F351458

General Info

Members Datasets Scaffolds Average Seq Length
238 167 476 248

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2671180195|2671839101
Length 282
Sequence SHSWSGRLWVPPAGRPPIAVALDAPDGATALDWARAVAPHCAVLKIGLELFLREGGAVVNALRDEGLLVQAGSVGSAGAGHTLGSLTEGDHSALSSPADPAGPAGSAPELFLDLKLHDIPATVAGGMRSLAVLAPRFVTVHAAGGAAMIRAAVEAAPEVHVTAVTVLTSLDAAALASIGLSGPPSDAVRRLAVLAVEAGARALVCSPKEASLVRGELGETVTLITPGVRPEGSEQADQARVATPERALADGSDLLVIGRPITSASDRAVAAATLAARVTPLR

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
19 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
60 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
79 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
80 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
84 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
85 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
86 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
87 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
88 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
89 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
90 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
91 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
92 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
93 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
102 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
103 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
104 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
105 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
106 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
141 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
142 2671180195 Frankia sp. CcI49 Isolate Nodule
143 2506783011 Frankia datiscae Dg1 Isolate Nodule
144 2508501039 Frankia saprophytica CN3 Isolate Nodule
145 2527291629 Frankia sp. BMG5.23 Isolate Nodule
146 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
147 2576861822 Frankia sp. CeD Isolate Nodule
148 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
149 2619618881 Frankia sp. ACN1ag Isolate Unclassified
150 2619619003 Frankia sp. CpI1-P Isolate Nodule
151 2626541554 Frankia sp. AvcI.1 Isolate Nodule
152 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
153 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
154 2684623036 Frankia sp. CgIM4 Isolate Nodule
155 2687453737 Frankia sp. BMG5.36 Isolate Nodule
156 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
157 2710264753 Frankia sp. KB5 Isolate Nodule
158 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
159 2773857922 Frankia sp. CcI49 Isolate Nodule
160 2773857924 Frankia sp. CgIS1 Isolate Nodule
161 2773857933 Frankia sp. BMG5.30 Isolate Nodule
162 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
163 637000116 Frankia casuarinae CcI3 Isolate Nodule
164 8002775197 Frankia nepalensis CN7 Isolate Nodule
165 8054920844 Frankia tisae Agncl-8 Isolate Nodule
166 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
167 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.24
Metatranscriptomes 0.84
Isolates 10.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 8.4
Rhizoplane 0.42
Rhizosphere 87.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10049344 3300003373 Bacteria 1068
2 Ga0070658_10000155 3300005327 Bacteria 60553
3 Ga0070658_10038648 3300005327 Bacteria 3848
4 Ga0070658_10077503 3300005327 Bacteria 2727
5 Ga0070683_100361678 3300005329 Bacteria 1382
6 Ga0070680_100061766 3300005336 Bacteria 3068
7 Ga0070680_100459821 3300005336 Bacteria 1087
8 Ga0070682_100754222 3300005337 Bacteria 786
9 Ga0070660_100091486 3300005339 Bacteria 2400
10 Ga0070661_100380117 3300005344 Bacteria 1113
11 Ga0070681_10011079 3300005458 Bacteria 8919
12 Ga0070681_10074955 3300005458 Bacteria 3344
13 Ga0070681_10510631 3300005458 Bacteria 1115
14 Ga0070679_100079825 3300005530 Bacteria 3261
15 Ga0070679_100122374 3300005530 Bacteria 2586
16 Ga0070679_100383546 3300005530 Bacteria 1352
17 Ga0070679_100626114 3300005530 Bacteria 1019
18 Ga0070684_100021613 3300005535 Bacteria 5359
19 Ga0070684_100038253 3300005535 Bacteria 4120
20 Ga0070684_100863777 3300005535 Bacteria 847
21 Ga0068855_100126474 3300005563 Bacteria 2922
22 Ga0068859_100001250 3300005617 Bacteria 25949
23 Ga0068861_100032340 3300005719 Bacteria 3850
24 Ga0068862_100000021 3300005844 Bacteria 218035
25 Ga0068862_100490894 3300005844 Bacteria 1164
26 Ga0081455_10010594 3300005937 Bacteria 9331
27 Ga0081538_10016570 3300005981 Bacteria 5643
28 Ga0081538_10018027 3300005981 Bacteria 5327
29 Ga0081538_10027008 3300005981 Bacteria 3992
30 Ga0081538_10030849 3300005981 Bacteria 3630
31 Ga0081538_10053709 3300005981 Bacteria 2392
32 Ga0081538_10145552 3300005981 Bacteria 1084
33 Ga0081539_10036548 3300005985 Bacteria 2939
34 Ga0075432_10006516 3300006058 Bacteria 3976
35 Ga0075427_10014124 3300006194 Bacteria 1224
36 Ga0075428_100150931 3300006844 Bacteria 2524
37 Ga0075430_100007249 3300006846 Bacteria 9366
38 Ga0075431_100002185 3300006847 Bacteria 18706
39 Ga0075433_10261716 3300006852 Bacteria 1533
40 Ga0075434_100041853 3300006871 Bacteria 4540
41 Ga0075429_100005729 3300006880 Bacteria 10720
42 Ga0097620_100001250 3300006931 Bacteria 25949
43 Ga0075435_100210693 3300007076 Bacteria 1649
44 Ga0111539_10022486 3300009094 Bacteria 7746
45 Ga0111539_10106670 3300009094 Bacteria 3286
46 Ga0111539_10717033 3300009094 Bacteria 1164
47 Ga0105247_10000164 3300009101 Bacteria 64953
48 Ga0105248_10013366 3300009177 Bacteria 9035
49 Ga0105237_10104320 3300009545 Bacteria 2827
50 Ga0105249_10030448 3300009553 Bacteria 4878
51 Ga0105249_10056435 3300009553 Bacteria 3595
52 Ga0105239_11149216 3300010375 Bacteria 894
53 Ga0157369_10002905 3300013105 Bacteria 20475
54 Ga0157369_10004575 3300013105 Bacteria 16260
55 Ga0157369_10004788 3300013105 Bacteria 15907
56 Ga0157369_10068791 3300013105 Bacteria 3804
57 Ga0157369_10339901 3300013105 Bacteria 1559
58 Ga0163162_10164396 3300013306 Bacteria 2343
59 Ga0157372_10422158 3300013307 Bacteria 1554
60 Ga0163163_10006845 3300014325 Bacteria 10006
61 Ga0163163_10245158 3300014325 Bacteria 1842
62 Ga0157379_10078034 3300014968 Bacteria 2966
63 Ga0206353_10961087 3300020082 Bacteria 1370
64 Ga0224712_10012453 3300022467 Bacteria 2677
65 Ga0207710_10000178 3300025900 Bacteria 64962
66 Ga0207705_10001837 3300025909 Bacteria 16689
67 Ga0207705_10154239 3300025909 Bacteria 1722
68 Ga0207671_10058253 3300025914 Bacteria 2863
69 Ga0207693_10263649 3300025915 Bacteria 1351
70 Ga0207660_10013362 3300025917 Bacteria 5381
71 Ga0207660_10015363 3300025917 Bacteria 5051
72 Ga0207657_10082556 3300025919 Bacteria 2697
73 Ga0207652_10037379 3300025921 Bacteria 4110
74 Ga0207652_10273375 3300025921 Bacteria 1524
75 Ga0207652_10527971 3300025921 Bacteria 1062
76 Ga0207706_10007291 3300025933 Bacteria 10225
77 Ga0207711_10027971 3300025941 Bacteria 4740
78 Ga0207661_10076953 3300025944 Bacteria 2742
79 Ga0207667_10406794 3300025949 Bacteria 1385
80 Ga0207712_10017355 3300025961 Bacteria 4673
81 Ga0207675_100069841 3300026118 Bacteria 3283
82 Ga0207428_10001285 3300027907 Bacteria 26877
83 Ga0207428_10281061 3300027907 Bacteria 1235
84 Ga0268265_10000034 3300028380 Bacteria 218695
85 Ga0268265_10930891 3300028380 Bacteria 855
86 Ga0265338_10019738 3300028800 Bacteria 7130
87 Ga0265330_10014899 3300031235 Bacteria 3602
88 Ga0265325_10002209 3300031241 Bacteria 13209
89 Ga0265340_10054279 3300031247 Bacteria 1932
90 Ga0265339_10007299 3300031249 Bacteria 7163
91 Ga0265316_10032445 3300031344 Bacteria 4262
92 Ga0307408_100472054 3300031548 Bacteria 1093
93 Ga0265313_10045542 3300031595 Bacteria 2135
94 Ga0316575_10037065 3300031665 Bacteria 1920
95 Ga0265314_10006406 3300031711 Bacteria 10430
96 Ga0316578_10017632 3300031728 Bacteria 3891
97 Ga0307405_10014044 3300031731 Bacteria 4293
98 Ga0307413_10303180 3300031824 Bacteria 1212
99 Ga0307410_10190695 3300031852 Bacteria 1558
100 Ga0307406_10272934 3300031901 Bacteria 1285
101 Ga0307406_10273412 3300031901 Bacteria 1284
102 Ga0307407_10007280 3300031903 Bacteria 5002
103 Ga0307407_10120672 3300031903 Bacteria 1661
104 Ga0307412_10127604 3300031911 Bacteria 1842
105 Ga0307412_10623872 3300031911 Bacteria 916
106 Ga0307409_100002233 3300031995 Bacteria 10003
107 Ga0307409_100014647 3300031995 Bacteria 5110
108 Ga0307409_100103640 3300031995 Bacteria 2367
109 Ga0307409_100123648 3300031995 Bacteria 2196
110 Ga0307409_100227435 3300031995 Bacteria 1688
111 Ga0307416_100000342 3300032002 Bacteria 24167
112 Ga0307416_100013805 3300032002 Bacteria 5505
113 Ga0307416_100022738 3300032002 Bacteria 4533
114 Ga0307416_100061570 3300032002 Bacteria 3063
115 Ga0307416_100445975 3300032002 Bacteria 1345
116 Ga0307416_101113021 3300032002 Bacteria 894
117 Ga0307414_10594978 3300032004 Bacteria 991
118 Ga0307411_10296567 3300032005 Bacteria 1294
119 Ga0307415_100018008 3300032126 Bacteria 4252
120 Ga0307415_100027758 3300032126 Bacteria 3591
121 Ga0307415_100271231 3300032126 Bacteria 1390
122 Ga0307415_100310904 3300032126 Bacteria 1309
123 Ga0316214_1014295 3300033545 Bacteria 1091
124 Ga0316574_0019188 3300035398 Bacteria 4032
125 Ga0316574_0120922 3300035398 Bacteria 1682
126 Ga0316584_0430218 3300036712 Bacteria 936
127 Ga0395900_0062246 3300037418 Bacteria 3836
128 Ga0436364_0432398 3300037853 Bacteria 1489
129 Ga0436363_1331181 3300039450 Bacteria 3112
130 Ga0439448_0001562 3300042005 Bacteria 5995
131 Ga0439450_029551 3300042008 Bacteria 1225
132 Ga0439455_0013101 3300042012 Bacteria 1872
133 Ga0439455_0049812 3300042012 Bacteria 1092
134 Ga0439463_001733 3300042016 Bacteria 5690
135 Ga0439463_011481 3300042016 Bacteria 2175
136 Ga0439463_027318 3300042016 Bacteria 1436
137 Ga0450902_026070 3300042137 Bacteria 977
138 Ga0439435_0090701 3300042436 Bacteria 928
139 Ga0439444_0004512 3300042437 Bacteria 2027
140 Ga0439464_0001837 3300042439 Bacteria 5126
141 Ga0439464_0063862 3300042439 Bacteria 1081
142 Ga0439464_0082709 3300042439 Bacteria 960
143 Ga0450916_002190 3300042530 Bacteria 2051
144 Ga0439440_0003853 3300042993 Bacteria 2919
145 Ga0466961_0065886 3300044693 Bacteria 2302
146 Ga0466971_0054909 3300044719 Bacteria 1795
147 Ga0466968_0059304 3300044735 Bacteria 1648
148 Ga0466957_0058250 3300044842 Bacteria 2366
149 Ga0466957_0090445 3300044842 Bacteria 1917
150 Ga0466960_0031121 3300044901 Bacteria 2460
151 Ga0466959_0232415 3300045049 Bacteria 1276
152 Ga0466967_0093530 3300045976 Bacteria 2736
153 Ga0466967_0160783 3300045976 Bacteria 2108
154 Ga0495584_0151346 3300046491 Bacteria 1179
155 Ga0495616_0102773 3300046513 Bacteria 1339
156 Ga0495644_0024627 3300046523 Bacteria 2289
157 Ga0495663_0004552 3300046525 Bacteria 3889
158 Ga0496119_0000375 3300048922 Bacteria 61774
159 Ga0496120_0000453 3300048923 Bacteria 64868
160 Ga0501031_0016344 3300049568 Bacteria 4818
161 Ga0501032_0049280 3300049569 Bacteria 2841
162 Ga0501033_0042006 3300049570 Bacteria 3410
163 Ga0501036_0002075 3300049572 Bacteria 15633
164 Ga0501037_0011482 3300049573 Bacteria 6522
165 Ga0501038_0008744 3300049574 Bacteria 9290
166 Ga0501038_0019485 3300049574 Bacteria 6115
167 Ga0501039_0000517 3300049575 Bacteria 27904
168 Ga0501039_0002771 3300049575 Bacteria 13073
169 Ga0501040_0002635 3300049576 Bacteria 11574
170 Ga0501040_0006551 3300049576 Bacteria 7561
171 Ga0501041_0009814 3300049577 Bacteria 5636
172 Ga0501041_0053134 3300049577 Bacteria 2470
173 Ga0501042_0000452 3300049578 Bacteria 21094
174 Ga0501042_0075825 3300049578 Bacteria 2406
175 Ga0501043_0040785 3300049579 Bacteria 3648
176 Ga0501043_0464119 3300049579 Bacteria 950
177 Ga0501046_0004957 3300049580 Bacteria 11951
178 Ga0501048_0003507 3300049582 Bacteria 11928
179 Ga0501048_0007241 3300049582 Bacteria 8414
180 Ga0501068_0110405 3300049584 Bacteria 1709
181 Ga0501071_0034774 3300049587 Bacteria 3588
182 Ga0501072_0014522 3300049588 Bacteria 6034
183 Ga0501074_0126342 3300049590 Bacteria 1829
184 Ga0501075_0004501 3300049591 Bacteria 9438
185 Ga0501075_0028769 3300049591 Bacteria 4104
186 Ga0501076_0003469 3300049592 Bacteria 11074
187 Ga0501076_0004627 3300049592 Bacteria 9799
188 Ga0501077_0009186 3300049593 Bacteria 6138
189 Ga0501077_0013514 3300049593 Bacteria 5120
190 Ga0501079_0000402 3300049741 Bacteria 27959
191 Ga0501079_0002596 3300049741 Bacteria 13124
192 Ga0501081_0000939 3300049743 Bacteria 17297
193 Ga0501081_0004008 3300049743 Bacteria 9443
194 Ga0501083_0045479 3300049744 Bacteria 2970
195 Ga0501035_0043943 3300049822 Bacteria 4025
196 Ga0501035_0211409 3300049822 Bacteria 1659
197 Ga0501045_0000125 3300049824 Bacteria 40131
198 Ga0501045_0000156 3300049824 Bacteria 36940
199 nmdc:mga05p37_21038_c1 3300050507 Bacteria 7896
200 nmdc:mga09592_95242_c1 3300050508 Bacteria 2547
201 nmdc:mga0qj67_1782_c1 3300050509 Bacteria 15242
202 nmdc:mga06r32_7441_c1 3300050510 Bacteria 9854
203 nmdc:mga08y16_360518_c1 3300050511 Bacteria 1492
204 nmdc:mga08y16_375485_c1 3300050511 Bacteria 1458
205 nmdc:mga08y16_3804_c1 3300050511 Bacteria 15702
206 nmdc:mga0a205_13246_c1 3300050515 Bacteria 7669
207 nmdc:mga0a205_30743_c2 3300050515 Bacteria 3390
208 Ga0501084_0017273 3300054114 Bacteria 5994
209 Ga0501082_0000501 3300060353 Bacteria 34701
210 Ga0501082_0004633 3300060353 Bacteria 11998
211 Ga0466962_0023859 3300061719 Bacteria 2940
212 Ga0530510_0000266 3300061734 Bacteria 32748
213 2671839101 2671180195 Bacteria 9757215
214 2506867875 2506783011 Bacteria 5323186
215 2508678230 2508501039 Bacteria 9978592
216 2528215000 2527291629 Bacteria 5267418
217 2546950300 2546825537 Bacteria 5389291
218 2579750216 2576861822 Bacteria 5004595
219 2579856441 2579778521 Bacteria 7624758
220 2619858113 2619618881 Bacteria 7521104
221 2620352582 2619619003 Bacteria 7619552
222 2626639635 2626541554 Bacteria 7741902
223 2676201676 2675902999 Bacteria 9438463
224 2686537829 2684623035 Bacteria 8032739
225 2686543106 2684623036 Bacteria 5199090
226 2689956258 2687453737 Bacteria 11203906
227 2689991619 2687453743 Bacteria 8361025
228 2710603782 2710264753 Bacteria 5455564
229 2774846252 2773857921 Bacteria 9435764
230 2774857257 2773857922 Bacteria 9757215
231 2774866131 2773857924 Bacteria 5256821
232 2774904297 2773857933 Bacteria 5818019
233 2895888706 2895880812 Bacteria 11255272
234 637880521 637000116 Bacteria 5433628
235 8002782814 8002775197 Bacteria 10728764
236 8054923148 8054920844 Bacteria 7068637
237 8055160851 8055157932 Bacteria 6429399
238 8056065537 8056060235 Bacteria 7259403
239 JGI25407J50210_10049344
240 Ga0070658_10000155
241 Ga0070658_10038648
242 Ga0070658_10077503
243 Ga0070683_100361678
244 Ga0070680_100061766
245 Ga0070680_100459821
246 Ga0070682_100754222
247 Ga0070660_100091486
248 Ga0070661_100380117
249 Ga0070681_10011079
250 Ga0070681_10074955
251 Ga0070681_10510631
252 Ga0070679_100079825
253 Ga0070679_100122374
254 Ga0070679_100383546
255 Ga0070679_100626114
256 Ga0070684_100021613
257 Ga0070684_100038253
258 Ga0070684_100863777
259 Ga0068855_100126474
260 Ga0068859_100001250
261 Ga0068861_100032340
262 Ga0068862_100000021
263 Ga0068862_100490894
264 Ga0081455_10010594
265 Ga0081538_10016570
266 Ga0081538_10018027
267 Ga0081538_10027008
268 Ga0081538_10030849
269 Ga0081538_10053709
270 Ga0081538_10145552
271 Ga0081539_10036548
272 Ga0075432_10006516
273 Ga0075427_10014124
274 Ga0075428_100150931
275 Ga0075430_100007249
276 Ga0075431_100002185
277 Ga0075433_10261716
278 Ga0075434_100041853
279 Ga0075429_100005729
280 Ga0097620_100001250
281 Ga0075435_100210693
282 Ga0111539_10022486
283 Ga0111539_10106670
284 Ga0111539_10717033
285 Ga0105247_10000164
286 Ga0105248_10013366
287 Ga0105237_10104320
288 Ga0105249_10030448
289 Ga0105249_10056435
290 Ga0105239_11149216
291 Ga0157369_10002905
292 Ga0157369_10004575
293 Ga0157369_10004788
294 Ga0157369_10068791
295 Ga0157369_10339901
296 Ga0163162_10164396
297 Ga0157372_10422158
298 Ga0163163_10006845
299 Ga0163163_10245158
300 Ga0157379_10078034
301 Ga0206353_10961087
302 Ga0224712_10012453
303 Ga0207710_10000178
304 Ga0207705_10001837
305 Ga0207705_10154239
306 Ga0207671_10058253
307 Ga0207693_10263649
308 Ga0207660_10013362
309 Ga0207660_10015363
310 Ga0207657_10082556
311 Ga0207652_10037379
312 Ga0207652_10273375
313 Ga0207652_10527971
314 Ga0207706_10007291
315 Ga0207711_10027971
316 Ga0207661_10076953
317 Ga0207667_10406794
318 Ga0207712_10017355
319 Ga0207675_100069841
320 Ga0207428_10001285
321 Ga0207428_10281061
322 Ga0268265_10000034
323 Ga0268265_10930891
324 Ga0265338_10019738
325 Ga0265330_10014899
326 Ga0265325_10002209
327 Ga0265340_10054279
328 Ga0265339_10007299
329 Ga0265316_10032445
330 Ga0307408_100472054
331 Ga0265313_10045542
332 Ga0316575_10037065
333 Ga0265314_10006406
334 Ga0316578_10017632
335 Ga0307405_10014044
336 Ga0307413_10303180
337 Ga0307410_10190695
338 Ga0307406_10272934
339 Ga0307406_10273412
340 Ga0307407_10007280
341 Ga0307407_10120672
342 Ga0307412_10127604
343 Ga0307412_10623872
344 Ga0307409_100002233
345 Ga0307409_100014647
346 Ga0307409_100103640
347 Ga0307409_100123648
348 Ga0307409_100227435
349 Ga0307416_100000342
350 Ga0307416_100013805
351 Ga0307416_100022738
352 Ga0307416_100061570
353 Ga0307416_100445975
354 Ga0307416_101113021
355 Ga0307414_10594978
356 Ga0307411_10296567
357 Ga0307415_100018008
358 Ga0307415_100027758
359 Ga0307415_100271231
360 Ga0307415_100310904
361 Ga0316214_1014295
362 Ga0316574_0019188
363 Ga0316574_0120922
364 Ga0316584_0430218
365 Ga0395900_0062246
366 Ga0436364_0432398
367 Ga0436363_1331181
368 Ga0439448_0001562
369 Ga0439450_029551
370 Ga0439455_0013101
371 Ga0439455_0049812
372 Ga0439463_001733
373 Ga0439463_011481
374 Ga0439463_027318
375 Ga0450902_026070
376 Ga0439435_0090701
377 Ga0439444_0004512
378 Ga0439464_0001837
379 Ga0439464_0063862
380 Ga0439464_0082709
381 Ga0450916_002190
382 Ga0439440_0003853
383 Ga0466961_0065886
384 Ga0466971_0054909
385 Ga0466968_0059304
386 Ga0466957_0058250
387 Ga0466957_0090445
388 Ga0466960_0031121
389 Ga0466959_0232415
390 Ga0466967_0093530
391 Ga0466967_0160783
392 Ga0495584_0151346
393 Ga0495616_0102773
394 Ga0495644_0024627
395 Ga0495663_0004552
396 Ga0496119_0000375
397 Ga0496120_0000453
398 Ga0501031_0016344
399 Ga0501032_0049280
400 Ga0501033_0042006
401 Ga0501036_0002075
402 Ga0501037_0011482
403 Ga0501038_0008744
404 Ga0501038_0019485
405 Ga0501039_0000517
406 Ga0501039_0002771
407 Ga0501040_0002635
408 Ga0501040_0006551
409 Ga0501041_0009814
410 Ga0501041_0053134
411 Ga0501042_0000452
412 Ga0501042_0075825
413 Ga0501043_0040785
414 Ga0501043_0464119
415 Ga0501046_0004957
416 Ga0501048_0003507
417 Ga0501048_0007241
418 Ga0501068_0110405
419 Ga0501071_0034774
420 Ga0501072_0014522
421 Ga0501074_0126342
422 Ga0501075_0004501
423 Ga0501075_0028769
424 Ga0501076_0003469
425 Ga0501076_0004627
426 Ga0501077_0009186
427 Ga0501077_0013514
428 Ga0501079_0000402
429 Ga0501079_0002596
430 Ga0501081_0000939
431 Ga0501081_0004008
432 Ga0501083_0045479
433 Ga0501035_0043943
434 Ga0501035_0211409
435 Ga0501045_0000125
436 Ga0501045_0000156
437 nmdc:mga05p37_21038_c1
438 nmdc:mga09592_95242_c1
439 nmdc:mga0qj67_1782_c1
440 nmdc:mga06r32_7441_c1
441 nmdc:mga08y16_360518_c1
442 nmdc:mga08y16_375485_c1
443 nmdc:mga08y16_3804_c1
444 nmdc:mga0a205_13246_c1
445 nmdc:mga0a205_30743_c2
446 Ga0501084_0017273
447 Ga0501082_0000501
448 Ga0501082_0004633
449 Ga0466962_0023859
450 Ga0530510_0000266
451 2671839101
452 2506867875
453 2508678230
454 2528215000
455 2546950300
456 2579750216
457 2579856441
458 2619858113
459 2620352582
460 2626639635
461 2676201676
462 2686537829
463 2686543106
464 2689956258
465 2689991619
466 2710603782
467 2774846252
468 2774857257
469 2774866131
470 2774904297
471 2895888706
472 637880521
473 8002782814
474 8054923148
475 8055160851
476 8056065537

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00215

OMPdecase

Orotidine 5'-phosphate decarboxylase / HUMPS family

105

274

0.97

PF00215

OMPdecase

Orotidine 5'-phosphate decarboxylase / HUMPS family

16

71

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cso-assembly1.cif.gz_B crystal structure of orotidine 5'-phosphate decarboxylase from klebsiella pneumoniae in complex with uridine-5'-monophosphate 0.9504 5 222
1jjk-assembly1.cif.gz_A selenomethionine substitution of orotidine-5'-monophosphate decarboxylase from e. coli causes a change in crystal contacts and space group 0.9485 3 222
8cso-assembly5.cif.gz_J crystal structure of orotidine 5'-phosphate decarboxylase from klebsiella pneumoniae in complex with uridine-5'-monophosphate 0.9425 6 171
1dbt-assembly2.cif.gz_C-2 crystal structure of orotidine 5'-monophosphate decarboxylase from bacillus subtilis complexed with ump 0.9376 3 225
3ru6-assembly2.cif.gz_C 1.8 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase (pyrf) from campylobacter jejuni subsp. jejuni nctc 11168 0.9168 5 223
ID Description Score Start End Superfamily
1jjkA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9257 3 224 3.20.20.70
3ru6D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9164 5 223 3.20.20.70
1jjkA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9057 3 224 3.20.20.70
3ru6D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9003 5 223 3.20.20.70
2yyuB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9 4 224 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A537YE04-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) 0.9744 2 223 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A381RPI2-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) 0.9732 25 227 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A1F9F7U1-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) 0.9672 2 225 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A357R6R8-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) 0.9672 34 226 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-Q5GRJ9-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) 0.9667 3 224 GO:0004590
GO:0005829
GO:0006207
GO:0044205

Map