ga0070673_100155317
257 Ga0070667_100013297
258 Ga0070709_10018605
259 Ga0070714_100224479
260 Ga0070713_100007209
261 Ga0070710_10068086
262 Ga0070701_10040976
263 Ga0070701_10057570
264 Ga0070711_100012676
265 Ga0070711_100300877
266 Ga0070700_100123226
267 Ga0070694_100010548
268 Ga0070708_100953373
269 Ga0070678_100001413
270 Ga0070678_100070564
271 Ga0070672_100001688
272 Ga0070672_100467780
273 Ga0070665_100006349
274 Ga0070665_100012526
275 Ga0070665_100409536
276 Ga0070704_100615318
277 Ga0068855_100273688
278 Ga0070664_100085450
279 Ga0068854_100203675
280 Ga0068856_100017426
281 Ga0070702_100159278
282 Ga0068864_100019363
283 Ga0068861_100009008
284 Ga0068861_100009094
285 Ga0068861_100115526
286 Ga0068863_100023607
287 Ga0068863_100612826
288 Ga0068858_100044107
289 Ga0068858_100637546
290 Ga0068860_100346843
291 Ga0068860_100429852
292 Ga0068860_101345729
293 Ga0068862_100023066
294 Ga0068862_100710796
295 Ga0070715_10000237
296 Ga0070716_100015821
297 Ga0070716_100129523
298 Ga0070712_100013542
299 Ga0097621_100031063
300 Ga0068871_100103905
301 Ga0068871_100178988
302 Ga0075430_100252170
303 Ga0068865_100015365
304 Ga0068865_100387927
305 Ga0068865_100535900
306 Ga0099794_10027048
307 Ga0099795_10000036
308 Ga0099795_10033038
309 Ga0099795_10090675
310 Ga0105240_10036408
311 Ga0111539_10620242
312 Ga0105245_10005984
313 Ga0105241_10029248
314 Ga0105242_10029110
315 Ga0105248_10090676
316 Ga0105248_11226721
317 Ga0105237_10041414
318 Ga0105237_10179824
319 Ga0105238_10147632
320 Ga0099796_10000035
321 Ga0099796_10001360
322 Ga0099796_10160710
323 Ga0105239_10032745
324 Ga0157374_10037268
325 Ga0157378_10026775
326 Ga0157378_11251031
327 Ga0163162_10412995
328 Ga0157375_10024819
329 Ga0157375_10139530
330 Ga0163163_10023228
331 Ga0157380_10077417
332 Ga0157380_11289673
333 Ga0157379_10000883
334 Ga0157379_10012040
335 Ga0207696_1000327
336 Ga0207682_10003861
337 Ga0207642_10095568
338 Ga0207680_10017064
339 Ga0207699_10028602
340 Ga0207645_10059315
341 Ga0207643_10040705
342 Ga0207671_10731160
343 Ga0207693_10000298
344 Ga0207663_10624890
345 Ga0207662_10029363
346 Ga0207649_10292657
347 Ga0207687_10062540
348 Ga0207664_10466471
349 Ga0207644_10037799
350 Ga0207686_10168242
351 Ga0207669_10609086
352 Ga0207669_11021751
353 Ga0207704_10120197
354 Ga0207704_10714457
355 Ga0207665_10091385
356 Ga0207691_10006335
357 Ga0207691_10006577
358 Ga0207691_10480616
359 Ga0207711_10050970
360 Ga0207689_10031858
361 Ga0207679_10049309
362 Ga0207679_10213246
363 Ga0207651_10345396
364 Ga0207712_10273875
365 Ga0207640_10703110
366 Ga0207658_10378189
367 Ga0207703_10055017
368 Ga0207641_10935913
369 Ga0207648_10457952
370 Ga0207676_10034777
371 Ga0207675_100009446
372 Ga0207675_100054953
373 Ga0207675_100335377
374 Ga0207683_10015981
375 Ga0209179_1000028
376 Ga0268266_10004547
377 Ga0268266_10395183
378 Ga0268266_11559141
379 Ga0268265_10052637
380 Ga0268265_10151031
381 Ga0268264_10098971
382 Ga0307515_10211272
383 Ga0307511_10016444
384 Ga0307511_10242818
385 Ga0265771_1003822
386 Ga0265760_10000357
387 Ga0307513_10014444
388 Ga0307513_10029715
389 Ga0307513_10180208
390 Ga0307513_10241108
391 Ga0307513_10359095
392 Ga0307516_10001465
393 Ga0307405_10574565
394 Ga0307406_10199573
395 Ga0307407_10236369
396 Ga0307412_10333590
397 Ga0307409_100055854
398 Ga0307416_100089487
399 Ga0307510_10002034
400 Ga0307510_10321178
401 Ga0373943_0562089
402 Ga0373931_0509703
403 Ga0373927_0060101
404 Ga0373927_0096264
405 Ga0373947_0014420
406 Ga0373937_0072297
407 Ga0373937_0150357
408 Ga0373925_0354186
409 Ga0436363_1169522
410 Ga0451791_0737340
411 Ga0451798_0059503
412 Ga0451802_0321135
413 Ga0451802_1304717
414 Ga0451804_0594376
415 Ga0451807_0297122
416 Ga0451807_0433581
417 Ga0451839_1108590
418 Ga0451841_0802128
419 Ga0451853_1212066
420 Ga0466966_0188996
421 Ga0466959_0080909
422 Ga0495590_0012326
423 Ga0495590_0054668
424 Ga0495590_0129051
425 Ga0495638_0103364
426 Ga0495580_0068252
427 Ga0495580_0093976
428 Ga0495580_0264352
429 Ga0495639_0114650
430 Ga0495584_0044586
431 Ga0495585_0353739
432 Ga0495630_0213085
433 Ga0495632_0103993
434 Ga0495634_0328772
435 Ga0495625_0031377
436 Ga0495625_0035021
437 Ga0495625_0083745
438 Ga0495599_0553893
439 Ga0495647_0031540
440 Ga0495658_0034169
441 Ga0495613_0527420
442 Ga0495649_0177330
443 Ga0495600_0223586
444 Ga0495600_0697429
445 Ga0495674_0032309
446 Ga0496100_0193894
447 Ga0496100_0829035
448 Ga0496101_0007578
449 Ga0496102_0022173
450 Ga0496103_0021609
451 Ga0496104_0008756
452 Ga0496105_0025382
453 Ga0496105_0106421
454 Ga0496106_0004541
455 Ga0496107_0351750
456 Ga0496108_0210377
457 Ga0496109_0655688
458 Ga0496110_0287124
459 Ga0496111_0275433
460 Ga0496112_0056029
461 Ga0496113_0150496
462 Ga0496114_0046935
463 Ga0496114_0190251
464 Ga0496115_0207707
465 Ga0496119_0375293
466 Ga0501031_0388493
467 Ga0501041_0329347
468 Ga0501042_0614505
469 Ga0501069_0123268
470 Ga0501069_0165434
471 Ga0501075_0118977
472 Ga0501080_0001009
473 Ga0501080_0252538
474 nmdc:mga08y16_654554_c1
475 Ga0495601_0405953
476 Ga0500641_0002287
477 Ga0501082_0247901
478 Ga0501082_0272042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pvs-assembly1.cif.gz_A structure and biochemical activities of escherichia coli mgsa 0.8628 19 57
7or8-assembly1.cif.gz_A ternary complex of 14-3-3 sigma, p27pt198 phosphopeptide, and wq136 0.8116 14 64
3ctd-assembly1.cif.gz_B-2 crystal structure of a putative aaa family atpase from prochlorococcus marinus subsp. pastoris 0.8078 20 59
7oqw-assembly1.cif.gz_A-2 ternary complex of 14-3-3 sigma, amot-p130 phosphopeptide, and wq178 0.8076 14 64
6tlf-assembly1.cif.gz_A-2 human 14-3-3 sigma isoform in complex with imp 0.8075 14 64
ID Description Score Start End Superfamily
6hepD00 Mainly Alpha;Up-down Bundle;Delta-Endotoxin; domain 1;14-3-3 domain 0.8031 16 64 1.20.190.20
af_Q4DMU3_256_347_1.20.272.10 Mainly Alpha;Up-down Bundle;Zinc Finger, Delta Prime; domain 3; 0.7911 20 59 1.20.272.10
af_Q8VD72_327_394_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7732 21 68 1.25.40.10
af_Q4E3J1_102_437_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7522 18 68 1.25.40.10
3bgeA01 Mainly Alpha;Up-down Bundle;Zinc Finger, Delta Prime; domain 3; 0.7522 19 64 1.20.272.10
ID Description Score Start End GO Terms
AF-A0A1E4GWA9-F1-model_v4 GIY-YIG domain-containing protein 0.8232 79 182
AF-A0A0Q8M9G8-F1-model_v4 GIY-YIG domain-containing protein 0.8065 73 182
AF-A0A7U0J3G9-F1-model_v4 deleted 0.8027 79 182
AF-A0A2V8G1S7-F1-model_v4 GIY-YIG domain-containing protein 0.8023 89 182
AF-A0A2V8BPK9-F1-model_v4 GIY-YIG domain-containing protein 0.7998 95 182

Map