F351721

General Info

Members Datasets Scaffolds Average Seq Length
239 122 478 293

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10042138|Ga0070681_100421382
Length 307
Sequence VPVPGAGMSAHGITRADLQAVNLPRRRVVNRVMQLLCTLAALIAVGLLVIIVYSVAKRGFAALNLDLLTKDPANSFSFGAPVKEGLANAFVGSLVLVGLATAMTLPVGILIAIYLIEFAPPTIRSGVSVVLDVLNGVPAIVIGIFVYGLIVIGSGQSGWAGAFALACLMLPILTRSTMEVLRLVPGSLREASLGLGIPRWRTTLSIVLPQALGGIVTGTVLAIARVAGETAPLLFTSSLVGTKTSWNPFHALQSVPVAIFELSEQPDPASHARAWAAALVLLLFILFTSLTARYFASRSRRKLTAGR

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
19 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
20 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
21 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
22 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
23 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
41 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
42 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
43 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
44 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
45 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
46 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
47 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
48 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
49 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
50 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
51 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
52 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
53 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
54 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
58 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
59 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
60 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
61 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
88 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
89 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
90 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
91 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
94 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
95 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
96 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
97 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
107 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
117 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
118 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
119 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
121 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
122 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 5.86
Rhizosphere 93.31
Stem 0
Stem Tuber 0
Unclassified 1.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10042138 3300005458 Bacteria 4576
2 Ga0070658_10017837 3300005327 Bacteria 5677
3 Ga0070658_10055488 3300005327 Bacteria 3219
4 Ga0070683_100042768 3300005329 Bacteria 4173
5 Ga0070660_100014624 3300005339 Bacteria 5661
6 Ga0070660_100015413 3300005339 Bacteria 5519
7 Ga0070660_100411686 3300005339 Bacteria 1119
8 Ga0070661_100002256 3300005344 Bacteria 13217
9 Ga0070661_100205518 3300005344 Bacteria 1506
10 Ga0070659_100234841 3300005366 Bacteria 1516
11 Ga0070709_10050037 3300005434 Bacteria 2616
12 Ga0070714_100013500 3300005435 Bacteria 6548
13 Ga0070714_100093595 3300005435 Bacteria 2636
14 Ga0070714_100274714 3300005435 Bacteria 1564
15 Ga0070714_100300689 3300005435 Bacteria 1496
16 Ga0070714_100408428 3300005435 Bacteria 1285
17 Ga0070714_100552046 3300005435 Bacteria 1103
18 Ga0070713_100337864 3300005436 Bacteria 1395
19 Ga0070708_100492729 3300005445 Unclassified 1156
20 Ga0070681_10015981 3300005458 Bacteria 7484
21 Ga0070681_10035382 3300005458 Bacteria 5017
22 Ga0070681_10063530 3300005458 Bacteria 3664
23 Ga0070681_10385602 3300005458 Bacteria 1312
24 Ga0070707_100270890 3300005468 Bacteria 1651
25 Ga0070698_100170870 3300005471 Bacteria 2115
26 Ga0070679_100185174 3300005530 Bacteria 2053
27 Ga0070679_100236165 3300005530 Bacteria 1787
28 Ga0070679_100263449 3300005530 Bacteria 1679
29 Ga0070684_100009303 3300005535 Bacteria 7735
30 Ga0070684_100155857 3300005535 Bacteria 2071
31 Ga0068855_100049669 3300005563 Bacteria 4946
32 Ga0105240_10172747 3300009093 Bacteria 2558
33 Ga0105238_10096783 3300009551 Bacteria 2937
34 Ga0105238_10304103 3300009551 Bacteria 1579
35 Ga0157370_10012865 3300013104 Bacteria 8651
36 Ga0157370_10075634 3300013104 Bacteria 3174
37 Ga0157369_10008041 3300013105 Bacteria 12095
38 Ga0157369_10018488 3300013105 Bacteria 7813
39 Ga0157372_10519984 3300013307 Bacteria 1387
40 Ga0182008_10010399 3300014497 Bacteria 4981
41 Ga0182008_10070375 3300014497 Bacteria 1721
42 Ga0182006_1050986 3300015261 Bacteria 1593
43 Ga0206354_10841045 3300020081 Bacteria 1892
44 Ga0207699_10143058 3300025906 Bacteria 1574
45 Ga0207707_10017295 3300025912 Bacteria 6285
46 Ga0207707_10031160 3300025912 Bacteria 4666
47 Ga0207707_10076900 3300025912 Bacteria 2913
48 Ga0207695_10121922 3300025913 Bacteria 2574
49 Ga0207693_10103708 3300025915 Bacteria 2231
50 Ga0207660_10034003 3300025917 Bacteria 3530
51 Ga0207660_10158605 3300025917 Bacteria 1744
52 Ga0207657_10009290 3300025919 Bacteria 9904
53 Ga0207657_10018203 3300025919 Bacteria 6720
54 Ga0207657_10026670 3300025919 Bacteria 5304
55 Ga0207649_10062381 3300025920 Bacteria 2350
56 Ga0207649_10305334 3300025920 Bacteria 1165
57 Ga0207652_10019733 3300025921 Bacteria 5546
58 Ga0207652_10485592 3300025921 Bacteria 1113
59 Ga0207646_10095682 3300025922 Bacteria 2661
60 Ga0207646_10259635 3300025922 Bacteria 1570
61 Ga0207700_10011526 3300025928 Bacteria 5643
62 Ga0207700_10291785 3300025928 Bacteria 1406
63 Ga0207700_10377036 3300025928 Bacteria 1240
64 Ga0207664_10003292 3300025929 Bacteria 10740
65 Ga0207664_10028107 3300025929 Bacteria 4271
66 Ga0207664_10101117 3300025929 Bacteria 2381
67 Ga0207664_10143803 3300025929 Bacteria 2021
68 Ga0207664_10194442 3300025929 Bacteria 1748
69 Ga0207690_10153194 3300025932 Bacteria 1711
70 Ga0207665_10228801 3300025939 Bacteria 1366
71 Ga0207661_10031054 3300025944 Bacteria 4122
72 Ga0207667_10085766 3300025949 Bacteria 3259
73 Ga0207639_10387929 3300026041 Bacteria 1256
74 Ga0265319_1000985 3300028563 Bacteria 17873
75 Ga0265319_1009282 3300028563 Bacteria 4209
76 Ga0265334_10009217 3300028573 Bacteria 4180
77 Ga0265318_10000633 3300028577 Bacteria 24181
78 Ga0265318_10000863 3300028577 Bacteria 19925
79 Ga0265318_10023768 3300028577 Bacteria 2438
80 Ga0265322_10039974 3300028654 Bacteria 1335
81 Ga0265338_10000811 3300028800 Bacteria 52712
82 Ga0265338_10007397 3300028800 Bacteria 13647
83 Ga0265338_10011459 3300028800 Bacteria 10237
84 Ga0265338_10011482 3300028800 Bacteria 10226
85 Ga0265338_10013126 3300028800 Bacteria 9386
86 Ga0265338_10031813 3300028800 Bacteria 5163
87 Ga0265338_10110031 3300028800 Bacteria 2221
88 Ga0265324_10026480 3300029957 Bacteria 2052
89 Ga0265330_10002570 3300031235 Bacteria 9854
90 Ga0265330_10012639 3300031235 Bacteria 3945
91 Ga0265332_10014143 3300031238 Bacteria 3531
92 Ga0265328_10007941 3300031239 Bacteria 4404
93 Ga0265320_10011297 3300031240 Bacteria 5261
94 Ga0265320_10020407 3300031240 Bacteria 3594
95 Ga0265325_10006204 3300031241 Bacteria 7288
96 Ga0265325_10046455 3300031241 Bacteria 2252
97 Ga0265329_10005681 3300031242 Bacteria 5013
98 Ga0265329_10005871 3300031242 Bacteria 4922
99 Ga0265340_10011167 3300031247 Bacteria 4783
100 Ga0265340_10048058 3300031247 Bacteria 2075
101 Ga0265340_10093874 3300031247 Bacteria 1400
102 Ga0265339_10025872 3300031249 Bacteria 3363
103 Ga0265339_10040100 3300031249 Bacteria 2603
104 Ga0265339_10159440 3300031249 Bacteria 1136
105 Ga0265331_10008506 3300031250 Bacteria 5834
106 Ga0265331_10029032 3300031250 Bacteria 2763
107 Ga0265327_10003744 3300031251 Bacteria 14140
108 Ga0265327_10019635 3300031251 Bacteria 4146
109 Ga0265327_10027647 3300031251 Bacteria 3259
110 Ga0265327_10050756 3300031251 Bacteria 2168
111 Ga0265316_10025029 3300031344 Bacteria 4986
112 Ga0265316_10042775 3300031344 Bacteria 3617
113 Ga0265316_10094511 3300031344 Bacteria 2277
114 Ga0265313_10015348 3300031595 Bacteria 4466
115 Ga0265313_10019544 3300031595 Bacteria 3764
116 Ga0265314_10017605 3300031711 Bacteria 5602
117 Ga0265314_10027444 3300031711 Bacteria 4262
118 Ga0265314_10118085 3300031711 Bacteria 1674
119 Ga0316583_10035166 3300032133 Bacteria 1778
120 Ga0373957_0016787 3300035120 Bacteria 2541
121 Ga0373935_0262104 3300035692 Bacteria 1212
122 Ga0373937_0005253 3300036401 Bacteria 11057
123 Ga0373937_0450520 3300036401 Bacteria 1222
124 Ga0395899_0184879 3300037312 Bacteria 1461
125 Ga0395900_0039606 3300037418 Bacteria 4855
126 Ga0395900_0530945 3300037418 Bacteria 1123
127 Ga0395898_0024742 3300037466 Bacteria 6053
128 Ga0395898_0096918 3300037466 Bacteria 2833
129 Ga0395898_0165861 3300037466 Bacteria 2112
130 Ga0395898_0224575 3300037466 Bacteria 1791
131 Ga0395898_0362059 3300037466 Bacteria 1383
132 Ga0395905_0028379 3300037471 Bacteria 5276
133 Ga0395905_0062693 3300037471 Bacteria 3477
134 Ga0395905_0202902 3300037471 Bacteria 1859
135 Ga0395905_0313078 3300037471 Bacteria 1458
136 Ga0395901_0041902 3300038443 Bacteria 4746
137 Ga0395901_0101175 3300038443 Bacteria 3024
138 Ga0395901_0304993 3300038443 Bacteria 1650
139 Ga0395901_0387956 3300038443 Bacteria 1436
140 Ga0395901_0529211 3300038443 Bacteria 1197
141 Ga0395901_0605369 3300038443 Unclassified 1104
142 Ga0436360_0731594 3300039438 Bacteria 15643
143 Ga0466965_0059647 3300044683 Bacteria 1905
144 Ga0466961_0005404 3300044693 Bacteria 8047
145 Ga0466961_0050659 3300044693 Bacteria 2652
146 Ga0466961_0062040 3300044693 Bacteria 2375
147 Ga0466961_0123723 3300044693 Bacteria 1623
148 Ga0466963_0003151 3300044694 Bacteria 9360
149 Ga0466963_0003364 3300044694 Bacteria 9131
150 Ga0466963_0009456 3300044694 Bacteria 5870
151 Ga0466963_0013036 3300044694 Bacteria 5096
152 Ga0466963_0015847 3300044694 Bacteria 4678
153 Ga0466963_0020921 3300044694 Bacteria 4121
154 Ga0466963_0035584 3300044694 Bacteria 3245
155 Ga0466963_0086783 3300044694 Bacteria 2127
156 Ga0466963_0149836 3300044694 Bacteria 1619
157 Ga0466964_0046361 3300044706 Bacteria 1771
158 Ga0453684_0580878 3300044712 Bacteria 1231
159 Ga0466971_0051783 3300044719 Bacteria 1848
160 Ga0466971_0105507 3300044719 Bacteria 1298
161 Ga0466968_0003890 3300044735 Bacteria 5542
162 Ga0466968_0012352 3300044735 Bacteria 3342
163 Ga0466957_0004817 3300044842 Bacteria 7554
164 Ga0466957_0008551 3300044842 Bacteria 5825
165 Ga0466957_0061862 3300044842 Bacteria 2299
166 Ga0466960_0069467 3300044901 Bacteria 1750
167 Ga0466959_0029173 3300045049 Bacteria 4088
168 Ga0466959_0258926 3300045049 Bacteria 1198
169 Ga0466959_0312086 3300045049 Bacteria 1076
170 Ga0466958_0012875 3300045836 Bacteria 4748
171 Ga0466958_0161904 3300045836 Bacteria 1414
172 Ga0466958_0211233 3300045836 Bacteria 1236
173 Ga0466967_0020340 3300045976 Bacteria 5362
174 Ga0466967_0027496 3300045976 Bacteria 4733
175 Ga0466967_0038232 3300045976 Bacteria 4114
176 Ga0466967_0068697 3300045976 Bacteria 3165
177 Ga0466967_0087354 3300045976 Bacteria 2827
178 Ga0466967_0093248 3300045976 Bacteria 2739
179 Ga0466967_0177712 3300045976 Bacteria 2006
180 Ga0466967_0297392 3300045976 Bacteria 1552
181 Ga0495629_0005257 3300046459 Bacteria 9680
182 Ga0495651_0040403 3300046462 Bacteria 3628
183 Ga0495653_0008519 3300046463 Bacteria 8410
184 Ga0495608_0022398 3300046511 Bacteria 4331
185 Ga0495608_0099565 3300046511 Bacteria 1875
186 Ga0495630_0320209 3300046517 Bacteria 1185
187 Ga0495652_0231607 3300046529 Bacteria 1381
188 Ga0495587_0120229 3300046536 Bacteria 1505
189 Ga0495667_0004579 3300046559 Bacteria 9345
190 Ga0495634_0011958 3300046642 Bacteria 6297
191 Ga0495635_0089086 3300046663 Bacteria 2111
192 Ga0495657_0011048 3300046675 Bacteria 6771
193 Ga0495613_0014833 3300046689 Bacteria 5783
194 Ga0495600_0022606 3300046809 Bacteria 4039
195 Ga0495604_0131984 3300047317 Bacteria 1794
196 Ga0495676_0128879 3300047321 Bacteria 1830
197 Ga0495680_0007127 3300047322 Bacteria 10296
198 Ga0495680_0052210 3300047322 Bacteria 3188
199 Ga0495684_0116873 3300047471 Bacteria 2010
200 Ga0496106_0009131 3300048909 Bacteria 7327
201 Ga0496107_0003956 3300048910 Bacteria 9970
202 Ga0496108_0315908 3300048911 Bacteria 1362
203 Ga0496109_0017919 3300048912 Bacteria 6216
204 Ga0496109_0272137 3300048912 Bacteria 1596
205 Ga0496110_0259014 3300048913 Bacteria 1583
206 Ga0496112_0024061 3300048915 Bacteria 5828
207 Ga0496112_0039595 3300048915 Bacteria 4607
208 Ga0496112_0062581 3300048915 Bacteria 3671
209 Ga0496112_0078609 3300048915 Bacteria 3262
210 Ga0496112_0200602 3300048915 Bacteria 1954
211 Ga0496112_0383744 3300048915 Bacteria 1346
212 Ga0496115_0096543 3300048918 Bacteria 2420
213 Ga0496115_0181665 3300048918 Bacteria 1739
214 Ga0496126_0073052 3300048929 Bacteria 3050
215 Ga0501067_0008976 3300049583 Bacteria 5542
216 Ga0501067_0023892 3300049583 Bacteria 3389
217 Ga0501067_0114135 3300049583 Bacteria 1502
218 Ga0501069_0025791 3300049585 Bacteria 3214
219 Ga0501069_0062619 3300049585 Bacteria 2077
220 Ga0501070_0012113 3300049586 Bacteria 7279
221 Ga0501070_0048414 3300049586 Bacteria 3531
222 Ga0501072_0005382 3300049588 Bacteria 9743
223 Ga0501073_0064760 3300049589 Bacteria 2549
224 Ga0501074_0060853 3300049590 Bacteria 2720
225 Ga0501079_0006203 3300049741 Bacteria 8970
226 Ga0501080_0000309 3300049742 Bacteria 37361
227 Ga0501080_0034208 3300049742 Bacteria 4742
228 Ga0501083_0009873 3300049744 Bacteria 6740
229 nmdc:mga0n895_209761_c2 3300050512 Bacteria 1230
230 nmdc:mga08x19_141148_c1 3300050514 Bacteria 1627
231 nmdc:mga08x19_285521_c1 3300050514 Bacteria 1144
232 Ga0495595_0105510 3300053084 Bacteria 1363
233 Ga0495619_0022331 3300053085 Bacteria 4048
234 Ga0500566_0087001 3300053094 Bacteria 1731
235 Ga0501082_0338579 3300060353 Bacteria 1311
236 Ga0466962_0001894 3300061719 Bacteria 9847
237 Ga0466962_0080248 3300061719 Bacteria 1560
238 Ga0466962_0124775 3300061719 Unclassified 1243
239 Ga0530510_0100591 3300061734 Bacteria 2114
240 Ga0070681_10042138
241 Ga0070658_10017837
242 Ga0070658_10055488
243 Ga0070683_100042768
244 Ga0070660_100014624
245 Ga0070660_100015413
246 Ga0070660_100411686
247 Ga0070661_100002256
248 Ga0070661_100205518
249 Ga0070659_100234841
250 Ga0070709_10050037
251 Ga0070714_100013500
252 Ga0070714_100093595
253 Ga0070714_100274714
254 Ga0070714_100300689
255 Ga0070714_100408428
256 Ga0070714_100552046
257 Ga0070713_100337864
258 Ga0070708_100492729
259 Ga0070681_10015981
260 Ga0070681_10035382
261 Ga0070681_10063530
262 Ga0070681_10385602
263 Ga0070707_100270890
264 Ga0070698_100170870
265 Ga0070679_100185174
266 Ga0070679_100236165
267 Ga0070679_100263449
268 Ga0070684_100009303
269 Ga0070684_100155857
270 Ga0068855_100049669
271 Ga0105240_10172747
272 Ga0105238_10096783
273 Ga0105238_10304103
274 Ga0157370_10012865
275 Ga0157370_10075634
276 Ga0157369_10008041
277 Ga0157369_10018488
278 Ga0157372_10519984
279 Ga0182008_10010399
280 Ga0182008_10070375
281 Ga0182006_1050986
282 Ga0206354_10841045
283 Ga0207699_10143058
284 Ga0207707_10017295
285 Ga0207707_10031160
286 Ga0207707_10076900
287 Ga0207695_10121922
288 Ga0207693_10103708
289 Ga0207660_10034003
290 Ga0207660_10158605
291 Ga0207657_10009290
292 Ga0207657_10018203
293 Ga0207657_10026670
294 Ga0207649_10062381
295 Ga0207649_10305334
296 Ga0207652_10019733
297 Ga0207652_10485592
298 Ga0207646_10095682
299 Ga0207646_10259635
300 Ga0207700_10011526
301 Ga0207700_10291785
302 Ga0207700_10377036
303 Ga0207664_10003292
304 Ga0207664_10028107
305 Ga0207664_10101117
306 Ga0207664_10143803
307 Ga0207664_10194442
308 Ga0207690_10153194
309 Ga0207665_10228801
310 Ga0207661_10031054
311 Ga0207667_10085766
312 Ga0207639_10387929
313 Ga0265319_1000985
314 Ga0265319_1009282
315 Ga0265334_10009217
316 Ga0265318_10000633
317 Ga0265318_10000863
318 Ga0265318_10023768
319 Ga0265322_10039974
320 Ga0265338_10000811
321 Ga0265338_10007397
322 Ga0265338_10011459
323 Ga0265338_10011482
324 Ga0265338_10013126
325 Ga0265338_10031813
326 Ga0265338_10110031
327 Ga0265324_10026480
328 Ga0265330_10002570
329 Ga0265330_10012639
330 Ga0265332_10014143
331 Ga0265328_10007941
332 Ga0265320_10011297
333 Ga0265320_10020407
334 Ga0265325_10006204
335 Ga0265325_10046455
336 Ga0265329_10005681
337 Ga0265329_10005871
338 Ga0265340_10011167
339 Ga0265340_10048058
340 Ga0265340_10093874
341 Ga0265339_10025872
342 Ga0265339_10040100
343 Ga0265339_10159440
344 Ga0265331_10008506
345 Ga0265331_10029032
346 Ga0265327_10003744
347 Ga0265327_10019635
348 Ga0265327_10027647
349 Ga0265327_10050756
350 Ga0265316_10025029
351 Ga0265316_10042775
352 Ga0265316_10094511
353 Ga0265313_10015348
354 Ga0265313_10019544
355 Ga0265314_10017605
356 Ga0265314_10027444
357 Ga0265314_10118085
358 Ga0316583_10035166
359 Ga0373957_0016787
360 Ga0373935_0262104
361 Ga0373937_0005253
362 Ga0373937_0450520
363 Ga0395899_0184879
364 Ga0395900_0039606
365 Ga0395900_0530945
366 Ga0395898_0024742
367 Ga0395898_0096918
368 Ga0395898_0165861
369 Ga0395898_0224575
370 Ga0395898_0362059
371 Ga0395905_0028379
372 Ga0395905_0062693
373 Ga0395905_0202902
374 Ga0395905_0313078
375 Ga0395901_0041902
376 Ga0395901_0101175
377 Ga0395901_0304993
378 Ga0395901_0387956
379 Ga0395901_0529211
380 Ga0395901_0605369
381 Ga0436360_0731594
382 Ga0466965_0059647
383 Ga0466961_0005404
384 Ga0466961_0050659
385 Ga0466961_0062040
386 Ga0466961_0123723
387 Ga0466963_0003151
388 Ga0466963_0003364
389 Ga0466963_0009456
390 Ga0466963_0013036
391 Ga0466963_0015847
392 Ga0466963_0020921
393 Ga0466963_0035584
394 Ga0466963_0086783
395 Ga0466963_0149836
396 Ga0466964_0046361
397 Ga0453684_0580878
398 Ga0466971_0051783
399 Ga0466971_0105507
400 Ga0466968_0003890
401 Ga0466968_0012352
402 Ga0466957_0004817
403 Ga0466957_0008551
404 Ga0466957_0061862
405 Ga0466960_0069467
406 Ga0466959_0029173
407 Ga0466959_0258926
408 Ga0466959_0312086
409 Ga0466958_0012875
410 Ga0466958_0161904
411 Ga0466958_0211233
412 Ga0466967_0020340
413 Ga0466967_0027496
414 Ga0466967_0038232
415 Ga0466967_0068697
416 Ga0466967_0087354
417 Ga0466967_0093248
418 Ga0466967_0177712
419 Ga0466967_0297392
420 Ga0495629_0005257
421 Ga0495651_0040403
422 Ga0495653_0008519
423 Ga0495608_0022398
424 Ga0495608_0099565
425 Ga0495630_0320209
426 Ga0495652_0231607
427 Ga0495587_0120229
428 Ga0495667_0004579
429 Ga0495634_0011958
430 Ga0495635_0089086
431 Ga0495657_0011048
432 Ga0495613_0014833
433 Ga0495600_0022606
434 Ga0495604_0131984
435 Ga0495676_0128879
436 Ga0495680_0007127
437 Ga0495680_0052210
438 Ga0495684_0116873
439 Ga0496106_0009131
440 Ga0496107_0003956
441 Ga0496108_0315908
442 Ga0496109_0017919
443 Ga0496109_0272137
444 Ga0496110_0259014
445 Ga0496112_0024061
446 Ga0496112_0039595
447 Ga0496112_0062581
448 Ga0496112_0078609
449 Ga0496112_0200602
450 Ga0496112_0383744
451 Ga0496115_0096543
452 Ga0496115_0181665
453 Ga0496126_0073052
454 Ga0501067_0008976
455 Ga0501067_0023892
456 Ga0501067_0114135
457 Ga0501069_0025791
458 Ga0501069_0062619
459 Ga0501070_0012113
460 Ga0501070_0048414
461 Ga0501072_0005382
462 Ga0501073_0064760
463 Ga0501074_0060853
464 Ga0501079_0006203
465 Ga0501080_0000309
466 Ga0501080_0034208
467 Ga0501083_0009873
468 nmdc:mga0n895_209761_c2
469 nmdc:mga08x19_141148_c1
470 nmdc:mga08x19_285521_c1
471 Ga0495595_0105510
472 Ga0495619_0022331
473 Ga0500566_0087001
474 Ga0501082_0338579
475 Ga0466962_0001894
476 Ga0466962_0080248
477 Ga0466962_0124775
478 Ga0530510_0100591

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

104

301

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.8845 83 287
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.8761 84 287
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.8163 83 289
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.8056 83 282
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7851 79 290
ID Description Score Start End Superfamily
af_P07654_38_293_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9406 37 288 1.10.3720.10
af_P07654_38_293_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9193 37 288 1.10.3720.10
af_Q2FYP8_79_307_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9192 79 291 1.10.3720.10
af_P0AGH8_17_311_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9079 25 288 1.10.3720.10
af_P9WG09_26_296_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.907 24 290 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A538JHT3-F1-model_v4 Phosphate transport system permease protein PstA 0.9657 16 295 GO:0005315
GO:0005886
GO:0035435
AF-A0A3D3QAR6-F1-model_v4 Phosphate transport system permease protein PstA 0.9614 39 294 GO:0005315
GO:0005886
GO:0035435
AF-A0A4Z0L1G1-F1-model_v4 deleted 0.9605 41 286
AF-A0A536BC38-F1-model_v4 Phosphate transport system permease protein PstA 0.9585 60 291 GO:0005315
GO:0005886
GO:0035435
AF-A0A497H2X9-F1-model_v4 deleted 0.9581 50 290

Map