F351458
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 238 | 167 | 476 | 248 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2671180195|2671839101 |
| Length | 282 |
| Sequence | SHSWSGRLWVPPAGRPPIAVALDAPDGATALDWARAVAPHCAVLKIGLELFLREGGAVVNALRDEGLLVQAGSVGSAGAGHTLGSLTEGDHSALSSPADPAGPAGSAPELFLDLKLHDIPATVAGGMRSLAVLAPRFVTVHAAGGAAMIRAAVEAAPEVHVTAVTVLTSLDAAALASIGLSGPPSDAVRRLAVLAVEAGARALVCSPKEASLVRGELGETVTLITPGVRPEGSEQADQARVATPERALADGSDLLVIGRPITSASDRAVAAATLAARVTPLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 12 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 13 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 14 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 15 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 16 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 17 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 18 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 19 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 20 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 21 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 22 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 23 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 24 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 25 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 26 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 28 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 40 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 41 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 55 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 57 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 58 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 59 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 60 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 61 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 62 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 63 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 64 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 65 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 66 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 67 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 68 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 69 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 70 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 71 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 72 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 73 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 74 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 75 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 76 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 77 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 78 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 79 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 80 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 81 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 82 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 83 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 84 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 85 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 86 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 87 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 88 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 89 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 90 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 91 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 92 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 93 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 94 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 95 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 96 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 97 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 98 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 99 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 100 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 101 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 106 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 107 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 108 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 109 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 110 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 111 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 114 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 117 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 120 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 123 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 129 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 141 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 142 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 143 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 144 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 145 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 146 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 147 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 148 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 149 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 150 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 151 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 152 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 153 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 154 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 155 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 156 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 157 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 158 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 159 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 160 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 161 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 162 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 163 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 164 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 165 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 166 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 167 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.24 |
| Metatranscriptomes | 0.84 |
| Isolates | 10.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 8.4 |
| Rhizoplane | 0.42 |
| Rhizosphere | 87.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10049344 | 3300003373 | Bacteria | 1068 |
| 2 | Ga0070658_10000155 | 3300005327 | Bacteria | 60553 |
| 3 | Ga0070658_10038648 | 3300005327 | Bacteria | 3848 |
| 4 | Ga0070658_10077503 | 3300005327 | Bacteria | 2727 |
| 5 | Ga0070683_100361678 | 3300005329 | Bacteria | 1382 |
| 6 | Ga0070680_100061766 | 3300005336 | Bacteria | 3068 |
| 7 | Ga0070680_100459821 | 3300005336 | Bacteria | 1087 |
| 8 | Ga0070682_100754222 | 3300005337 | Bacteria | 786 |
| 9 | Ga0070660_100091486 | 3300005339 | Bacteria | 2400 |
| 10 | Ga0070661_100380117 | 3300005344 | Bacteria | 1113 |
| 11 | Ga0070681_10011079 | 3300005458 | Bacteria | 8919 |
| 12 | Ga0070681_10074955 | 3300005458 | Bacteria | 3344 |
| 13 | Ga0070681_10510631 | 3300005458 | Bacteria | 1115 |
| 14 | Ga0070679_100079825 | 3300005530 | Bacteria | 3261 |
| 15 | Ga0070679_100122374 | 3300005530 | Bacteria | 2586 |
| 16 | Ga0070679_100383546 | 3300005530 | Bacteria | 1352 |
| 17 | Ga0070679_100626114 | 3300005530 | Bacteria | 1019 |
| 18 | Ga0070684_100021613 | 3300005535 | Bacteria | 5359 |
| 19 | Ga0070684_100038253 | 3300005535 | Bacteria | 4120 |
| 20 | Ga0070684_100863777 | 3300005535 | Bacteria | 847 |
| 21 | Ga0068855_100126474 | 3300005563 | Bacteria | 2922 |
| 22 | Ga0068859_100001250 | 3300005617 | Bacteria | 25949 |
| 23 | Ga0068861_100032340 | 3300005719 | Bacteria | 3850 |
| 24 | Ga0068862_100000021 | 3300005844 | Bacteria | 218035 |
| 25 | Ga0068862_100490894 | 3300005844 | Bacteria | 1164 |
| 26 | Ga0081455_10010594 | 3300005937 | Bacteria | 9331 |
| 27 | Ga0081538_10016570 | 3300005981 | Bacteria | 5643 |
| 28 | Ga0081538_10018027 | 3300005981 | Bacteria | 5327 |
| 29 | Ga0081538_10027008 | 3300005981 | Bacteria | 3992 |
| 30 | Ga0081538_10030849 | 3300005981 | Bacteria | 3630 |
| 31 | Ga0081538_10053709 | 3300005981 | Bacteria | 2392 |
| 32 | Ga0081538_10145552 | 3300005981 | Bacteria | 1084 |
| 33 | Ga0081539_10036548 | 3300005985 | Bacteria | 2939 |
| 34 | Ga0075432_10006516 | 3300006058 | Bacteria | 3976 |
| 35 | Ga0075427_10014124 | 3300006194 | Bacteria | 1224 |
| 36 | Ga0075428_100150931 | 3300006844 | Bacteria | 2524 |
| 37 | Ga0075430_100007249 | 3300006846 | Bacteria | 9366 |
| 38 | Ga0075431_100002185 | 3300006847 | Bacteria | 18706 |
| 39 | Ga0075433_10261716 | 3300006852 | Bacteria | 1533 |
| 40 | Ga0075434_100041853 | 3300006871 | Bacteria | 4540 |
| 41 | Ga0075429_100005729 | 3300006880 | Bacteria | 10720 |
| 42 | Ga0097620_100001250 | 3300006931 | Bacteria | 25949 |
| 43 | Ga0075435_100210693 | 3300007076 | Bacteria | 1649 |
| 44 | Ga0111539_10022486 | 3300009094 | Bacteria | 7746 |
| 45 | Ga0111539_10106670 | 3300009094 | Bacteria | 3286 |
| 46 | Ga0111539_10717033 | 3300009094 | Bacteria | 1164 |
| 47 | Ga0105247_10000164 | 3300009101 | Bacteria | 64953 |
| 48 | Ga0105248_10013366 | 3300009177 | Bacteria | 9035 |
| 49 | Ga0105237_10104320 | 3300009545 | Bacteria | 2827 |
| 50 | Ga0105249_10030448 | 3300009553 | Bacteria | 4878 |
| 51 | Ga0105249_10056435 | 3300009553 | Bacteria | 3595 |
| 52 | Ga0105239_11149216 | 3300010375 | Bacteria | 894 |
| 53 | Ga0157369_10002905 | 3300013105 | Bacteria | 20475 |
| 54 | Ga0157369_10004575 | 3300013105 | Bacteria | 16260 |
| 55 | Ga0157369_10004788 | 3300013105 | Bacteria | 15907 |
| 56 | Ga0157369_10068791 | 3300013105 | Bacteria | 3804 |
| 57 | Ga0157369_10339901 | 3300013105 | Bacteria | 1559 |
| 58 | Ga0163162_10164396 | 3300013306 | Bacteria | 2343 |
| 59 | Ga0157372_10422158 | 3300013307 | Bacteria | 1554 |
| 60 | Ga0163163_10006845 | 3300014325 | Bacteria | 10006 |
| 61 | Ga0163163_10245158 | 3300014325 | Bacteria | 1842 |
| 62 | Ga0157379_10078034 | 3300014968 | Bacteria | 2966 |
| 63 | Ga0206353_10961087 | 3300020082 | Bacteria | 1370 |
| 64 | Ga0224712_10012453 | 3300022467 | Bacteria | 2677 |
| 65 | Ga0207710_10000178 | 3300025900 | Bacteria | 64962 |
| 66 | Ga0207705_10001837 | 3300025909 | Bacteria | 16689 |
| 67 | Ga0207705_10154239 | 3300025909 | Bacteria | 1722 |
| 68 | Ga0207671_10058253 | 3300025914 | Bacteria | 2863 |
| 69 | Ga0207693_10263649 | 3300025915 | Bacteria | 1351 |
| 70 | Ga0207660_10013362 | 3300025917 | Bacteria | 5381 |
| 71 | Ga0207660_10015363 | 3300025917 | Bacteria | 5051 |
| 72 | Ga0207657_10082556 | 3300025919 | Bacteria | 2697 |
| 73 | Ga0207652_10037379 | 3300025921 | Bacteria | 4110 |
| 74 | Ga0207652_10273375 | 3300025921 | Bacteria | 1524 |
| 75 | Ga0207652_10527971 | 3300025921 | Bacteria | 1062 |
| 76 | Ga0207706_10007291 | 3300025933 | Bacteria | 10225 |
| 77 | Ga0207711_10027971 | 3300025941 | Bacteria | 4740 |
| 78 | Ga0207661_10076953 | 3300025944 | Bacteria | 2742 |
| 79 | Ga0207667_10406794 | 3300025949 | Bacteria | 1385 |
| 80 | Ga0207712_10017355 | 3300025961 | Bacteria | 4673 |
| 81 | Ga0207675_100069841 | 3300026118 | Bacteria | 3283 |
| 82 | Ga0207428_10001285 | 3300027907 | Bacteria | 26877 |
| 83 | Ga0207428_10281061 | 3300027907 | Bacteria | 1235 |
| 84 | Ga0268265_10000034 | 3300028380 | Bacteria | 218695 |
| 85 | Ga0268265_10930891 | 3300028380 | Bacteria | 855 |
| 86 | Ga0265338_10019738 | 3300028800 | Bacteria | 7130 |
| 87 | Ga0265330_10014899 | 3300031235 | Bacteria | 3602 |
| 88 | Ga0265325_10002209 | 3300031241 | Bacteria | 13209 |
| 89 | Ga0265340_10054279 | 3300031247 | Bacteria | 1932 |
| 90 | Ga0265339_10007299 | 3300031249 | Bacteria | 7163 |
| 91 | Ga0265316_10032445 | 3300031344 | Bacteria | 4262 |
| 92 | Ga0307408_100472054 | 3300031548 | Bacteria | 1093 |
| 93 | Ga0265313_10045542 | 3300031595 | Bacteria | 2135 |
| 94 | Ga0316575_10037065 | 3300031665 | Bacteria | 1920 |
| 95 | Ga0265314_10006406 | 3300031711 | Bacteria | 10430 |
| 96 | Ga0316578_10017632 | 3300031728 | Bacteria | 3891 |
| 97 | Ga0307405_10014044 | 3300031731 | Bacteria | 4293 |
| 98 | Ga0307413_10303180 | 3300031824 | Bacteria | 1212 |
| 99 | Ga0307410_10190695 | 3300031852 | Bacteria | 1558 |
| 100 | Ga0307406_10272934 | 3300031901 | Bacteria | 1285 |
| 101 | Ga0307406_10273412 | 3300031901 | Bacteria | 1284 |
| 102 | Ga0307407_10007280 | 3300031903 | Bacteria | 5002 |
| 103 | Ga0307407_10120672 | 3300031903 | Bacteria | 1661 |
| 104 | Ga0307412_10127604 | 3300031911 | Bacteria | 1842 |
| 105 | Ga0307412_10623872 | 3300031911 | Bacteria | 916 |
| 106 | Ga0307409_100002233 | 3300031995 | Bacteria | 10003 |
| 107 | Ga0307409_100014647 | 3300031995 | Bacteria | 5110 |
| 108 | Ga0307409_100103640 | 3300031995 | Bacteria | 2367 |
| 109 | Ga0307409_100123648 | 3300031995 | Bacteria | 2196 |
| 110 | Ga0307409_100227435 | 3300031995 | Bacteria | 1688 |
| 111 | Ga0307416_100000342 | 3300032002 | Bacteria | 24167 |
| 112 | Ga0307416_100013805 | 3300032002 | Bacteria | 5505 |
| 113 | Ga0307416_100022738 | 3300032002 | Bacteria | 4533 |
| 114 | Ga0307416_100061570 | 3300032002 | Bacteria | 3063 |
| 115 | Ga0307416_100445975 | 3300032002 | Bacteria | 1345 |
| 116 | Ga0307416_101113021 | 3300032002 | Bacteria | 894 |
| 117 | Ga0307414_10594978 | 3300032004 | Bacteria | 991 |
| 118 | Ga0307411_10296567 | 3300032005 | Bacteria | 1294 |
| 119 | Ga0307415_100018008 | 3300032126 | Bacteria | 4252 |
| 120 | Ga0307415_100027758 | 3300032126 | Bacteria | 3591 |
| 121 | Ga0307415_100271231 | 3300032126 | Bacteria | 1390 |
| 122 | Ga0307415_100310904 | 3300032126 | Bacteria | 1309 |
| 123 | Ga0316214_1014295 | 3300033545 | Bacteria | 1091 |
| 124 | Ga0316574_0019188 | 3300035398 | Bacteria | 4032 |
| 125 | Ga0316574_0120922 | 3300035398 | Bacteria | 1682 |
| 126 | Ga0316584_0430218 | 3300036712 | Bacteria | 936 |
| 127 | Ga0395900_0062246 | 3300037418 | Bacteria | 3836 |
| 128 | Ga0436364_0432398 | 3300037853 | Bacteria | 1489 |
| 129 | Ga0436363_1331181 | 3300039450 | Bacteria | 3112 |
| 130 | Ga0439448_0001562 | 3300042005 | Bacteria | 5995 |
| 131 | Ga0439450_029551 | 3300042008 | Bacteria | 1225 |
| 132 | Ga0439455_0013101 | 3300042012 | Bacteria | 1872 |
| 133 | Ga0439455_0049812 | 3300042012 | Bacteria | 1092 |
| 134 | Ga0439463_001733 | 3300042016 | Bacteria | 5690 |
| 135 | Ga0439463_011481 | 3300042016 | Bacteria | 2175 |
| 136 | Ga0439463_027318 | 3300042016 | Bacteria | 1436 |
| 137 | Ga0450902_026070 | 3300042137 | Bacteria | 977 |
| 138 | Ga0439435_0090701 | 3300042436 | Bacteria | 928 |
| 139 | Ga0439444_0004512 | 3300042437 | Bacteria | 2027 |
| 140 | Ga0439464_0001837 | 3300042439 | Bacteria | 5126 |
| 141 | Ga0439464_0063862 | 3300042439 | Bacteria | 1081 |
| 142 | Ga0439464_0082709 | 3300042439 | Bacteria | 960 |
| 143 | Ga0450916_002190 | 3300042530 | Bacteria | 2051 |
| 144 | Ga0439440_0003853 | 3300042993 | Bacteria | 2919 |
| 145 | Ga0466961_0065886 | 3300044693 | Bacteria | 2302 |
| 146 | Ga0466971_0054909 | 3300044719 | Bacteria | 1795 |
| 147 | Ga0466968_0059304 | 3300044735 | Bacteria | 1648 |
| 148 | Ga0466957_0058250 | 3300044842 | Bacteria | 2366 |
| 149 | Ga0466957_0090445 | 3300044842 | Bacteria | 1917 |
| 150 | Ga0466960_0031121 | 3300044901 | Bacteria | 2460 |
| 151 | Ga0466959_0232415 | 3300045049 | Bacteria | 1276 |
| 152 | Ga0466967_0093530 | 3300045976 | Bacteria | 2736 |
| 153 | Ga0466967_0160783 | 3300045976 | Bacteria | 2108 |
| 154 | Ga0495584_0151346 | 3300046491 | Bacteria | 1179 |
| 155 | Ga0495616_0102773 | 3300046513 | Bacteria | 1339 |
| 156 | Ga0495644_0024627 | 3300046523 | Bacteria | 2289 |
| 157 | Ga0495663_0004552 | 3300046525 | Bacteria | 3889 |
| 158 | Ga0496119_0000375 | 3300048922 | Bacteria | 61774 |
| 159 | Ga0496120_0000453 | 3300048923 | Bacteria | 64868 |
| 160 | Ga0501031_0016344 | 3300049568 | Bacteria | 4818 |
| 161 | Ga0501032_0049280 | 3300049569 | Bacteria | 2841 |
| 162 | Ga0501033_0042006 | 3300049570 | Bacteria | 3410 |
| 163 | Ga0501036_0002075 | 3300049572 | Bacteria | 15633 |
| 164 | Ga0501037_0011482 | 3300049573 | Bacteria | 6522 |
| 165 | Ga0501038_0008744 | 3300049574 | Bacteria | 9290 |
| 166 | Ga0501038_0019485 | 3300049574 | Bacteria | 6115 |
| 167 | Ga0501039_0000517 | 3300049575 | Bacteria | 27904 |
| 168 | Ga0501039_0002771 | 3300049575 | Bacteria | 13073 |
| 169 | Ga0501040_0002635 | 3300049576 | Bacteria | 11574 |
| 170 | Ga0501040_0006551 | 3300049576 | Bacteria | 7561 |
| 171 | Ga0501041_0009814 | 3300049577 | Bacteria | 5636 |
| 172 | Ga0501041_0053134 | 3300049577 | Bacteria | 2470 |
| 173 | Ga0501042_0000452 | 3300049578 | Bacteria | 21094 |
| 174 | Ga0501042_0075825 | 3300049578 | Bacteria | 2406 |
| 175 | Ga0501043_0040785 | 3300049579 | Bacteria | 3648 |
| 176 | Ga0501043_0464119 | 3300049579 | Bacteria | 950 |
| 177 | Ga0501046_0004957 | 3300049580 | Bacteria | 11951 |
| 178 | Ga0501048_0003507 | 3300049582 | Bacteria | 11928 |
| 179 | Ga0501048_0007241 | 3300049582 | Bacteria | 8414 |
| 180 | Ga0501068_0110405 | 3300049584 | Bacteria | 1709 |
| 181 | Ga0501071_0034774 | 3300049587 | Bacteria | 3588 |
| 182 | Ga0501072_0014522 | 3300049588 | Bacteria | 6034 |
| 183 | Ga0501074_0126342 | 3300049590 | Bacteria | 1829 |
| 184 | Ga0501075_0004501 | 3300049591 | Bacteria | 9438 |
| 185 | Ga0501075_0028769 | 3300049591 | Bacteria | 4104 |
| 186 | Ga0501076_0003469 | 3300049592 | Bacteria | 11074 |
| 187 | Ga0501076_0004627 | 3300049592 | Bacteria | 9799 |
| 188 | Ga0501077_0009186 | 3300049593 | Bacteria | 6138 |
| 189 | Ga0501077_0013514 | 3300049593 | Bacteria | 5120 |
| 190 | Ga0501079_0000402 | 3300049741 | Bacteria | 27959 |
| 191 | Ga0501079_0002596 | 3300049741 | Bacteria | 13124 |
| 192 | Ga0501081_0000939 | 3300049743 | Bacteria | 17297 |
| 193 | Ga0501081_0004008 | 3300049743 | Bacteria | 9443 |
| 194 | Ga0501083_0045479 | 3300049744 | Bacteria | 2970 |
| 195 | Ga0501035_0043943 | 3300049822 | Bacteria | 4025 |
| 196 | Ga0501035_0211409 | 3300049822 | Bacteria | 1659 |
| 197 | Ga0501045_0000125 | 3300049824 | Bacteria | 40131 |
| 198 | Ga0501045_0000156 | 3300049824 | Bacteria | 36940 |
| 199 | nmdc:mga05p37_21038_c1 | 3300050507 | Bacteria | 7896 |
| 200 | nmdc:mga09592_95242_c1 | 3300050508 | Bacteria | 2547 |
| 201 | nmdc:mga0qj67_1782_c1 | 3300050509 | Bacteria | 15242 |
| 202 | nmdc:mga06r32_7441_c1 | 3300050510 | Bacteria | 9854 |
| 203 | nmdc:mga08y16_360518_c1 | 3300050511 | Bacteria | 1492 |
| 204 | nmdc:mga08y16_375485_c1 | 3300050511 | Bacteria | 1458 |
| 205 | nmdc:mga08y16_3804_c1 | 3300050511 | Bacteria | 15702 |
| 206 | nmdc:mga0a205_13246_c1 | 3300050515 | Bacteria | 7669 |
| 207 | nmdc:mga0a205_30743_c2 | 3300050515 | Bacteria | 3390 |
| 208 | Ga0501084_0017273 | 3300054114 | Bacteria | 5994 |
| 209 | Ga0501082_0000501 | 3300060353 | Bacteria | 34701 |
| 210 | Ga0501082_0004633 | 3300060353 | Bacteria | 11998 |
| 211 | Ga0466962_0023859 | 3300061719 | Bacteria | 2940 |
| 212 | Ga0530510_0000266 | 3300061734 | Bacteria | 32748 |
| 213 | 2671839101 | 2671180195 | Bacteria | 9757215 |
| 214 | 2506867875 | 2506783011 | Bacteria | 5323186 |
| 215 | 2508678230 | 2508501039 | Bacteria | 9978592 |
| 216 | 2528215000 | 2527291629 | Bacteria | 5267418 |
| 217 | 2546950300 | 2546825537 | Bacteria | 5389291 |
| 218 | 2579750216 | 2576861822 | Bacteria | 5004595 |
| 219 | 2579856441 | 2579778521 | Bacteria | 7624758 |
| 220 | 2619858113 | 2619618881 | Bacteria | 7521104 |
| 221 | 2620352582 | 2619619003 | Bacteria | 7619552 |
| 222 | 2626639635 | 2626541554 | Bacteria | 7741902 |
| 223 | 2676201676 | 2675902999 | Bacteria | 9438463 |
| 224 | 2686537829 | 2684623035 | Bacteria | 8032739 |
| 225 | 2686543106 | 2684623036 | Bacteria | 5199090 |
| 226 | 2689956258 | 2687453737 | Bacteria | 11203906 |
| 227 | 2689991619 | 2687453743 | Bacteria | 8361025 |
| 228 | 2710603782 | 2710264753 | Bacteria | 5455564 |
| 229 | 2774846252 | 2773857921 | Bacteria | 9435764 |
| 230 | 2774857257 | 2773857922 | Bacteria | 9757215 |
| 231 | 2774866131 | 2773857924 | Bacteria | 5256821 |
| 232 | 2774904297 | 2773857933 | Bacteria | 5818019 |
| 233 | 2895888706 | 2895880812 | Bacteria | 11255272 |
| 234 | 637880521 | 637000116 | Bacteria | 5433628 |
| 235 | 8002782814 | 8002775197 | Bacteria | 10728764 |
| 236 | 8054923148 | 8054920844 | Bacteria | 7068637 |
| 237 | 8055160851 | 8055157932 | Bacteria | 6429399 |
| 238 | 8056065537 | 8056060235 | Bacteria | 7259403 |
| 239 | JGI25407J50210_10049344 | |||
| 240 | Ga0070658_10000155 | |||
| 241 | Ga0070658_10038648 | |||
| 242 | Ga0070658_10077503 | |||
| 243 | Ga0070683_100361678 | |||
| 244 | Ga0070680_100061766 | |||
| 245 | Ga0070680_100459821 | |||
| 246 | Ga0070682_100754222 | |||
| 247 | Ga0070660_100091486 | |||
| 248 | Ga0070661_100380117 | |||
| 249 | Ga0070681_10011079 | |||
| 250 | Ga0070681_10074955 | |||
| 251 | Ga0070681_10510631 | |||
| 252 | Ga0070679_100079825 | |||
| 253 | Ga0070679_100122374 | |||
| 254 | Ga0070679_100383546 | |||
| 255 | Ga0070679_100626114 | |||
| 256 | Ga0070684_100021613 | |||
| 257 | Ga0070684_100038253 | |||
| 258 | Ga0070684_100863777 | |||
| 259 | Ga0068855_100126474 | |||
| 260 | Ga0068859_100001250 | |||
| 261 | Ga0068861_100032340 | |||
| 262 | Ga0068862_100000021 | |||
| 263 | Ga0068862_100490894 | |||
| 264 | Ga0081455_10010594 | |||
| 265 | Ga0081538_10016570 | |||
| 266 | Ga0081538_10018027 | |||
| 267 | Ga0081538_10027008 | |||
| 268 | Ga0081538_10030849 | |||
| 269 | Ga0081538_10053709 | |||
| 270 | Ga0081538_10145552 | |||
| 271 | Ga0081539_10036548 | |||
| 272 | Ga0075432_10006516 | |||
| 273 | Ga0075427_10014124 | |||
| 274 | Ga0075428_100150931 | |||
| 275 | Ga0075430_100007249 | |||
| 276 | Ga0075431_100002185 | |||
| 277 | Ga0075433_10261716 | |||
| 278 | Ga0075434_100041853 | |||
| 279 | Ga0075429_100005729 | |||
| 280 | Ga0097620_100001250 | |||
| 281 | Ga0075435_100210693 | |||
| 282 | Ga0111539_10022486 | |||
| 283 | Ga0111539_10106670 | |||
| 284 | Ga0111539_10717033 | |||
| 285 | Ga0105247_10000164 | |||
| 286 | Ga0105248_10013366 | |||
| 287 | Ga0105237_10104320 | |||
| 288 | Ga0105249_10030448 | |||
| 289 | Ga0105249_10056435 | |||
| 290 | Ga0105239_11149216 | |||
| 291 | Ga0157369_10002905 | |||
| 292 | Ga0157369_10004575 | |||
| 293 | Ga0157369_10004788 | |||
| 294 | Ga0157369_10068791 | |||
| 295 | Ga0157369_10339901 | |||
| 296 | Ga0163162_10164396 | |||
| 297 | Ga0157372_10422158 | |||
| 298 | Ga0163163_10006845 | |||
| 299 | Ga0163163_10245158 | |||
| 300 | Ga0157379_10078034 | |||
| 301 | Ga0206353_10961087 | |||
| 302 | Ga0224712_10012453 | |||
| 303 | Ga0207710_10000178 | |||
| 304 | Ga0207705_10001837 | |||
| 305 | Ga0207705_10154239 | |||
| 306 | Ga0207671_10058253 | |||
| 307 | Ga0207693_10263649 | |||
| 308 | Ga0207660_10013362 | |||
| 309 | Ga0207660_10015363 | |||
| 310 | Ga0207657_10082556 | |||
| 311 | Ga0207652_10037379 | |||
| 312 | Ga0207652_10273375 | |||
| 313 | Ga0207652_10527971 | |||
| 314 | Ga0207706_10007291 | |||
| 315 | Ga0207711_10027971 | |||
| 316 | Ga0207661_10076953 | |||
| 317 | Ga0207667_10406794 | |||
| 318 | Ga0207712_10017355 | |||
| 319 | Ga0207675_100069841 | |||
| 320 | Ga0207428_10001285 | |||
| 321 | Ga0207428_10281061 | |||
| 322 | Ga0268265_10000034 | |||
| 323 | Ga0268265_10930891 | |||
| 324 | Ga0265338_10019738 | |||
| 325 | Ga0265330_10014899 | |||
| 326 | Ga0265325_10002209 | |||
| 327 | Ga0265340_10054279 | |||
| 328 | Ga0265339_10007299 | |||
| 329 | Ga0265316_10032445 | |||
| 330 | Ga0307408_100472054 | |||
| 331 | Ga0265313_10045542 | |||
| 332 | Ga0316575_10037065 | |||
| 333 | Ga0265314_10006406 | |||
| 334 | Ga0316578_10017632 | |||
| 335 | Ga0307405_10014044 | |||
| 336 | Ga0307413_10303180 | |||
| 337 | Ga0307410_10190695 | |||
| 338 | Ga0307406_10272934 | |||
| 339 | Ga0307406_10273412 | |||
| 340 | Ga0307407_10007280 | |||
| 341 | Ga0307407_10120672 | |||
| 342 | Ga0307412_10127604 | |||
| 343 | Ga0307412_10623872 | |||
| 344 | Ga0307409_100002233 | |||
| 345 | Ga0307409_100014647 | |||
| 346 | Ga0307409_100103640 | |||
| 347 | Ga0307409_100123648 | |||
| 348 | Ga0307409_100227435 | |||
| 349 | Ga0307416_100000342 | |||
| 350 | Ga0307416_100013805 | |||
| 351 | Ga0307416_100022738 | |||
| 352 | Ga0307416_100061570 | |||
| 353 | Ga0307416_100445975 | |||
| 354 | Ga0307416_101113021 | |||
| 355 | Ga0307414_10594978 | |||
| 356 | Ga0307411_10296567 | |||
| 357 | Ga0307415_100018008 | |||
| 358 | Ga0307415_100027758 | |||
| 359 | Ga0307415_100271231 | |||
| 360 | Ga0307415_100310904 | |||
| 361 | Ga0316214_1014295 | |||
| 362 | Ga0316574_0019188 | |||
| 363 | Ga0316574_0120922 | |||
| 364 | Ga0316584_0430218 | |||
| 365 | Ga0395900_0062246 | |||
| 366 | Ga0436364_0432398 | |||
| 367 | Ga0436363_1331181 | |||
| 368 | Ga0439448_0001562 | |||
| 369 | Ga0439450_029551 | |||
| 370 | Ga0439455_0013101 | |||
| 371 | Ga0439455_0049812 | |||
| 372 | Ga0439463_001733 | |||
| 373 | Ga0439463_011481 | |||
| 374 | Ga0439463_027318 | |||
| 375 | Ga0450902_026070 | |||
| 376 | Ga0439435_0090701 | |||
| 377 | Ga0439444_0004512 | |||
| 378 | Ga0439464_0001837 | |||
| 379 | Ga0439464_0063862 | |||
| 380 | Ga0439464_0082709 | |||
| 381 | Ga0450916_002190 | |||
| 382 | Ga0439440_0003853 | |||
| 383 | Ga0466961_0065886 | |||
| 384 | Ga0466971_0054909 | |||
| 385 | Ga0466968_0059304 | |||
| 386 | Ga0466957_0058250 | |||
| 387 | Ga0466957_0090445 | |||
| 388 | Ga0466960_0031121 | |||
| 389 | Ga0466959_0232415 | |||
| 390 | Ga0466967_0093530 | |||
| 391 | Ga0466967_0160783 | |||
| 392 | Ga0495584_0151346 | |||
| 393 | Ga0495616_0102773 | |||
| 394 | Ga0495644_0024627 | |||
| 395 | Ga0495663_0004552 | |||
| 396 | Ga0496119_0000375 | |||
| 397 | Ga0496120_0000453 | |||
| 398 | Ga0501031_0016344 | |||
| 399 | Ga0501032_0049280 | |||
| 400 | Ga0501033_0042006 | |||
| 401 | Ga0501036_0002075 | |||
| 402 | Ga0501037_0011482 | |||
| 403 | Ga0501038_0008744 | |||
| 404 | Ga0501038_0019485 | |||
| 405 | Ga0501039_0000517 | |||
| 406 | Ga0501039_0002771 | |||
| 407 | Ga0501040_0002635 | |||
| 408 | Ga0501040_0006551 | |||
| 409 | Ga0501041_0009814 | |||
| 410 | Ga0501041_0053134 | |||
| 411 | Ga0501042_0000452 | |||
| 412 | Ga0501042_0075825 | |||
| 413 | Ga0501043_0040785 | |||
| 414 | Ga0501043_0464119 | |||
| 415 | Ga0501046_0004957 | |||
| 416 | Ga0501048_0003507 | |||
| 417 | Ga0501048_0007241 | |||
| 418 | Ga0501068_0110405 | |||
| 419 | Ga0501071_0034774 | |||
| 420 | Ga0501072_0014522 | |||
| 421 | Ga0501074_0126342 | |||
| 422 | Ga0501075_0004501 | |||
| 423 | Ga0501075_0028769 | |||
| 424 | Ga0501076_0003469 | |||
| 425 | Ga0501076_0004627 | |||
| 426 | Ga0501077_0009186 | |||
| 427 | Ga0501077_0013514 | |||
| 428 | Ga0501079_0000402 | |||
| 429 | Ga0501079_0002596 | |||
| 430 | Ga0501081_0000939 | |||
| 431 | Ga0501081_0004008 | |||
| 432 | Ga0501083_0045479 | |||
| 433 | Ga0501035_0043943 | |||
| 434 | Ga0501035_0211409 | |||
| 435 | Ga0501045_0000125 | |||
| 436 | Ga0501045_0000156 | |||
| 437 | nmdc:mga05p37_21038_c1 | |||
| 438 | nmdc:mga09592_95242_c1 | |||
| 439 | nmdc:mga0qj67_1782_c1 | |||
| 440 | nmdc:mga06r32_7441_c1 | |||
| 441 | nmdc:mga08y16_360518_c1 | |||
| 442 | nmdc:mga08y16_375485_c1 | |||
| 443 | nmdc:mga08y16_3804_c1 | |||
| 444 | nmdc:mga0a205_13246_c1 | |||
| 445 | nmdc:mga0a205_30743_c2 | |||
| 446 | Ga0501084_0017273 | |||
| 447 | Ga0501082_0000501 | |||
| 448 | Ga0501082_0004633 | |||
| 449 | Ga0466962_0023859 | |||
| 450 | Ga0530510_0000266 | |||
| 451 | 2671839101 | |||
| 452 | 2506867875 | |||
| 453 | 2508678230 | |||
| 454 | 2528215000 | |||
| 455 | 2546950300 | |||
| 456 | 2579750216 | |||
| 457 | 2579856441 | |||
| 458 | 2619858113 | |||
| 459 | 2620352582 | |||
| 460 | 2626639635 | |||
| 461 | 2676201676 | |||
| 462 | 2686537829 | |||
| 463 | 2686543106 | |||
| 464 | 2689956258 | |||
| 465 | 2689991619 | |||
| 466 | 2710603782 | |||
| 467 | 2774846252 | |||
| 468 | 2774857257 | |||
| 469 | 2774866131 | |||
| 470 | 2774904297 | |||
| 471 | 2895888706 | |||
| 472 | 637880521 | |||
| 473 | 8002782814 | |||
| 474 | 8054923148 | |||
| 475 | 8055160851 | |||
| 476 | 8056065537 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cso-assembly1.cif.gz_B | crystal structure of orotidine 5'-phosphate decarboxylase from klebsiella pneumoniae in complex with uridine-5'-monophosphate | 0.9504 | 5 | 222 |
| 1jjk-assembly1.cif.gz_A | selenomethionine substitution of orotidine-5'-monophosphate decarboxylase from e. coli causes a change in crystal contacts and space group | 0.9485 | 3 | 222 |
| 8cso-assembly5.cif.gz_J | crystal structure of orotidine 5'-phosphate decarboxylase from klebsiella pneumoniae in complex with uridine-5'-monophosphate | 0.9425 | 6 | 171 |
| 1dbt-assembly2.cif.gz_C-2 | crystal structure of orotidine 5'-monophosphate decarboxylase from bacillus subtilis complexed with ump | 0.9376 | 3 | 225 |
| 3ru6-assembly2.cif.gz_C | 1.8 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase (pyrf) from campylobacter jejuni subsp. jejuni nctc 11168 | 0.9168 | 5 | 223 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1jjkA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9257 | 3 | 224 | 3.20.20.70 |
| 3ru6D00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9164 | 5 | 223 | 3.20.20.70 |
| 1jjkA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9057 | 3 | 224 | 3.20.20.70 |
| 3ru6D00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9003 | 5 | 223 | 3.20.20.70 |
| 2yyuB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9 | 4 | 224 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537YE04-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) | 0.9744 | 2 | 223 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |
| AF-A0A381RPI2-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) | 0.9732 | 25 | 227 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |
| AF-A0A1F9F7U1-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) | 0.9672 | 2 | 225 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |
| AF-A0A357R6R8-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) | 0.9672 | 34 | 226 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |
| AF-Q5GRJ9-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) | 0.9667 | 3 | 224 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |