F351419

General Info

Members Datasets Scaffolds Average Seq Length
238 150 476 229

Family's Representative Sequence

Representative Sequence 3300053084|Ga0495595_0065745|Ga0495595_0065745_475_1287
Length 270
Sequence MNRQTRLVEVRQHVLKQNDVAACAPRARFREAGVYVVSLVSSPGAGKTAFLERTLTYLGRSHRVAALVGDLATDNDAQRLARSGAPVRQITTGTVCHLEADMVAGALDGWRPEDLDFLFVENVGNLVCPATFDLGEALRVVLLSVTEGEDKPLKYPTVFNTADVVVVTKVDLAAAVEFDARALDRNLQAVRPGIEALAVSAKSGDEMGAWLDLLAAGRAGCWRKKATARRIAGSMLRWSPGTVAASTSRPRSGIAAGASGSGRRQSIAFG

Samples

Sample ID Description Type Environment
1 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
94 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
95 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
146 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
147 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
150 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.74
Metatranscriptomes 0.84
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.72
Rhizosphere 89.5
Stem 0
Stem Tuber 0
Unclassified 2.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495595_0065745 3300053084 Bacteria 1706
2 Ga0058862_12709008 3300004803 Bacteria 1145
3 Ga0065715_10591948 3300005293 Bacteria 713
4 Ga0070683_100013325 3300005329 Bacteria 7168
5 Ga0070683_100024489 3300005329 Bacteria 5408
6 Ga0068869_100645268 3300005334 Bacteria 898
7 Ga0070680_100192643 3300005336 Bacteria 1718
8 Ga0070660_100002931 3300005339 Bacteria 11745
9 Ga0070660_100053572 3300005339 Bacteria 3112
10 Ga0070660_100172751 3300005339 Bacteria 1746
11 Ga0070674_100441536 3300005356 Bacteria 1072
12 Ga0070673_100340311 3300005364 Bacteria 1329
13 Ga0070659_100144886 3300005366 Bacteria 1935
14 Ga0070659_100228303 3300005366 Bacteria 1538
15 Ga0070709_10245862 3300005434 Unclassified 1287
16 Ga0070713_100020284 3300005436 Bacteria 5093
17 Ga0070713_100211026 3300005436 Bacteria 1758
18 Ga0070711_100062656 3300005439 Bacteria 2593
19 Ga0070711_100114863 3300005439 Bacteria 1982
20 Ga0070705_100024220 3300005440 Bacteria 3273
21 Ga0070705_100044930 3300005440 Bacteria 2539
22 Ga0070694_100000747 3300005444 Bacteria 18214
23 Ga0070694_100033538 3300005444 Bacteria 3379
24 Ga0070681_10004223 3300005458 Bacteria 13617
25 Ga0070681_10076516 3300005458 Bacteria 3305
26 Ga0070699_100017583 3300005518 Bacteria 6138
27 Ga0070699_100170683 3300005518 Bacteria 1927
28 Ga0070679_100003974 3300005530 Bacteria 13616
29 Ga0070679_100137115 3300005530 Bacteria 2428
30 Ga0070679_100370032 3300005530 Bacteria 1380
31 Ga0070684_100006087 3300005535 Bacteria 9291
32 Ga0070684_100008479 3300005535 Bacteria 8040
33 Ga0070697_100005140 3300005536 Bacteria 10046
34 Ga0070697_100129827 3300005536 Bacteria 2113
35 Ga0070697_100242062 3300005536 Bacteria 1541
36 Ga0068853_100008548 3300005539 Bacteria 8228
37 Ga0070686_100425619 3300005544 Bacteria 1015
38 Ga0070695_100100836 3300005545 Bacteria 1944
39 Ga0070695_100381985 3300005545 Bacteria 1063
40 Ga0070696_100019088 3300005546 Bacteria 4641
41 Ga0070704_100074341 3300005549 Bacteria 2478
42 Ga0068855_100011981 3300005563 Bacteria 10483
43 Ga0068855_100028383 3300005563 Bacteria 6694
44 Ga0070664_100003711 3300005564 Bacteria 12312
45 Ga0070664_100130604 3300005564 Bacteria 2206
46 Ga0068857_100002252 3300005577 Bacteria 15693
47 Ga0068856_100007248 3300005614 Bacteria 10818
48 Ga0068852_100170581 3300005616 Bacteria 2039
49 Ga0068852_100719594 3300005616 Bacteria 1009
50 Ga0068859_100028055 3300005617 Bacteria 5644
51 Ga0068859_100159297 3300005617 Bacteria 2336
52 Ga0068864_100931078 3300005618 Bacteria 859
53 Ga0081455_10303857 3300005937 Bacteria 1143
54 Ga0070716_100585098 3300006173 Bacteria 837
55 Ga0070716_100656364 3300006173 Bacteria 796
56 Ga0070712_100048179 3300006175 Bacteria 2953
57 Ga0097621_100016859 3300006237 Bacteria 5536
58 Ga0068871_100094325 3300006358 Bacteria 2498
59 Ga0068871_100113190 3300006358 Bacteria 2285
60 Ga0075431_100095772 3300006847 Bacteria 3064
61 Ga0075431_100119633 3300006847 Bacteria 2718
62 Ga0075433_10040675 3300006852 Bacteria 4024
63 Ga0075434_100002454 3300006871 Bacteria 16325
64 Ga0075434_100023741 3300006871 Bacteria 5982
65 Ga0097620_100028055 3300006931 Bacteria 5644
66 Ga0097620_100159291 3300006931 Bacteria 2336
67 Ga0075435_100391009 3300007076 Bacteria 1195
68 Ga0075435_100460438 3300007076 Bacteria 1097
69 Ga0105240_10000620 3300009093 Bacteria 65714
70 Ga0105240_10041927 3300009093 Bacteria 5837
71 Ga0105245_10133554 3300009098 Bacteria 2330
72 Ga0114129_10071646 3300009147 Bacteria 4833
73 Ga0114129_10107429 3300009147 Bacteria 3855
74 Ga0114129_10254853 3300009147 Bacteria 2354
75 Ga0114129_10382040 3300009147 Bacteria 1860
76 Ga0105243_10000121 3300009148 Bacteria 90206
77 Ga0105243_10215111 3300009148 Bacteria 1695
78 Ga0105242_10000348 3300009176 Bacteria 37181
79 Ga0105248_10137263 3300009177 Bacteria 2759
80 Ga0105248_10531908 3300009177 Bacteria 1326
81 Ga0105238_10137394 3300009551 Bacteria 2422
82 Ga0157373_10029430 3300013100 Bacteria 3956
83 Ga0157369_10001372 3300013105 Bacteria 29999
84 Ga0157369_10028033 3300013105 Bacteria 6237
85 Ga0157369_10113268 3300013105 Bacteria 2882
86 Ga0157374_10006603 3300013296 Bacteria 9854
87 Ga0157372_10012038 3300013307 Bacteria 9212
88 Ga0157372_10053533 3300013307 Bacteria 4499
89 Ga0157372_10149105 3300013307 Bacteria 2698
90 Ga0157376_10042164 3300014969 Bacteria 3740
91 Ga0206352_10683309 3300020078 Bacteria 870
92 Ga0213875_10051262 3300021388 Bacteria 1933
93 Ga0213875_10143188 3300021388 Bacteria 1119
94 Ga0207699_10296811 3300025906 Bacteria 1127
95 Ga0207707_10008286 3300025912 Bacteria 9022
96 Ga0207707_10117806 3300025912 Bacteria 2321
97 Ga0207695_10004048 3300025913 Bacteria 20161
98 Ga0207663_10102077 3300025916 Bacteria 1929
99 Ga0207657_10014400 3300025919 Bacteria 7723
100 Ga0207657_10061505 3300025919 Bacteria 3219
101 Ga0207657_10170295 3300025919 Bacteria 1765
102 Ga0207649_10004751 3300025920 Bacteria 7350
103 Ga0207649_10019533 3300025920 Bacteria 3873
104 Ga0207649_10170994 3300025920 Bacteria 1514
105 Ga0207652_10032408 3300025921 Bacteria 4393
106 Ga0207652_10542676 3300025921 Bacteria 1045
107 Ga0207652_10927973 3300025921 Bacteria 768
108 Ga0207694_10142641 3300025924 Bacteria 1927
109 Ga0207694_10206720 3300025924 Bacteria 1598
110 Ga0207687_10073824 3300025927 Bacteria 2443
111 Ga0207700_10028873 3300025928 Unclassified 3908
112 Ga0207700_10073701 3300025928 Bacteria 2637
113 Ga0207664_10048200 3300025929 Unclassified 3350
114 Ga0207690_10192162 3300025932 Bacteria 1544
115 Ga0207690_10237039 3300025932 Bacteria 1403
116 Ga0207706_10183371 3300025933 Bacteria 1838
117 Ga0207686_10000221 3300025934 Bacteria 43581
118 Ga0207709_10000012 3300025935 Bacteria 552803
119 Ga0207665_10108151 3300025939 Bacteria 1951
120 Ga0207665_10688567 3300025939 Bacteria 803
121 Ga0207661_10018494 3300025944 Bacteria 5177
122 Ga0207661_10031300 3300025944 Bacteria 4108
123 Ga0207679_10007663 3300025945 Bacteria 6858
124 Ga0207679_10119386 3300025945 Bacteria 2096
125 Ga0207667_10014060 3300025949 Bacteria 9136
126 Ga0207667_10039041 3300025949 Bacteria 5062
127 Ga0207639_10002428 3300026041 Bacteria 12523
128 Ga0207708_10126007 3300026075 Bacteria 1999
129 Ga0207702_10033141 3300026078 Bacteria 4314
130 Ga0207702_10472230 3300026078 Bacteria 1220
131 Ga0207674_10000233 3300026116 Bacteria 69271
132 Ga0207674_10246410 3300026116 Bacteria 1734
133 Ga0207675_101191511 3300026118 Bacteria 782
134 Ga0207698_10810256 3300026142 Bacteria 939
135 Ga0207428_10246220 3300027907 Bacteria 1334
136 Ga0307405_10012082 3300031731 Bacteria 4555
137 Ga0307410_10002229 3300031852 Bacteria 9252
138 Ga0307410_10103553 3300031852 Bacteria 2044
139 Ga0307406_10024431 3300031901 Bacteria 3610
140 Ga0307407_10045060 3300031903 Bacteria 2490
141 Ga0307412_10054836 3300031911 Bacteria 2648
142 Ga0307409_100024741 3300031995 Bacteria 4195
143 Ga0307409_100098863 3300031995 Bacteria 2414
144 Ga0307416_100010773 3300032002 Bacteria 6057
145 Ga0307416_100740001 3300032002 Bacteria 1075
146 Ga0307414_10283430 3300032004 Bacteria 1393
147 Ga0307411_10014077 3300032005 Bacteria 4439
148 Ga0307411_10434810 3300032005 Bacteria 1093
149 Ga0307415_100005010 3300032126 Bacteria 6973
150 Ga0307415_100449758 3300032126 Bacteria 1113
151 Ga0373934_0001935 3300035086 Bacteria 7592
152 Ga0373953_0017555 3300035117 Bacteria 2633
153 Ga0373953_0176160 3300035117 Bacteria 922
154 Ga0373957_0128365 3300035120 Bacteria 1030
155 Ga0373955_0266781 3300035172 Bacteria 1028
156 Ga0373931_0085459 3300035691 Bacteria 1749
157 Ga0373933_0003373 3300035724 Bacteria 8904
158 Ga0373933_0149190 3300035724 Bacteria 1480
159 Ga0373947_0108070 3300035725 Bacteria 1755
160 Ga0373937_0000217 3300036401 Bacteria 55775
161 Ga0373937_0093366 3300036401 Bacteria 2790
162 Ga0373937_0105429 3300036401 Bacteria 2619
163 Ga0395905_0132951 3300037471 Bacteria 2340
164 Ga0395905_0154556 3300037471 Bacteria 2158
165 Ga0395905_0552015 3300037471 Unclassified 1053
166 Ga0436364_0174235 3300037853 Bacteria 4226
167 Ga0436364_0287761 3300037853 Bacteria 2621
168 Ga0436364_0801856 3300037853 Bacteria 4009
169 Ga0436364_1122518 3300037853 Bacteria 2205
170 Ga0436360_0568204 3300039438 Bacteria 1038
171 Ga0436361_0390978 3300039447 Bacteria 3639
172 Ga0436363_0319868 3300039450 Bacteria 4163
173 Ga0439446_0078287 3300042156 Bacteria 1020
174 Ga0466959_0004116 3300045049 Bacteria 9687
175 Ga0495592_0211495 3300046454 Bacteria 1302
176 Ga0495608_0002013 3300046511 Bacteria 14563
177 Ga0495587_0297398 3300046536 Bacteria 903
178 Ga0495587_0386495 3300046536 Bacteria 778
179 Ga0495645_0014053 3300046543 Bacteria 5675
180 Ga0495645_0061234 3300046543 Unclassified 2727
181 Ga0495600_0036668 3300046809 Bacteria 3187
182 Ga0495604_0043408 3300047317 Bacteria 3520
183 Ga0495604_0057198 3300047317 Bacteria 2999
184 Ga0495675_0169237 3300047444 Bacteria 1342
185 Ga0496100_0148034 3300048903 Bacteria 1672
186 Ga0496102_0012524 3300048905 Bacteria 7342
187 Ga0496102_0022028 3300048905 Bacteria 5644
188 Ga0496103_0007305 3300048906 Bacteria 6584
189 Ga0496103_0055362 3300048906 Bacteria 2460
190 Ga0496104_0000503 3300048907 Bacteria 33699
191 Ga0496104_0065018 3300048907 Bacteria 3461
192 Ga0496104_0081341 3300048907 Bacteria 3089
193 Ga0496106_0737981 3300048909 Bacteria 783
194 Ga0496108_0000715 3300048911 Bacteria 25783
195 Ga0496110_0053064 3300048913 Bacteria 3563
196 Ga0496112_0179739 3300048915 Bacteria 2080
197 Ga0496112_0207244 3300048915 Bacteria 1918
198 Ga0496112_0640647 3300048915 Bacteria 993
199 Ga0496113_0052341 3300048916 Bacteria 3049
200 Ga0496115_0067728 3300048918 Bacteria 2888
201 Ga0496126_0000068 3300048929 Bacteria 248663
202 Ga0496126_0000074 3300048929 Bacteria 235643
203 Ga0501036_0300671 3300049572 Bacteria 1342
204 Ga0501037_0440432 3300049573 Bacteria 890
205 Ga0501040_0182933 3300049576 Bacteria 1486
206 Ga0501040_0229150 3300049576 Bacteria 1323
207 Ga0501041_0086184 3300049577 Bacteria 1937
208 Ga0501042_0103438 3300049578 Bacteria 2049
209 Ga0501069_0407426 3300049585 Bacteria 805
210 Ga0501075_0475211 3300049591 Bacteria 953
211 Ga0501077_0272835 3300049593 Bacteria 1076
212 Ga0501079_0381211 3300049741 Bacteria 1106
213 Ga0501081_0449277 3300049743 Bacteria 957
214 Ga0501044_0524400 3300049823 Bacteria 1084
215 nmdc:mga05p37_253028_c1 3300050507 Bacteria 2112
216 nmdc:mga05p37_499857_c1 3300050507 Bacteria 1396
217 nmdc:mga05p37_824204_c1 3300050507 Bacteria 1011
218 nmdc:mga0qj67_121894_c1 3300050509 Bacteria 2109
219 nmdc:mga06r32_212688_c1 3300050510 Bacteria 1921
220 nmdc:mga06r32_430124_c1 3300050510 Bacteria 1301
221 nmdc:mga0n895_204928_c1 3300050512 Bacteria 2003
222 nmdc:mga0n895_22174_c1 3300050512 Bacteria 5952
223 nmdc:mga0n895_339312_c1 3300050512 Bacteria 1522
224 nmdc:mga0n895_53140_c1 3300050512 Bacteria 3979
225 nmdc:mga0rr50_210526_c1 3300050513 Bacteria 1601
226 nmdc:mga0rr50_237336_c1 3300050513 Bacteria 1019
227 nmdc:mga0rr50_640786_c1 3300050513 Bacteria 906
228 nmdc:mga0a205_114812_c1 3300050515 Unclassified 2591
229 nmdc:mga0a205_59404_c1 3300050515 Bacteria 3693
230 Ga0495619_0285897 3300053085 Bacteria 1143
231 Ga0501084_0010204 3300054114 Bacteria 7769
232 Ga0590071_001632 3300059421 Bacteria 5862
233 Ga0590074_000835 3300059423 Bacteria 4766
234 Ga0590077_001156 3300059426 Bacteria 6424
235 Ga0501082_0017468 3300060353 Bacteria 6182
236 Ga0501082_0438657 3300060353 Bacteria 1141
237 Ga0530510_0334170 3300061734 Bacteria 1137
238 2898909280 2898907183 Bacteria 4067722
239 Ga0495595_0065745
240 Ga0058862_12709008
241 Ga0065715_10591948
242 Ga0070683_100013325
243 Ga0070683_100024489
244 Ga0068869_100645268
245 Ga0070680_100192643
246 Ga0070660_100002931
247 Ga0070660_100053572
248 Ga0070660_100172751
249 Ga0070674_100441536
250 Ga0070673_100340311
251 Ga0070659_100144886
252 Ga0070659_100228303
253 Ga0070709_10245862
254 Ga0070713_100020284
255 Ga0070713_100211026
256 Ga0070711_100062656
257 Ga0070711_100114863
258 Ga0070705_100024220
259 Ga0070705_100044930
260 Ga0070694_100000747
261 Ga0070694_100033538
262 Ga0070681_10004223
263 Ga0070681_10076516
264 Ga0070699_100017583
265 Ga0070699_100170683
266 Ga0070679_100003974
267 Ga0070679_100137115
268 Ga0070679_100370032
269 Ga0070684_100006087
270 Ga0070684_100008479
271 Ga0070697_100005140
272 Ga0070697_100129827
273 Ga0070697_100242062
274 Ga0068853_100008548
275 Ga0070686_100425619
276 Ga0070695_100100836
277 Ga0070695_100381985
278 Ga0070696_100019088
279 Ga0070704_100074341
280 Ga0068855_100011981
281 Ga0068855_100028383
282 Ga0070664_100003711
283 Ga0070664_100130604
284 Ga0068857_100002252
285 Ga0068856_100007248
286 Ga0068852_100170581
287 Ga0068852_100719594
288 Ga0068859_100028055
289 Ga0068859_100159297
290 Ga0068864_100931078
291 Ga0081455_10303857
292 Ga0070716_100585098
293 Ga0070716_100656364
294 Ga0070712_100048179
295 Ga0097621_100016859
296 Ga0068871_100094325
297 Ga0068871_100113190
298 Ga0075431_100095772
299 Ga0075431_100119633
300 Ga0075433_10040675
301 Ga0075434_100002454
302 Ga0075434_100023741
303 Ga0097620_100028055
304 Ga0097620_100159291
305 Ga0075435_100391009
306 Ga0075435_100460438
307 Ga0105240_10000620
308 Ga0105240_10041927
309 Ga0105245_10133554
310 Ga0114129_10071646
311 Ga0114129_10107429
312 Ga0114129_10254853
313 Ga0114129_10382040
314 Ga0105243_10000121
315 Ga0105243_10215111
316 Ga0105242_10000348
317 Ga0105248_10137263
318 Ga0105248_10531908
319 Ga0105238_10137394
320 Ga0157373_10029430
321 Ga0157369_10001372
322 Ga0157369_10028033
323 Ga0157369_10113268
324 Ga0157374_10006603
325 Ga0157372_10012038
326 Ga0157372_10053533
327 Ga0157372_10149105
328 Ga0157376_10042164
329 Ga0206352_10683309
330 Ga0213875_10051262
331 Ga0213875_10143188
332 Ga0207699_10296811
333 Ga0207707_10008286
334 Ga0207707_10117806
335 Ga0207695_10004048
336 Ga0207663_10102077
337 Ga0207657_10014400
338 Ga0207657_10061505
339 Ga0207657_10170295
340 Ga0207649_10004751
341 Ga0207649_10019533
342 Ga0207649_10170994
343 Ga0207652_10032408
344 Ga0207652_10542676
345 Ga0207652_10927973
346 Ga0207694_10142641
347 Ga0207694_10206720
348 Ga0207687_10073824
349 Ga0207700_10028873
350 Ga0207700_10073701
351 Ga0207664_10048200
352 Ga0207690_10192162
353 Ga0207690_10237039
354 Ga0207706_10183371
355 Ga0207686_10000221
356 Ga0207709_10000012
357 Ga0207665_10108151
358 Ga0207665_10688567
359 Ga0207661_10018494
360 Ga0207661_10031300
361 Ga0207679_10007663
362 Ga0207679_10119386
363 Ga0207667_10014060
364 Ga0207667_10039041
365 Ga0207639_10002428
366 Ga0207708_10126007
367 Ga0207702_10033141
368 Ga0207702_10472230
369 Ga0207674_10000233
370 Ga0207674_10246410
371 Ga0207675_101191511
372 Ga0207698_10810256
373 Ga0207428_10246220
374 Ga0307405_10012082
375 Ga0307410_10002229
376 Ga0307410_10103553
377 Ga0307406_10024431
378 Ga0307407_10045060
379 Ga0307412_10054836
380 Ga0307409_100024741
381 Ga0307409_100098863
382 Ga0307416_100010773
383 Ga0307416_100740001
384 Ga0307414_10283430
385 Ga0307411_10014077
386 Ga0307411_10434810
387 Ga0307415_100005010
388 Ga0307415_100449758
389 Ga0373934_0001935
390 Ga0373953_0017555
391 Ga0373953_0176160
392 Ga0373957_0128365
393 Ga0373955_0266781
394 Ga0373931_0085459
395 Ga0373933_0003373
396 Ga0373933_0149190
397 Ga0373947_0108070
398 Ga0373937_0000217
399 Ga0373937_0093366
400 Ga0373937_0105429
401 Ga0395905_0132951
402 Ga0395905_0154556
403 Ga0395905_0552015
404 Ga0436364_0174235
405 Ga0436364_0287761
406 Ga0436364_0801856
407 Ga0436364_1122518
408 Ga0436360_0568204
409 Ga0436361_0390978
410 Ga0436363_0319868
411 Ga0439446_0078287
412 Ga0466959_0004116
413 Ga0495592_0211495
414 Ga0495608_0002013
415 Ga0495587_0297398
416 Ga0495587_0386495
417 Ga0495645_0014053
418 Ga0495645_0061234
419 Ga0495600_0036668
420 Ga0495604_0043408
421 Ga0495604_0057198
422 Ga0495675_0169237
423 Ga0496100_0148034
424 Ga0496102_0012524
425 Ga0496102_0022028
426 Ga0496103_0007305
427 Ga0496103_0055362
428 Ga0496104_0000503
429 Ga0496104_0065018
430 Ga0496104_0081341
431 Ga0496106_0737981
432 Ga0496108_0000715
433 Ga0496110_0053064
434 Ga0496112_0179739
435 Ga0496112_0207244
436 Ga0496112_0640647
437 Ga0496113_0052341
438 Ga0496115_0067728
439 Ga0496126_0000068
440 Ga0496126_0000074
441 Ga0501036_0300671
442 Ga0501037_0440432
443 Ga0501040_0182933
444 Ga0501040_0229150
445 Ga0501041_0086184
446 Ga0501042_0103438
447 Ga0501069_0407426
448 Ga0501075_0475211
449 Ga0501077_0272835
450 Ga0501079_0381211
451 Ga0501081_0449277
452 Ga0501044_0524400
453 nmdc:mga05p37_253028_c1
454 nmdc:mga05p37_499857_c1
455 nmdc:mga05p37_824204_c1
456 nmdc:mga0qj67_121894_c1
457 nmdc:mga06r32_212688_c1
458 nmdc:mga06r32_430124_c1
459 nmdc:mga0n895_204928_c1
460 nmdc:mga0n895_22174_c1
461 nmdc:mga0n895_339312_c1
462 nmdc:mga0n895_53140_c1
463 nmdc:mga0rr50_210526_c1
464 nmdc:mga0rr50_237336_c1
465 nmdc:mga0rr50_640786_c1
466 nmdc:mga0a205_114812_c1
467 nmdc:mga0a205_59404_c1
468 Ga0495619_0285897
469 Ga0501084_0010204
470 Ga0590071_001632
471 Ga0590074_000835
472 Ga0590077_001156
473 Ga0501082_0017468
474 Ga0501082_0438657
475 Ga0530510_0334170
476 2898909280

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02492

cobW

CobW/HypB/UreG, nucleotide-binding domain

35

198

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hf9-assembly1.cif.gz_A crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form 0.9505 11 217
2wsm-assembly1.cif.gz_B crystal structure of hydrogenase maturation factor hypb from archaeoglobus fulgidus 0.9399 12 213
2hf9-assembly1.cif.gz_A crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form 0.9289 11 217
2wsm-assembly1.cif.gz_B crystal structure of hydrogenase maturation factor hypb from archaeoglobus fulgidus 0.9254 12 213
2wsm-assembly1.cif.gz_A crystal structure of hydrogenase maturation factor hypb from archaeoglobus fulgidus 0.9253 13 216
ID Description Score Start End Superfamily
af_P0AAN3_68_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9561 1 215 3.40.50.300
2wsmA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9253 13 216 3.40.50.300
af_P0AAN3_68_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9227 1 215 3.40.50.300
2wsmA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9167 13 216 3.40.50.300
4lpsB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9062 15 228 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6N9VK75-F1-model_v4 Hydrogenase nickel incorporation protein HypB 0.9829 3 218 GO:0003924
GO:0005525
GO:0008270
GO:0016151
GO:0051604
AF-A0A6B2YPV4-F1-model_v4 Hydrogenase nickel incorporation protein HypB 0.9818 6 218 GO:0003924
GO:0005525
GO:0008270
GO:0016151
GO:0051604
AF-A0A178TS71-F1-model_v4 deleted 0.9814 13 223
AF-A0A6B3HF11-F1-model_v4 Hydrogenase nickel incorporation protein HypB 0.9812 40 218 GO:0003924
GO:0005525
GO:0008270
GO:0016151
GO:0051604
AF-A0A1F3SPI5-F1-model_v4 Hydrogenase accessory protein HypB 0.9778 4 214 GO:0003924
GO:0005525
GO:0008270
GO:0016151
GO:0051604

Map