F351511

General Info

Members Datasets Scaffolds Average Seq Length
238 177 476 394

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8057345674|8057349223
Length 439
Sequence WFETVAEAQRRAQKRLPSSVYGALVAGSERGLTIEDNIGAFSEIGFAPHVAGHKPSRDLSTSVMGLPLSFPVMISPTGVQAVHPDGEVAVSRAAANRGITMGLSSFASKPVEEVVAANPNTLFQMYWTGTRDAMIQRMDRARKAGARGLIATLDWSFSNGRDWGSPSIPEKLDLKTMVNFAPNVLPHPAWLLAYLRRRELPDLTAPNLQPPGGVAPTFFGAYYEWMQTPPPTWEDVAWLREEWGGPFMLKGVTRIDDALRAVDAGVTAISVSNHGGNNLDTTPATIRMLPSVAAAVGDQIEVVLDGGVRRGGDVAKAVALGARAVMIGRAYLWGLAANGQAGVENVLDILRGGLDSAVLGTGHASVHELGPDDLVIPEGFTRTLGAGSAAGDDGGAGGAAGSSAAASSAAAAPPAGAGSKAGPRTRTAKPLAKAEAEKK

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
86 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
87 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
88 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
96 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
97 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
111 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
120 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
124 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
125 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
126 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
127 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
128 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
142 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
143 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
162 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
163 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
164 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
165 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere
166 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
167 2643221561 Nocardioides sp. Root151 Isolate Unclassified
168 2643221696 Nocardioides sp. Root140 Isolate Unclassified
169 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
170 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
171 2808606372 Agromyces sp. 23-23 Isolate Unclassified
172 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
173 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
174 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
175 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
176 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
177 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.12
Metatranscriptomes 0.42
Isolates 5.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0
Rhizoplane 5.04
Rhizosphere 78.99
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10172866 3300005328 Bacteria 1399
2 Ga0068869_100071420 3300005334 Bacteria 2570
3 Ga0070669_100023455 3300005353 Bacteria 4419
4 Ga0070669_100096220 3300005353 Bacteria 2227
5 Ga0070709_10012924 3300005434 Bacteria 4680
6 Ga0070709_10071296 3300005434 Bacteria 2242
7 Ga0070714_100003737 3300005435 Bacteria 11413
8 Ga0070714_100058558 3300005435 Bacteria 3301
9 Ga0070714_100058696 3300005435 Bacteria 3298
10 Ga0070714_100149931 3300005435 Bacteria 2100
11 Ga0070713_100000247 3300005436 Bacteria 35608
12 Ga0070713_100004765 3300005436 Bacteria 9178
13 Ga0070713_100021140 3300005436 Bacteria 4999
14 Ga0070710_10003614 3300005437 Bacteria 7320
15 Ga0070710_10043423 3300005437 Bacteria 2489
16 Ga0070711_100074319 3300005439 Bacteria 2404
17 Ga0070711_100187160 3300005439 Bacteria 1588
18 Ga0070705_100125002 3300005440 Bacteria 1668
19 Ga0070678_100076685 3300005456 Bacteria 2519
20 Ga0070662_100277792 3300005457 Bacteria 1355
21 Ga0070706_100000931 3300005467 Bacteria 32026
22 Ga0070707_100019406 3300005468 Bacteria 6404
23 Ga0070707_100254596 3300005468 Bacteria 1708
24 Ga0070698_100006558 3300005471 Bacteria 12626
25 Ga0070699_100011161 3300005518 Bacteria 7765
26 Ga0070699_100025589 3300005518 Bacteria 5087
27 Ga0070665_100253982 3300005548 Bacteria 1759
28 Ga0068856_100023932 3300005614 Bacteria 5939
29 Ga0068859_100003277 3300005617 Bacteria 16469
30 Ga0068859_100004252 3300005617 Bacteria 14623
31 Ga0068859_100196845 3300005617 Bacteria 2100
32 Ga0068861_100059328 3300005719 Bacteria 2929
33 Ga0068860_100023149 3300005843 Bacteria 6006
34 Ga0081455_10000420 3300005937 Bacteria 55691
35 Ga0081539_10006336 3300005985 Bacteria 11405
36 Ga0081539_10015055 3300005985 Bacteria 5663
37 Ga0070717_10064690 3300006028 Bacteria 3038
38 Ga0070717_10086297 3300006028 Bacteria 2642
39 Ga0070717_10130337 3300006028 Bacteria 2162
40 Ga0075365_10078474 3300006038 Bacteria 2232
41 Ga0070716_100100696 3300006173 Bacteria 1770
42 Ga0070712_100060320 3300006175 Bacteria 2675
43 Ga0097621_100006595 3300006237 Bacteria 8243
44 Ga0068871_100019342 3300006358 Bacteria 5198
45 Ga0075428_100003557 3300006844 Bacteria 17065
46 Ga0075428_100406332 3300006844 Bacteria 1459
47 Ga0075430_100001135 3300006846 Bacteria 21233
48 Ga0075431_100000707 3300006847 Bacteria 28789
49 Ga0075433_10010213 3300006852 Bacteria 7530
50 Ga0075429_100006737 3300006880 Bacteria 9961
51 Ga0068865_100134279 3300006881 Bacteria 1857
52 Ga0075436_100049053 3300006914 Bacteria 2913
53 Ga0097620_100003277 3300006931 Bacteria 16469
54 Ga0097620_100004252 3300006931 Bacteria 14623
55 Ga0097620_100196849 3300006931 Bacteria 2100
56 Ga0075435_100020232 3300007076 Bacteria 5095
57 Ga0114129_10031986 3300009147 Bacteria 7437
58 Ga0114129_10350881 3300009147 Bacteria 1955
59 Ga0105243_10173210 3300009148 Bacteria 1871
60 Ga0105248_10041097 3300009177 Bacteria 5184
61 Ga0105248_10103749 3300009177 Bacteria 3205
62 Ga0105237_10160744 3300009545 Bacteria 2245
63 Ga0157370_10171992 3300013104 Bacteria 2013
64 Ga0157369_10083309 3300013105 Bacteria 3421
65 Ga0157375_10115313 3300013308 Bacteria 2789
66 Ga0163163_10195453 3300014325 Bacteria 2071
67 Ga0157379_10153599 3300014968 Bacteria 2076
68 Ga0157376_10035965 3300014969 Bacteria 4009
69 Ga0157376_10140482 3300014969 Bacteria 2166
70 Ga0213875_10007629 3300021388 Bacteria 5576
71 Ga0224712_10004173 3300022467 Bacteria 3865
72 Ga0207697_10000998 3300025315 Bacteria 15840
73 Ga0207688_10002041 3300025901 Bacteria 10844
74 Ga0207688_10013787 3300025901 Bacteria 4393
75 Ga0207699_10021724 3300025906 Bacteria 3465
76 Ga0207643_10031146 3300025908 Bacteria 2972
77 Ga0207684_10000974 3300025910 Bacteria 32066
78 Ga0207693_10005845 3300025915 Bacteria 10209
79 Ga0207693_10010359 3300025915 Bacteria 7567
80 Ga0207693_10034059 3300025915 Bacteria 4018
81 Ga0207693_10082961 3300025915 Bacteria 2510
82 Ga0207693_10143722 3300025915 Bacteria 1876
83 Ga0207663_10090872 3300025916 Bacteria 2025
84 Ga0207646_10016592 3300025922 Bacteria 6910
85 Ga0207681_10057238 3300025923 Bacteria 2663
86 Ga0207650_10008975 3300025925 Bacteria 6833
87 Ga0207650_10018950 3300025925 Bacteria 4835
88 Ga0207700_10025969 3300025928 Bacteria 4077
89 Ga0207700_10095937 3300025928 Bacteria 2353
90 Ga0207700_10137209 3300025928 Bacteria 2005
91 Ga0207664_10000378 3300025929 Bacteria 32313
92 Ga0207664_10015141 3300025929 Bacteria 5588
93 Ga0207664_10074434 3300025929 Bacteria 2744
94 Ga0207664_10086157 3300025929 Bacteria 2565
95 Ga0207664_10107918 3300025929 Bacteria 2310
96 Ga0207664_10119451 3300025929 Bacteria 2204
97 Ga0207644_10313884 3300025931 Bacteria 1266
98 Ga0207669_10005532 3300025937 Bacteria 5679
99 Ga0207704_10155695 3300025938 Bacteria 1619
100 Ga0207665_10019282 3300025939 Bacteria 4483
101 Ga0207665_10034268 3300025939 Bacteria 3369
102 Ga0207691_10027537 3300025940 Bacteria 5328
103 Ga0207679_10267222 3300025945 Bacteria 1461
104 Ga0207712_10227703 3300025961 Bacteria 1494
105 Ga0207658_10095259 3300025986 Bacteria 2319
106 Ga0207678_10162896 3300026067 Bacteria 1905
107 Ga0207702_10009637 3300026078 Bacteria 8107
108 Ga0207683_10058296 3300026121 Bacteria 3390
109 Ga0207683_10065554 3300026121 Bacteria 3202
110 Ga0268266_10068510 3300028379 Bacteria 3073
111 Ga0268266_10239553 3300028379 Bacteria 1674
112 Ga0268264_10033905 3300028381 Bacteria 4197
113 Ga0265338_10016203 3300028800 Bacteria 8125
114 Ga0307511_10000351 3300030521 Bacteria 48742
115 Ga0265331_10007833 3300031250 Bacteria 6129
116 Ga0265316_10100976 3300031344 Bacteria 2192
117 Ga0307513_10000311 3300031456 Bacteria 69934
118 Ga0307513_10012737 3300031456 Bacteria 10356
119 Ga0307513_10123335 3300031456 Bacteria 2553
120 Ga0307509_10000763 3300031507 Bacteria 54898
121 Ga0307509_10010907 3300031507 Bacteria 11078
122 Ga0307509_10059452 3300031507 Bacteria 4044
123 Ga0307408_100230469 3300031548 Bacteria 1517
124 Ga0307514_10081190 3300031649 Bacteria 2397
125 Ga0307516_10023136 3300031730 Bacteria 6375
126 Ga0307409_100224748 3300031995 Bacteria 1697
127 Ga0316580_10036685 3300032139 Bacteria 1517
128 Ga0307510_10000542 3300033180 Bacteria 37782
129 Ga0307510_10026885 3300033180 Bacteria 6604
130 Ga0373943_0014087 3300035170 Unclassified 3616
131 Ga0316574_0099713 3300035398 Bacteria 1858
132 Ga0373931_0065801 3300035691 Bacteria 1965
133 Ga0316582_0137915 3300036647 Bacteria 1643
134 Ga0316584_0104657 3300036712 Bacteria 2118
135 Ga0373925_0008960 3300037068 Bacteria 7292
136 Ga0395900_0176941 3300037418 Bacteria 2170
137 Ga0436364_1104205 3300037853 Bacteria 12735
138 Ga0451795_0384989 3300041456 Bacteria 2081
139 Ga0451841_0948424 3300041498 Bacteria 1387
140 Ga0451843_1481876 3300041509 Bacteria 1818
141 Ga0451853_2701295 3300041512 Bacteria 2080
142 Ga0439440_0010160 3300042993 Bacteria 1962
143 Ga0466966_0135187 3300044684 Bacteria 1508
144 Ga0466963_0005076 3300044694 Bacteria 7696
145 Ga0495617_018424 3300046452 Bacteria 2361
146 Ga0495603_0146911 3300046455 Bacteria 1370
147 Ga0495629_0081054 3300046459 Bacteria 2265
148 Ga0495605_0000988 3300046474 Bacteria 19320
149 Ga0495664_0007119 3300046477 Bacteria 6200
150 Ga0495583_0050070 3300046506 Bacteria 1910
151 Ga0495583_0079029 3300046506 Bacteria 1432
152 Ga0495606_0007451 3300046507 Bacteria 9787
153 Ga0495616_0005782 3300046513 Bacteria 7559
154 Ga0495631_0007413 3300046518 Bacteria 5576
155 Ga0495666_0001543 3300046526 Bacteria 11309
156 Ga0495640_0020003 3300046533 Bacteria 4934
157 Ga0495611_0002608 3300046648 Bacteria 8160
158 Ga0495611_0030067 3300046648 Bacteria 2386
159 Ga0495625_0005625 3300046660 Bacteria 11365
160 Ga0495599_0047687 3300046678 Bacteria 2685
161 Ga0495658_0025434 3300046683 Bacteria 3164
162 Ga0495613_0056927 3300046689 Bacteria 2871
163 Ga0495649_0025156 3300046694 Bacteria 3316
164 Ga0495660_0004770 3300046810 Bacteria 8186
165 Ga0495660_0033685 3300046810 Bacteria 2870
166 Ga0495636_0043033 3300047318 Bacteria 1878
167 Ga0495674_0054475 3300047319 Bacteria 3513
168 Ga0495674_0182997 3300047319 Bacteria 1744
169 Ga0495676_0018395 3300047321 Bacteria 6158
170 Ga0495676_0057576 3300047321 Bacteria 3064
171 Ga0495683_0008059 3300047323 Bacteria 5653
172 Ga0495687_000503 3300047443 Bacteria 47154
173 Ga0495687_000504 3300047443 Bacteria 47007
174 Ga0495687_008388 3300047443 Bacteria 5919
175 Ga0495685_029912 3300047447 Bacteria 1873
176 Ga0495593_0055128 3300047673 Bacteria 2093
177 Ga0495614_0083145 3300048089 Bacteria 1388
178 Ga0495626_0091412 3300048091 Bacteria 1338
179 Ga0496101_0141146 3300048904 Bacteria 1836
180 Ga0496102_0000818 3300048905 Bacteria 30275
181 Ga0496102_0171963 3300048905 Bacteria 2039
182 Ga0496103_0000313 3300048906 Bacteria 44848
183 Ga0496104_0162790 3300048907 Bacteria 2140
184 Ga0496109_0220286 3300048912 Bacteria 1784
185 Ga0496112_0006039 3300048915 Bacteria 10575
186 Ga0496112_0009125 3300048915 Bacteria 8911
187 Ga0496112_0155808 3300048915 Bacteria 2251
188 Ga0496113_0079614 3300048916 Bacteria 2509
189 Ga0496114_0155467 3300048917 Bacteria 1986
190 Ga0496117_0001250 3300048920 Bacteria 37864
191 Ga0496117_0171287 3300048920 Bacteria 1260
192 Ga0496118_0022638 3300048921 Bacteria 5485
193 Ga0496119_0000595 3300048922 Bacteria 48961
194 Ga0496121_0003802 3300048924 Bacteria 21043
195 Ga0496122_0020190 3300048925 Bacteria 6038
196 Ga0496123_0041238 3300048926 Bacteria 3203
197 Ga0496125_0012026 3300048928 Bacteria 8616
198 Ga0501034_0019092 3300049571 Bacteria 7019
199 Ga0501034_0134799 3300049571 Bacteria 2451
200 Ga0501037_0035995 3300049573 Bacteria 3649
201 Ga0501042_0002514 3300049578 Bacteria 11294
202 Ga0501069_0000079 3300049585 Bacteria 47599
203 Ga0501070_0000092 3300049586 Bacteria 76642
204 Ga0501070_0177505 3300049586 Bacteria 1753
205 Ga0501072_0252083 3300049588 Bacteria 1405
206 Ga0501073_0000071 3300049589 Bacteria 62958
207 Ga0501074_0000010 3300049590 Bacteria 99952
208 Ga0501076_0116252 3300049592 Bacteria 2165
209 Ga0501080_0000419 3300049742 Bacteria 32644
210 Ga0501083_0001988 3300049744 Bacteria 14065
211 Ga0501083_0013343 3300049744 Bacteria 5745
212 Ga0501083_0070009 3300049744 Bacteria 2334
213 nmdc:mga05p37_85037_c1 3300050507 Bacteria 3898
214 nmdc:mga09592_2033_c1 3300050508 Bacteria 16320
215 nmdc:mga0qj67_433_c1 3300050509 Bacteria 28644
216 nmdc:mga06r32_487_c1 3300050510 Bacteria 34252
217 nmdc:mga0n895_106293_c1 3300050512 Bacteria 2820
218 nmdc:mga0n895_81857_c1 3300050512 Bacteria 3217
219 nmdc:mga08x19_14638_c1 3300050514 Bacteria 4762
220 Ga0500643_000497 3300053087 Bacteria 28195
221 Ga0500559_0010488 3300053136 Bacteria 3976
222 Ga0500616_0000076 3300053153 Bacteria 216836
223 Ga0500616_0000477 3300053153 Bacteria 51936
224 Ga0500616_0005536 3300053153 Bacteria 8555
225 Ga0500645_005674 3300053730 Bacteria 4560
226 8057349223 8057345674 Bacteria 4160394
227 2585312400 2582581314 Bacteria 11452267
228 2643824611 2643221561 Bacteria 4984412
229 2644535863 2643221696 Bacteria 5431823
230 2739202751 2738543005 Bacteria 5278128
231 2768645926 2767802112 Bacteria 6465194
232 2808900561 2808606372 Bacteria 4649509
233 2837274773 2837268691 Bacteria 7850704
234 2897562864 2897561785 Bacteria 3256946
235 2906802715 2906799679 Bacteria 4031749
236 2928143033 2928142448 Bacteria 5288925
237 8008575236 8008574985 Bacteria 7815457
238 8046354159 8046352972 Bacteria 3613806
239 Ga0070676_10172866
240 Ga0068869_100071420
241 Ga0070669_100023455
242 Ga0070669_100096220
243 Ga0070709_10012924
244 Ga0070709_10071296
245 Ga0070714_100003737
246 Ga0070714_100058558
247 Ga0070714_100058696
248 Ga0070714_100149931
249 Ga0070713_100000247
250 Ga0070713_100004765
251 Ga0070713_100021140
252 Ga0070710_10003614
253 Ga0070710_10043423
254 Ga0070711_100074319
255 Ga0070711_100187160
256 Ga0070705_100125002
257 Ga0070678_100076685
258 Ga0070662_100277792
259 Ga0070706_100000931
260 Ga0070707_100019406
261 Ga0070707_100254596
262 Ga0070698_100006558
263 Ga0070699_100011161
264 Ga0070699_100025589
265 Ga0070665_100253982
266 Ga0068856_100023932
267 Ga0068859_100003277
268 Ga0068859_100004252
269 Ga0068859_100196845
270 Ga0068861_100059328
271 Ga0068860_100023149
272 Ga0081455_10000420
273 Ga0081539_10006336
274 Ga0081539_10015055
275 Ga0070717_10064690
276 Ga0070717_10086297
277 Ga0070717_10130337
278 Ga0075365_10078474
279 Ga0070716_100100696
280 Ga0070712_100060320
281 Ga0097621_100006595
282 Ga0068871_100019342
283 Ga0075428_100003557
284 Ga0075428_100406332
285 Ga0075430_100001135
286 Ga0075431_100000707
287 Ga0075433_10010213
288 Ga0075429_100006737
289 Ga0068865_100134279
290 Ga0075436_100049053
291 Ga0097620_100003277
292 Ga0097620_100004252
293 Ga0097620_100196849
294 Ga0075435_100020232
295 Ga0114129_10031986
296 Ga0114129_10350881
297 Ga0105243_10173210
298 Ga0105248_10041097
299 Ga0105248_10103749
300 Ga0105237_10160744
301 Ga0157370_10171992
302 Ga0157369_10083309
303 Ga0157375_10115313
304 Ga0163163_10195453
305 Ga0157379_10153599
306 Ga0157376_10035965
307 Ga0157376_10140482
308 Ga0213875_10007629
309 Ga0224712_10004173
310 Ga0207697_10000998
311 Ga0207688_10002041
312 Ga0207688_10013787
313 Ga0207699_10021724
314 Ga0207643_10031146
315 Ga0207684_10000974
316 Ga0207693_10005845
317 Ga0207693_10010359
318 Ga0207693_10034059
319 Ga0207693_10082961
320 Ga0207693_10143722
321 Ga0207663_10090872
322 Ga0207646_10016592
323 Ga0207681_10057238
324 Ga0207650_10008975
325 Ga0207650_10018950
326 Ga0207700_10025969
327 Ga0207700_10095937
328 Ga0207700_10137209
329 Ga0207664_10000378
330 Ga0207664_10015141
331 Ga0207664_10074434
332 Ga0207664_10086157
333 Ga0207664_10107918
334 Ga0207664_10119451
335 Ga0207644_10313884
336 Ga0207669_10005532
337 Ga0207704_10155695
338 Ga0207665_10019282
339 Ga0207665_10034268
340 Ga0207691_10027537
341 Ga0207679_10267222
342 Ga0207712_10227703
343 Ga0207658_10095259
344 Ga0207678_10162896
345 Ga0207702_10009637
346 Ga0207683_10058296
347 Ga0207683_10065554
348 Ga0268266_10068510
349 Ga0268266_10239553
350 Ga0268264_10033905
351 Ga0265338_10016203
352 Ga0307511_10000351
353 Ga0265331_10007833
354 Ga0265316_10100976
355 Ga0307513_10000311
356 Ga0307513_10012737
357 Ga0307513_10123335
358 Ga0307509_10000763
359 Ga0307509_10010907
360 Ga0307509_10059452
361 Ga0307408_100230469
362 Ga0307514_10081190
363 Ga0307516_10023136
364 Ga0307409_100224748
365 Ga0316580_10036685
366 Ga0307510_10000542
367 Ga0307510_10026885
368 Ga0373943_0014087
369 Ga0316574_0099713
370 Ga0373931_0065801
371 Ga0316582_0137915
372 Ga0316584_0104657
373 Ga0373925_0008960
374 Ga0395900_0176941
375 Ga0436364_1104205
376 Ga0451795_0384989
377 Ga0451841_0948424
378 Ga0451843_1481876
379 Ga0451853_2701295
380 Ga0439440_0010160
381 Ga0466966_0135187
382 Ga0466963_0005076
383 Ga0495617_018424
384 Ga0495603_0146911
385 Ga0495629_0081054
386 Ga0495605_0000988
387 Ga0495664_0007119
388 Ga0495583_0050070
389 Ga0495583_0079029
390 Ga0495606_0007451
391 Ga0495616_0005782
392 Ga0495631_0007413
393 Ga0495666_0001543
394 Ga0495640_0020003
395 Ga0495611_0002608
396 Ga0495611_0030067
397 Ga0495625_0005625
398 Ga0495599_0047687
399 Ga0495658_0025434
400 Ga0495613_0056927
401 Ga0495649_0025156
402 Ga0495660_0004770
403 Ga0495660_0033685
404 Ga0495636_0043033
405 Ga0495674_0054475
406 Ga0495674_0182997
407 Ga0495676_0018395
408 Ga0495676_0057576
409 Ga0495683_0008059
410 Ga0495687_000503
411 Ga0495687_000504
412 Ga0495687_008388
413 Ga0495685_029912
414 Ga0495593_0055128
415 Ga0495614_0083145
416 Ga0495626_0091412
417 Ga0496101_0141146
418 Ga0496102_0000818
419 Ga0496102_0171963
420 Ga0496103_0000313
421 Ga0496104_0162790
422 Ga0496109_0220286
423 Ga0496112_0006039
424 Ga0496112_0009125
425 Ga0496112_0155808
426 Ga0496113_0079614
427 Ga0496114_0155467
428 Ga0496117_0001250
429 Ga0496117_0171287
430 Ga0496118_0022638
431 Ga0496119_0000595
432 Ga0496121_0003802
433 Ga0496122_0020190
434 Ga0496123_0041238
435 Ga0496125_0012026
436 Ga0501034_0019092
437 Ga0501034_0134799
438 Ga0501037_0035995
439 Ga0501042_0002514
440 Ga0501069_0000079
441 Ga0501070_0000092
442 Ga0501070_0177505
443 Ga0501072_0252083
444 Ga0501073_0000071
445 Ga0501074_0000010
446 Ga0501076_0116252
447 Ga0501080_0000419
448 Ga0501083_0001988
449 Ga0501083_0013343
450 Ga0501083_0070009
451 nmdc:mga05p37_85037_c1
452 nmdc:mga09592_2033_c1
453 nmdc:mga0qj67_433_c1
454 nmdc:mga06r32_487_c1
455 nmdc:mga0n895_106293_c1
456 nmdc:mga0n895_81857_c1
457 nmdc:mga08x19_14638_c1
458 Ga0500643_000497
459 Ga0500559_0010488
460 Ga0500616_0000076
461 Ga0500616_0000477
462 Ga0500616_0005536
463 Ga0500645_005674
464 8057349223
465 2585312400
466 2643824611
467 2644535863
468 2739202751
469 2768645926
470 2808900561
471 2837274773
472 2897562864
473 2906802715
474 2928143033
475 8008575236
476 8046354159

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01070

FMN_dh

FMN-dependent dehydrogenase

12

376

0.93

PF01645

Glu_synthase

Conserved region in glutamate synthase

265

339

0.89

PF00478

IMPDH

IMP dehydrogenase / GMP reductase domain

281

344

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cdh-assembly1.cif.gz_0 architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. 0.9401 75 369
1tb3-assembly3.cif.gz_E crystal structure analysis of recombinant rat kidney long-chain hydroxy acid oxidase 0.9287 16 385
2cdh-assembly1.cif.gz_0 architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. 0.9238 75 369
1tb3-assembly3.cif.gz_E crystal structure analysis of recombinant rat kidney long-chain hydroxy acid oxidase 0.9232 16 385
1tb3-assembly3.cif.gz_D crystal structure analysis of recombinant rat kidney long-chain hydroxy acid oxidase 0.9185 16 385
ID Description Score Start End Superfamily
af_P33232_3_380_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9306 16 387 3.20.20.70
af_P33232_3_380_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.914 16 387 3.20.20.70
3sgzB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9091 16 385 3.20.20.70
af_P9WND7_8_384_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.908 19 387 3.20.20.70
3sgzB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9038 16 385 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V5WKW0-F1-model_v4 Alpha-hydroxy-acid oxidizing protein 0.9846 9 390 GO:0004459
GO:0005886
GO:0009060
GO:0010181
AF-A0A1Y0CTU3-F1-model_v4 deleted 0.9783 276 381
AF-A0A533IR46-F1-model_v4 deleted 0.976 276 378
AF-A0A1Q8BKK9-F1-model_v4 Alpha-hydroxy-acid oxidizing enzyme 0.974 26 352 GO:0010181
GO:0016491
AF-A0A7R9VQ67-F1-model_v4 FMN hydroxy acid dehydrogenase domain-containing protein 0.9739 262 391 GO:0010181
GO:0016491
GO:0051707

Map