F351752

General Info

Members Datasets Scaffolds Average Seq Length
239 194 160 124

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_102286883|Ga0068853_1022868831
Length 124
Sequence MSAVFAVLSGLFFAAAIYLMLARHVVRIMIGTVLLGNAVNLLLFTAGRVTRETPPVIVSGKVLAAGAANPLPQALILTAIVISFSFFAFLMVLAYRAWQTLGTDDGNEMRVAEPRDEAMPPVEY

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
3 2516143018 Ensifer sp. BR816 Isolate Nodule
4 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
5 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
6 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
7 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
8 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
9 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
10 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
11 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
12 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
13 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
14 2643221557 Ensifer sp. Root558 Isolate Unclassified
15 2643221558 Rhizobium sp. Root149 Isolate Unclassified
16 2643221607 Rhizobium sp. Root73 Isolate Unclassified
17 2643221610 Ensifer sp. Root74 Isolate Unclassified
18 2643221618 Ensifer sp. Root231 Isolate Unclassified
19 2643221626 Ensifer sp. Root31 Isolate Unclassified
20 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
21 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
22 2643221655 Ensifer sp. Root1252 Isolate Unclassified
23 2643221659 Ensifer sp. Root127 Isolate Unclassified
24 2643221668 Ensifer sp. Root423 Isolate Unclassified
25 2643221675 Ensifer sp. Root1298 Isolate Unclassified
26 2643221680 Ensifer sp. Root1312 Isolate Unclassified
27 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
28 2643221688 Rhizobium sp. Root482 Isolate Unclassified
29 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
30 2643221698 Ensifer sp. Root142 Isolate Unclassified
31 2643221712 Ensifer sp. Root258 Isolate Unclassified
32 2643221718 Rhizobium sp. Root268 Isolate Unclassified
33 2643221723 Ensifer sp. Root278 Isolate Unclassified
34 2643221726 Ensifer sp. Root954 Isolate Unclassified
35 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
36 2738543024 Aminobacter sp. AP02 Isolate Unclassified
37 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
38 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
39 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
40 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
41 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
42 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
43 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
44 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
45 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
46 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
47 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
48 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
49 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
50 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
51 2844163670 Ensifer sp. 1H6 Isolate Unclassified
52 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
53 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
54 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
55 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
56 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
57 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
58 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
59 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
60 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
61 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
62 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
63 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
64 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
65 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
66 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
67 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
68 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
69 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
70 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
71 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
72 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
73 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
74 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
75 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
76 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
77 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
78 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
79 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
80 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
81 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
82 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
83 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
84 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
85 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
86 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
105 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
106 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
107 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
108 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
109 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
110 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
111 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
112 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
138 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
143 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
144 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
145 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
146 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
147 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
148 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
149 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
150 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
151 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
152 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
153 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
154 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
155 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
156 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
181 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
182 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
185 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
186 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
187 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
188 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
189 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
190 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
191 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
192 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
193 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
194 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 66.53
Metatranscriptomes 0.42
Isolates 33.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.18
Nodule 12.55
Rhizoplane 2.51
Rhizosphere 30.96
Stem 0
Stem Tuber 0
Unclassified 31.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000089 3300002704 Bacteria 51946
2 JGI25156J39149_1000147 3300002705 Bacteria 51946
3 JGI25154J39366_1000160 3300002738 Bacteria 51946
4 JGI25157J39369_1000190 3300002741 Bacteria 51946
5 JGI25151J46595_10016398 3300003187 Bacteria 3240
6 JGI25151J46595_10027999 3300003187 Bacteria 2250
7 JGI25151J46595_10148679 3300003187 Bacteria 562
8 JGI25160J50197_1000002 3300003354 Bacteria 561707
9 JGI25161J50226_1000944 3300003374 Bacteria 10374
10 Ga0055526_1001202 3300003771 Bacteria 18643
11 Ga0055524_1000890 3300003775 Bacteria 19381
12 Ga0055524_1061012 3300003775 Bacteria 782
13 Ga0055536_1002285 3300003781 Bacteria 10883
14 Ga0055536_1008469 3300003781 Bacteria 4411
15 Ga0055536_1013355 3300003781 Bacteria 2974
16 Ga0055530_10027702 3300003791 Bacteria 1543
17 Ga0055530_10035124 3300003791 Bacteria 1274
18 Ga0055540_1011709 3300003792 Bacteria 2806
19 Ga0055540_1016968 3300003792 Bacteria 2048
20 Ga0055531_10002384 3300003794 Bacteria 12627
21 Ga0055531_10010596 3300003794 Bacteria 4559
22 Ga0055543_1000137 3300004625 Bacteria 60651
23 Ga0065165_1000004 3300005262 Bacteria 377081
24 Ga0068853_102286883 3300005539 Bacteria 524
25 Ga0070665_100021793 3300005548 Bacteria 6442
26 Ga0075365_10271940 3300006038 Bacteria 1192
27 Ga0075365_11196388 3300006038 Bacteria 535
28 Ga0075364_10719745 3300006051 Bacteria 681
29 Ga0075367_10692815 3300006178 Bacteria 648
30 Ga0079104_1000010 3300006946 Bacteria 366021
31 Ga0105243_11320416 3300009148 Bacteria 739
32 Ga0105242_10802630 3300009176 Bacteria 932
33 Ga0105239_10240681 3300010375 Bacteria 2031
34 Ga0157373_10015734 3300013100 Bacteria 5523
35 Ga0157371_10451966 3300013102 Bacteria 945
36 Ga0157370_10084955 3300013104 Bacteria 2973
37 Ga0157369_10133455 3300013105 Bacteria 2630
38 Ga0171463_1001 3300013249 Bacteria 1406070
39 Ga0157380_11077648 3300014326 Bacteria 841
40 Ga0183363_1114 3300015690 Bacteria 22062
41 Ga0163161_10633768 3300017792 Bacteria 884
42 Ga0214544_1000008 3300021320 Bacteria 326027
43 Ga0214542_1000010 3300021321 Bacteria 262816
44 Ga0214542_1020572 3300021321 Bacteria 4798
45 Ga0214543_1000003 3300021327 Bacteria 692327
46 Ga0214543_1000004 3300021327 Bacteria 527190
47 Ga0209435_100036 3300025206 Bacteria 126970
48 Ga0209436_100270 3300025208 Bacteria 23759
49 Ga0209646_1000132 3300025246 Bacteria 126859
50 Ga0209026_1000313 3300025250 Bacteria 52121
51 Ga0209759_1000417 3300025256 Bacteria 52121
52 Ga0209130_1000008 3300025284 Bacteria 581232
53 Ga0209130_1040591 3300025284 Bacteria 899
54 Ga0209676_1000885 3300025292 Bacteria 38361
55 Ga0209676_1020481 3300025292 Bacteria 2245
56 Ga0209025_1000100 3300025294 Bacteria 229182
57 Ga0209025_1000165 3300025294 Bacteria 164692
58 Ga0209025_1016948 3300025294 Bacteria 4246
59 Ga0209025_1025386 3300025294 Bacteria 3018
60 Ga0209564_1000104 3300025295 Bacteria 219017
61 Ga0209564_1042287 3300025295 Bacteria 1211
62 Ga0209758_1000121 3300025297 Bacteria 192028
63 Ga0209758_1054679 3300025297 Bacteria 1362
64 Ga0209050_1001445 3300025298 Bacteria 25507
65 Ga0209050_1003961 3300025298 Bacteria 10456
66 Ga0209256_1000351 3300025299 Bacteria 74921
67 Ga0209256_1000723 3300025299 Bacteria 43638
68 Ga0207426_1000016 3300025302 Bacteria 581232
69 Ga0209051_1001278 3300025303 Bacteria 22378
70 Ga0209051_1001973 3300025303 Bacteria 15769
71 Ga0209257_1002305 3300025304 Bacteria 19326
72 Ga0207639_11865339 3300026041 Bacteria 562
73 Ga0207675_102195262 3300026118 Bacteria 567
74 Ga0209281_1000078 3300027111 Bacteria 261622
75 Ga0268266_10015136 3300028379 Bacteria 6624
76 Ga0307515_10000115 3300028794 Bacteria 193697
77 Ga0307515_10018668 3300028794 Bacteria 12526
78 Ga0307515_10468362 3300028794 Bacteria 873
79 Ga0307515_10509542 3300028794 Bacteria 813
80 Ga0307513_10362123 3300031456 Bacteria 1194
81 Ga0307408_101479674 3300031548 Bacteria 642
82 Ga0316576_10493818 3300031727 Bacteria 901
83 Ga0307406_10028744 3300031901 Bacteria 3361
84 Ga0307412_11598345 3300031911 Bacteria 595
85 Ga0307416_103266526 3300032002 Bacteria 543
86 Ga0307414_10406742 3300032004 Bacteria 1183
87 Ga0307414_10834245 3300032004 Bacteria 842
88 Ga0307411_11529406 3300032005 Bacteria 614
89 Ga0316593_10041972 3300032168 Bacteria 1524
90 Ga0316574_0319573 3300035398 Bacteria 986
91 Ga0316582_0821416 3300036647 Bacteria 637
92 Ga0316584_0413113 3300036712 Bacteria 959
93 Ga0395900_0187399 3300037418 Bacteria 2100
94 Ga0395898_1558142 3300037466 Bacteria 586
95 Ga0395905_0001129 3300037471 Bacteria 33426
96 Ga0395905_0005656 3300037471 Bacteria 12714
97 Ga0395905_0104312 3300037471 Bacteria 2661
98 Ga0439438_034721 3300041405 Bacteria 1328
99 Ga0439439_0011585 3300041406 Bacteria 2125
100 Ga0439453_0042008 3300041408 Bacteria 899
101 Ga0439466_0062653 3300041411 Bacteria 1195
102 Ga0439465_0003572 3300041413 Bacteria 5070
103 Ga0439465_0356517 3300041413 Bacteria 553
104 Ga0439433_0030965 3300041999 Bacteria 1224
105 Ga0439432_109431 3300042006 Bacteria 823
106 Ga0439432_255710 3300042006 Bacteria 502
107 Ga0439449_0005496 3300042007 Bacteria 4854
108 Ga0439449_0039109 3300042007 Bacteria 1763
109 Ga0439462_0049869 3300042015 Bacteria 1124
110 Ga0450919_016035 3300042121 Bacteria 846
111 Ga0450920_081665 3300042122 Bacteria 662
112 Ga0450910_005246 3300042147 Bacteria 1764
113 Ga0450908_069418 3300042184 Bacteria 625
114 Ga0439434_0022429 3300042435 Bacteria 1898
115 Ga0450918_002771 3300042531 Bacteria 3285
116 Ga0466965_0278252 3300044683 Bacteria 903
117 Ga0495638_0023467 3300046460 Bacteria 4033
118 Ga0495654_0000223 3300046530 Bacteria 52992
119 Ga0495588_0167565 3300046674 Bacteria 1162
120 Ga0495686_0165536 3300047472 Bacteria 1289
121 Ga0496110_0192266 3300048913 Bacteria 1853
122 Ga0496111_0000142 3300048914 Bacteria 32155
123 Ga0496117_0001371 3300048920 Bacteria 35494
124 Ga0496120_0197773 3300048923 Bacteria 975
125 Ga0496121_0022545 3300048924 Bacteria 6104
126 Ga0496121_0059295 3300048924 Bacteria 3157
127 Ga0496122_0000009 3300048925 Bacteria 584024
128 Ga0496122_0000205 3300048925 Bacteria 131755
129 Ga0496122_0104844 3300048925 Bacteria 1877
130 Ga0496123_0000103 3300048926 Bacteria 168232
131 Ga0496123_0000245 3300048926 Bacteria 109471
132 Ga0496123_0012018 3300048926 Bacteria 7426
133 Ga0496124_0001609 3300048927 Bacteria 32380
134 Ga0496124_0017562 3300048927 Bacteria 6739
135 Ga0496124_0070003 3300048927 Bacteria 2911
136 Ga0496124_0224788 3300048927 Bacteria 1409
137 Ga0496124_0456010 3300048927 Bacteria 870
138 Ga0496124_0561082 3300048927 Bacteria 751
139 Ga0496125_0000879 3300048928 Bacteria 47630
140 Ga0496125_0721635 3300048928 Bacteria 526
141 Ga0496126_0001035 3300048929 Bacteria 47018
142 Ga0496126_0072797 3300048929 Bacteria 3056
143 Ga0501031_0035224 3300049568 Bacteria 3265
144 Ga0501034_0016781 3300049571 Bacteria 7508
145 Ga0501034_0122106 3300049571 Bacteria 2591
146 Ga0501034_0123762 3300049571 Bacteria 2572
147 Ga0501047_0777099 3300049581 Bacteria 773
148 Ga0501076_1398441 3300049592 Bacteria 575
149 Ga0501238_034503 3300049671 Bacteria 736
150 Ga0501080_0196847 3300049742 Bacteria 1851
151 Ga0501083_0124800 3300049744 Bacteria 1688
152 nmdc:mga0yw44_218562_c1 3300050492 Bacteria 1262
153 Ga0500618_000007 3300053125 Bacteria 226268
154 Ga0500618_015312 3300053125 Bacteria 1940
155 Ga0500559_0007396 3300053136 Bacteria 4870
156 Ga0500604_0040404 3300053151 Bacteria 1406
157 Ga0500616_0000599 3300053153 Bacteria 43738
158 Ga0500624_074879 3300053157 Bacteria 667
159 Ga0500627_0258537 3300053158 Bacteria 769
160 Ga0500634_0007251 3300053161 Bacteria 5446

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053158 Ga0500627_0258537 Ga0500627_0258537_11_331 106
2 3300041405 Ga0439438_034721 Ga0439438_034721_584_943 119
3 iso_pu_bacteria 2643221689 2644500855 120
4 iso_pu_bacteria 2508501122 2509107422 121
5 iso_pu_bacteria 2513237159 2513999394 121
6 iso_pu_bacteria 2516143018 2516208757 121
7 iso_pu_bacteria 2558860983 2561465909 121
8 iso_pu_bacteria 2582581283 2585165392 121
9 iso_pu_bacteria 2582581306 2585266372 121
10 iso_pu_bacteria 2582581865 2585387347 121
11 iso_pu_bacteria 2582581866 2585397831 121
12 iso_pu_bacteria 2585427633 2585994896 121
13 iso_pu_bacteria 2585427634 2585999438 121
14 iso_pu_bacteria 2599185236 2599719161 121
15 iso_pu_bacteria 2599185352 2600191802 121
16 iso_pu_bacteria 2600254933 2600375044 121
17 iso_pu_bacteria 2643221557 2643807337 121
18 iso_pu_bacteria 2643221558 2643810182 121
19 iso_pu_bacteria 2643221607 2644046740 121
20 iso_pu_bacteria 2643221610 2644069749 121
21 iso_pu_bacteria 2643221618 2644109129 121
22 iso_pu_bacteria 2643221626 2644151649 121
23 iso_pu_bacteria 2643221636 2644202447 121
24 iso_pu_bacteria 2643221637 2644206363 121
25 iso_pu_bacteria 2643221655 2644311785 121
26 iso_pu_bacteria 2643221659 2644330056 121
27 iso_pu_bacteria 2643221668 2644380720 121
28 iso_pu_bacteria 2643221675 2644414625 121
29 iso_pu_bacteria 2643221680 2644448282 121
30 iso_pu_bacteria 2643221686 2644479529 121
31 iso_pu_bacteria 2643221688 2644493542 121
32 iso_pu_bacteria 2643221698 2644543190 121
33 iso_pu_bacteria 2643221712 2644617583 121
34 iso_pu_bacteria 2643221718 2644650010 121
35 iso_pu_bacteria 2643221723 2644673681 121
36 iso_pu_bacteria 2643221726 2644689411 121
37 iso_pu_bacteria 2690316117 2692316948 121
38 iso_pu_bacteria 2738543024 2739306631 121
39 iso_pu_bacteria 2751185821 2753462938 121
40 iso_pu_bacteria 2791355082 2792584037 121
41 iso_pu_bacteria 2791355091 2792622160 121
42 iso_pu_bacteria 2791355092 2792628275 121
43 iso_pu_bacteria 2791355094 2792638467 121
44 iso_pu_bacteria 2818991461 2819685265 121
45 iso_pu_bacteria 2821123053 2821124025 121
46 iso_pu_bacteria 2837651117 2837652529 121
47 iso_pu_bacteria 2837678835 2837681350 121
48 iso_pu_bacteria 2838074704 2838076315 121
49 iso_pu_bacteria 2838736955 2838738947 121
50 iso_pu_bacteria 2841840854 2841842845 121
51 iso_pu_bacteria 2842140634 2842142626 121
52 iso_pu_bacteria 2842521101 2842525186 121
53 iso_pu_bacteria 2844163670 2844163865 121
54 iso_pu_bacteria 2847417321 2847417983 121
55 iso_pu_bacteria 2854896431 2854898680 121
56 iso_pu_bacteria 2854916844 2854921716 121
57 iso_pu_bacteria 2855872281 2855879022 121
58 iso_pu_bacteria 2857531043 2857531587 121
59 iso_pu_bacteria 2896384573 2896386515 121
60 iso_pu_bacteria 2899803654 2899806064 121
61 iso_pu_bacteria 2913295892 2913297564 121
62 iso_pu_bacteria 2917554339 2917558466 121
63 iso_pu_bacteria 2919171160 2919171653 121
64 iso_pu_bacteria 2920822456 2920823716 121
65 iso_pu_bacteria 2937049772 2937052674 121
66 iso_pu_bacteria 2941499720 2941500351 121
67 iso_pu_bacteria 2970040964 2970043004 121
68 iso_pu_bacteria 2970116247 2970118063 121
69 iso_pu_bacteria 2977579622 2977581590 121
70 iso_pu_bacteria 2989349275 2989354349 121
71 iso_pu_bacteria 2989771324 2989771861 121
72 iso_pu_bacteria 3003930520 3003932450 121
73 iso_pu_bacteria 643692032 643824959 121
74 iso_pu_bacteria 8002285264 8002287972 121
75 iso_pu_bacteria 8005658619 8005662334 121
76 iso_pu_bacteria 8045864390 8045868493 121
77 iso_pu_bacteria 8049293176 8049293790 121
78 iso_pu_bacteria 8054558443 8054560128 121
79 iso_pu_bacteria 8055431914 8055434014 121
80 iso_pu_bacteria 8056875544 8056879940 121
81 iso_pu_bacteria 2891373044 2891376517 122
82 3300005539 Ga0068853_102286883 Ga0068853_1022868831 124
83 3300010375 Ga0105239_10240681 Ga0105239_102406812 124
84 3300026041 Ga0207639_11865339 Ga0207639_118653392 124
85 3300028794 Ga0307515_10468362 Ga0307515_104683622 124
86 3300028794 Ga0307515_10509542 Ga0307515_105095422 124
87 3300037471 Ga0395905_0001129 Ga0395905_0001129_28015_28389 124
88 3300037471 Ga0395905_0005656 Ga0395905_0005656_7025_7399 124
89 3300048924 Ga0496121_0059295 Ga0496121_0059295_666_1040 124
90 3300049581 Ga0501047_0777099 Ga0501047_0777099_265_639 124
91 3300049742 Ga0501080_0196847 Ga0501080_0196847_969_1343 124
92 3300053136 Ga0500559_0007396 Ga0500559_0007396_2333_2707 124
93 3300002704 JGI25155J39150_1000089 JGI25155J39150_100008927 125
94 3300002705 JGI25156J39149_1000147 JGI25156J39149_100014726 125
95 3300002738 JGI25154J39366_1000160 JGI25154J39366_100016038 125
96 3300002741 JGI25157J39369_1000190 JGI25157J39369_100019026 125
97 3300003187 JGI25151J46595_10016398 JGI25151J46595_100163982 125
98 3300003187 JGI25151J46595_10027999 JGI25151J46595_100279993 125
99 3300003187 JGI25151J46595_10148679 JGI25151J46595_101486792 125
100 3300003354 JGI25160J50197_1000002 JGI25160J50197_100000244 125
101 3300003374 JGI25161J50226_1000944 JGI25161J50226_10009442 125
102 3300003771 Ga0055526_1001202 Ga0055526_100120214 125
103 3300003775 Ga0055524_1000890 Ga0055524_100089010 125
104 3300003775 Ga0055524_1061012 Ga0055524_10610121 125
105 3300003781 Ga0055536_1002285 Ga0055536_100228510 125
106 3300003781 Ga0055536_1008469 Ga0055536_10084693 125
107 3300003781 Ga0055536_1013355 Ga0055536_10133554 125
108 3300003791 Ga0055530_10027702 Ga0055530_100277023 125
109 3300003791 Ga0055530_10035124 Ga0055530_100351242 125
110 3300003792 Ga0055540_1011709 Ga0055540_10117093 125
111 3300003792 Ga0055540_1016968 Ga0055540_10169681 125
112 3300003794 Ga0055531_10002384 Ga0055531_100023847 125
113 3300003794 Ga0055531_10010596 Ga0055531_100105963 125
114 3300004625 Ga0055543_1000137 Ga0055543_100013743 125
115 3300005262 Ga0065165_1000004 Ga0065165_1000004338 125
116 3300005548 Ga0070665_100021793 Ga0070665_1000217933 125
117 3300006038 Ga0075365_10271940 Ga0075365_102719402 125
118 3300006038 Ga0075365_11196388 Ga0075365_111963881 125
119 3300006051 Ga0075364_10719745 Ga0075364_107197451 125
120 3300006178 Ga0075367_10692815 Ga0075367_106928152 125
121 3300006946 Ga0079104_1000010 Ga0079104_1000010202 125
122 3300009148 Ga0105243_11320416 Ga0105243_113204162 125
123 3300009176 Ga0105242_10802630 Ga0105242_108026302 125
124 3300013100 Ga0157373_10015734 Ga0157373_100157348 125
125 3300013102 Ga0157371_10451966 Ga0157371_104519662 125
126 3300013104 Ga0157370_10084955 Ga0157370_100849552 125
127 3300013105 Ga0157369_10133455 Ga0157369_101334552 125
128 3300013249 Ga0171463_1001 Ga0171463_1001357 125
129 3300014326 Ga0157380_11077648 Ga0157380_110776481 125
130 3300015690 Ga0183363_1114 Ga0183363_111418 125
131 3300017792 Ga0163161_10633768 Ga0163161_106337682 125
132 3300021320 Ga0214544_1000008 Ga0214544_100000875 125
133 3300021321 Ga0214542_1000010 Ga0214542_100001031 125
134 3300021321 Ga0214542_1020572 Ga0214542_10205726 125
135 3300021327 Ga0214543_1000003 Ga0214543_1000003346 125
136 3300021327 Ga0214543_1000004 Ga0214543_100000453 125
137 3300025206 Ga0209435_100036 Ga0209435_10003638 125
138 3300025208 Ga0209436_100270 Ga0209436_10027014 125
139 3300025246 Ga0209646_1000132 Ga0209646_100013238 125
140 3300025250 Ga0209026_1000313 Ga0209026_100031325 125
141 3300025256 Ga0209759_1000417 Ga0209759_100041725 125
142 3300025284 Ga0209130_1000008 Ga0209130_1000008497 125
143 3300025284 Ga0209130_1040591 Ga0209130_10405912 125
144 3300025292 Ga0209676_1000885 Ga0209676_100088533 125
145 3300025292 Ga0209676_1020481 Ga0209676_10204813 125
146 3300025294 Ga0209025_1000100 Ga0209025_100010083 125
147 3300025294 Ga0209025_1000165 Ga0209025_1000165105 125
148 3300025294 Ga0209025_1016948 Ga0209025_10169485 125
149 3300025294 Ga0209025_1025386 Ga0209025_10253863 125
150 3300025295 Ga0209564_1000104 Ga0209564_1000104179 125
151 3300025295 Ga0209564_1042287 Ga0209564_10422872 125
152 3300025297 Ga0209758_1000121 Ga0209758_100012153 125
153 3300025297 Ga0209758_1054679 Ga0209758_10546793 125
154 3300025298 Ga0209050_1001445 Ga0209050_100144519 125
155 3300025298 Ga0209050_1003961 Ga0209050_100396114 125
156 3300025299 Ga0209256_1000351 Ga0209256_100035132 125
157 3300025299 Ga0209256_1000723 Ga0209256_100072325 125
158 3300025302 Ga0207426_1000016 Ga0207426_100001665 125
159 3300025303 Ga0209051_1001278 Ga0209051_100127810 125
160 3300025303 Ga0209051_1001973 Ga0209051_100197313 125
161 3300025304 Ga0209257_1002305 Ga0209257_100230512 125
162 3300026118 Ga0207675_102195262 Ga0207675_1021952621 125
163 3300027111 Ga0209281_1000078 Ga0209281_100007883 125
164 3300028379 Ga0268266_10015136 Ga0268266_100151367 125
165 3300028794 Ga0307515_10000115 Ga0307515_1000011556 125
166 3300028794 Ga0307515_10018668 Ga0307515_100186684 125
167 3300031456 Ga0307513_10362123 Ga0307513_103621232 125
168 3300031548 Ga0307408_101479674 Ga0307408_1014796742 125
169 3300031727 Ga0316576_10493818 Ga0316576_104938181 125
170 3300031901 Ga0307406_10028744 Ga0307406_100287442 125
171 3300031911 Ga0307412_11598345 Ga0307412_115983452 125
172 3300032002 Ga0307416_103266526 Ga0307416_1032665262 125
173 3300032004 Ga0307414_10406742 Ga0307414_104067423 125
174 3300032004 Ga0307414_10834245 Ga0307414_108342452 125
175 3300032005 Ga0307411_11529406 Ga0307411_115294061 125
176 3300032168 Ga0316593_10041972 Ga0316593_100419722 125
177 3300035398 Ga0316574_0319573 Ga0316574_0319573_373_750 125
178 3300036647 Ga0316582_0821416 Ga0316582_0821416_131_508 125
179 3300036712 Ga0316584_0413113 Ga0316584_0413113_409_786 125
180 3300037418 Ga0395900_0187399 Ga0395900_0187399_257_634 125
181 3300037466 Ga0395898_1558142 Ga0395898_1558142_142_519 125
182 3300037471 Ga0395905_0104312 Ga0395905_0104312_1588_1965 125
183 3300041406 Ga0439439_0011585 Ga0439439_0011585_438_815 125
184 3300041408 Ga0439453_0042008 Ga0439453_0042008_344_721 125
185 3300041411 Ga0439466_0062653 Ga0439466_0062653_42_419 125
186 3300041413 Ga0439465_0003572 Ga0439465_0003572_3925_4302 125
187 3300041413 Ga0439465_0356517 Ga0439465_0356517_62_439 125
188 3300041999 Ga0439433_0030965 Ga0439433_0030965_110_487 125
189 3300042006 Ga0439432_109431 Ga0439432_109431_420_797 125
190 3300042006 Ga0439432_255710 Ga0439432_255710_98_475 125
191 3300042007 Ga0439449_0005496 Ga0439449_0005496_4390_4767 125
192 3300042007 Ga0439449_0039109 Ga0439449_0039109_910_1287 125
193 3300042015 Ga0439462_0049869 Ga0439462_0049869_78_455 125
194 3300042121 Ga0450919_016035 Ga0450919_016035_333_710 125
195 3300042122 Ga0450920_081665 Ga0450920_081665_32_409 125
196 3300042147 Ga0450910_005246 Ga0450910_005246_501_878 125
197 3300042184 Ga0450908_069418 Ga0450908_069418_219_596 125
198 3300042435 Ga0439434_0022429 Ga0439434_0022429_782_1159 125
199 3300042531 Ga0450918_002771 Ga0450918_002771_1292_1669 125
200 3300044683 Ga0466965_0278252 Ga0466965_0278252_178_555 125
201 3300046460 Ga0495638_0023467 Ga0495638_0023467_3460_3837 125
202 3300046530 Ga0495654_0000223 Ga0495654_0000223_20631_21008 125
203 3300046674 Ga0495588_0167565 Ga0495588_0167565_656_1033 125
204 3300047472 Ga0495686_0165536 Ga0495686_0165536_385_762 125
205 3300048913 Ga0496110_0192266 Ga0496110_0192266_235_612 125
206 3300048914 Ga0496111_0000142 Ga0496111_0000142_18552_18929 125
207 3300048920 Ga0496117_0001371 Ga0496117_0001371_9818_10198 125
208 3300048923 Ga0496120_0197773 Ga0496120_0197773_548_928 125
209 3300048924 Ga0496121_0022545 Ga0496121_0022545_4493_4870 125
210 3300048925 Ga0496122_0000009 Ga0496122_0000009_144953_145330 125
211 3300048925 Ga0496122_0000205 Ga0496122_0000205_101485_101865 125
212 3300048925 Ga0496122_0104844 Ga0496122_0104844_1186_1563 125
213 3300048926 Ga0496123_0000103 Ga0496123_0000103_101485_101865 125
214 3300048926 Ga0496123_0000245 Ga0496123_0000245_50210_50587 125
215 3300048926 Ga0496123_0012018 Ga0496123_0012018_1351_1728 125
216 3300048927 Ga0496124_0001609 Ga0496124_0001609_10282_10662 125
217 3300048927 Ga0496124_0017562 Ga0496124_0017562_1689_2066 125
218 3300048927 Ga0496124_0070003 Ga0496124_0070003_744_1121 125
219 3300048927 Ga0496124_0224788 Ga0496124_0224788_159_539 125
220 3300048927 Ga0496124_0456010 Ga0496124_0456010_319_696 125
221 3300048927 Ga0496124_0561082 Ga0496124_0561082_107_484 125
222 3300048928 Ga0496125_0000879 Ga0496125_0000879_33374_33754 125
223 3300048928 Ga0496125_0721635 Ga0496125_0721635_113_490 125
224 3300048929 Ga0496126_0001035 Ga0496126_0001035_10433_10810 125
225 3300048929 Ga0496126_0072797 Ga0496126_0072797_486_863 125
226 3300049568 Ga0501031_0035224 Ga0501031_0035224_1184_1561 125
227 3300049571 Ga0501034_0016781 Ga0501034_0016781_4217_4594 125
228 3300049571 Ga0501034_0122106 Ga0501034_0122106_1639_2016 125
229 3300049571 Ga0501034_0123762 Ga0501034_0123762_80_457 125
230 3300049592 Ga0501076_1398441 Ga0501076_1398441_96_473 125
231 3300049671 Ga0501238_034503 Ga0501238_034503_205_582 125
232 3300049744 Ga0501083_0124800 Ga0501083_0124800_258_635 125
233 3300050492 nmdc:mga0yw44_218562_c1 nmdc:mga0yw44_218562_c1_101_478 125
234 3300053125 Ga0500618_000007 Ga0500618_000007_47511_47888 125
235 3300053125 Ga0500618_015312 Ga0500618_015312_1535_1912 125
236 3300053151 Ga0500604_0040404 Ga0500604_0040404_67_444 125
237 3300053153 Ga0500616_0000599 Ga0500616_0000599_20173_20550 125
238 3300053157 Ga0500624_074879 Ga0500624_074879_162_539 125
239 3300053161 Ga0500634_0007251 Ga0500634_0007251_981_1358 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

4

113

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wg5-assembly1.cif.gz_E cyclic electron transport supercomplex ndh-psi from arabidopsis 0.7566 2 100
7wg5-assembly1.cif.gz_E cyclic electron transport supercomplex ndh-psi from arabidopsis 0.7004 2 100
6z16-assembly1.cif.gz_c structure of the mrp antiporter complex 0.6918 1 110
6z16-assembly1.cif.gz_c structure of the mrp antiporter complex 0.6805 1 110
7p64-assembly1.cif.gz_K complex i from e. coli, ddm/lmng-purified, under turnover at ph 6, open state 0.6792 7 118
ID Description Score Start End Superfamily
af_P0AEW1_127_216_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7298 7 110 1.10.287.3510
3rkoK00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7209 6 109 1.10.287.3510
af_P9WIX3_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.717 5 112 1.10.287.3510
af_Q57879_1_79_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.716 1 98 1.10.287.3510
af_Q2FZV3_3_109_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6992 4 111 1.10.287.3510
ID Description Score Start End GO Terms
AF-I3X0B2-F1-model_v4 Na(+)/H(+) antiporter subunit D 0.7504 1 125 GO:0005886
GO:0008137
GO:0042773
AF-I3X0B2-F1-model_v4 Na(+)/H(+) antiporter subunit D 0.7453 1 125 GO:0005886
GO:0008137
GO:0042773
AF-A0A3N1JAI9-F1-model_v4 Multisubunit Na+/H+ antiporter MnhC subunit 0.7421 4 107 GO:0005886
AF-A0A2W4LV64-F1-model_v4 Sodium:proton antiporter 0.7362 1 112 GO:0005886
AF-A0A662E813-F1-model_v4 Sodium:proton antiporter 0.7328 1 107 GO:0005886

Feature Viewer

pLDDT pTM Quality
82.47 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map