F351403

General Info

Members Datasets Scaffolds Average Seq Length
238 130 476 204

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_498133_c1|nmdc:mga09592_498133_c1_329_940
Length 189
Sequence MSNFVSRGFQRRRQTPAELADRVPPGQYVENGFPVLTAGPTPHVEAELWGFRIDGMVGAEQEWTWDEFHALPFETVPCDIHCVTKWSKLGTSFGGVSLDTLLADVDPKGAYTIAYTGGKAWVVTEHEGEPLPREHGGPARLLVPHLYFWKSAKWVAGLRVIDHDEPGFWEQNGYHIRGDPWKEERYWND

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
76 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
77 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
78 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
79 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
80 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
81 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
82 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
83 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
84 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
85 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
86 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
87 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
88 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
103 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
104 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
108 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
109 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
110 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
113 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
117 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
118 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
119 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
120 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
128 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.61
Nodule 0
Rhizoplane 1.26
Rhizosphere 82.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_498133_c1 3300050508 Bacteria 1049
2 JGI25407J50210_10020780 3300003373 Bacteria 1706
3 JGI25407J50210_10062720 3300003373 Bacteria 932
4 Ga0070683_100122089 3300005329 Bacteria 2461
5 Ga0070668_100201473 3300005347 Bacteria 1634
6 Ga0070674_100009328 3300005356 Bacteria 5874
7 Ga0070674_100156543 3300005356 Bacteria 1725
8 Ga0070659_100116859 3300005366 Bacteria 2157
9 Ga0070667_100066789 3300005367 Bacteria 3056
10 Ga0070713_100285307 3300005436 Bacteria 1516
11 Ga0070710_10337611 3300005437 Bacteria 994
12 Ga0070662_100088500 3300005457 Bacteria 2321
13 Ga0070707_100125797 3300005468 Bacteria 2491
14 Ga0070695_100124263 3300005545 Bacteria 1770
15 Ga0070696_100081216 3300005546 Bacteria 2297
16 Ga0070665_100276997 3300005548 Bacteria 1679
17 Ga0070704_101100248 3300005549 Bacteria 722
18 Ga0070664_100589811 3300005564 Bacteria 1030
19 Ga0068857_100909775 3300005577 Bacteria 844
20 Ga0070702_100173464 3300005615 Bacteria 1405
21 Ga0068852_101245758 3300005616 Bacteria 765
22 Ga0068861_100159188 3300005719 Bacteria 1861
23 Ga0068861_100161729 3300005719 Bacteria 1847
24 Ga0081455_10021210 3300005937 Bacteria 6099
25 Ga0081538_10000018 3300005981 Bacteria 143542
26 Ga0081538_10001203 3300005981 Bacteria 27156
27 Ga0081538_10002046 3300005981 Bacteria 20129
28 Ga0081538_10002253 3300005981 Bacteria 19097
29 Ga0081538_10004441 3300005981 Bacteria 12931
30 Ga0081538_10006807 3300005981 Bacteria 9976
31 Ga0081538_10011391 3300005981 Bacteria 7205
32 Ga0081538_10012606 3300005981 Bacteria 6770
33 Ga0081538_10012876 3300005981 Bacteria 6669
34 Ga0081538_10017827 3300005981 Bacteria 5366
35 Ga0081538_10118597 3300005981 Bacteria 1278
36 Ga0081538_10166366 3300005981 Bacteria 970
37 Ga0081540_1039197 3300005983 Bacteria 2486
38 Ga0070717_10129408 3300006028 Bacteria 2170
39 Ga0075365_10014056 3300006038 Bacteria 4807
40 Ga0075365_10016761 3300006038 Bacteria 4466
41 Ga0075365_10032446 3300006038 Bacteria 3357
42 Ga0075365_10038607 3300006038 Bacteria 3105
43 Ga0075368_10028745 3300006042 Bacteria 2149
44 Ga0075368_10245871 3300006042 Bacteria 764
45 Ga0075363_100046677 3300006048 Bacteria 2299
46 Ga0075363_100235700 3300006048 Bacteria 1051
47 Ga0075363_100456340 3300006048 Bacteria 755
48 Ga0075364_10025894 3300006051 Bacteria 3738
49 Ga0075364_10079857 3300006051 Bacteria 2162
50 Ga0075432_10031773 3300006058 Bacteria 1828
51 Ga0070712_100154265 3300006175 Bacteria 1767
52 Ga0075369_10333208 3300006186 Bacteria 711
53 Ga0075428_100055407 3300006844 Bacteria 4344
54 Ga0075428_100091843 3300006844 Bacteria 3310
55 Ga0075428_100251260 3300006844 Bacteria 1906
56 Ga0075428_100349579 3300006844 Bacteria 1587
57 Ga0075428_101291520 3300006844 Bacteria 768
58 Ga0075430_100008692 3300006846 Bacteria 8569
59 Ga0075430_100091983 3300006846 Bacteria 2536
60 Ga0075430_100285774 3300006846 Bacteria 1365
61 Ga0075431_100003260 3300006847 Bacteria 15714
62 Ga0075431_100004773 3300006847 Bacteria 13323
63 Ga0075431_100031831 3300006847 Bacteria 5433
64 Ga0075431_100366924 3300006847 Bacteria 1445
65 Ga0075431_100446365 3300006847 Bacteria 1290
66 Ga0075433_10294579 3300006852 Bacteria 1437
67 Ga0075429_100337400 3300006880 Bacteria 1319
68 Ga0075429_100514547 3300006880 Bacteria 1049
69 Ga0111539_10004135 3300009094 Bacteria 19042
70 Ga0111539_10841936 3300009094 Bacteria 1067
71 Ga0105245_10012744 3300009098 Bacteria 7322
72 Ga0105247_10215636 3300009101 Bacteria 1297
73 Ga0114129_10013696 3300009147 Bacteria 11556
74 Ga0114129_10108263 3300009147 Bacteria 3837
75 Ga0114129_10125752 3300009147 Bacteria 3525
76 Ga0114129_10165331 3300009147 Bacteria 3020
77 Ga0114129_10234533 3300009147 Bacteria 2470
78 Ga0114129_11143876 3300009147 Bacteria 972
79 Ga0114129_11176430 3300009147 Bacteria 956
80 Ga0114129_11264505 3300009147 Bacteria 916
81 Ga0105243_10045280 3300009148 Bacteria 3456
82 Ga0105242_10724845 3300009176 Bacteria 976
83 Ga0105249_10005418 3300009553 Bacteria 11017
84 Ga0105249_11417339 3300009553 Bacteria 767
85 Ga0105239_10189920 3300010375 Bacteria 2299
86 Ga0105239_10981344 3300010375 Bacteria 971
87 Ga0163162_10103680 3300013306 Bacteria 2939
88 Ga0163163_10320042 3300014325 Bacteria 1605
89 Ga0207693_10073898 3300025915 Bacteria 2669
90 Ga0207663_10211998 3300025916 Bacteria 1404
91 Ga0207646_10275349 3300025922 Bacteria 1521
92 Ga0207681_10276197 3300025923 Bacteria 1321
93 Ga0207687_10105496 3300025927 Bacteria 2082
94 Ga0207706_10014303 3300025933 Bacteria 7192
95 Ga0207669_10102146 3300025937 Bacteria 1898
96 Ga0207669_10924095 3300025937 Bacteria 730
97 Ga0207665_10030772 3300025939 Bacteria 3549
98 Ga0207689_10699848 3300025942 Bacteria 854
99 Ga0207661_10140232 3300025944 Bacteria 2080
100 Ga0207712_10397748 3300025961 Bacteria 1157
101 Ga0207712_10524449 3300025961 Bacteria 1016
102 Ga0207658_10023377 3300025986 Bacteria 4314
103 Ga0207675_100006164 3300026118 Bacteria 11391
104 Ga0207675_100182031 3300026118 Bacteria 2012
105 Ga0209813_10187151 3300027866 Bacteria 760
106 Ga0268266_10000614 3300028379 Bacteria 48613
107 Ga0268266_10033614 3300028379 Bacteria 4359
108 Ga0307413_10394806 3300031824 Bacteria 1082
109 Ga0307407_10320297 3300031903 Bacteria 1088
110 Ga0307409_100158519 3300031995 Bacteria 1976
111 Ga0307416_100002570 3300032002 Bacteria 10482
112 Ga0307416_100828412 3300032002 Bacteria 1022
113 Ga0307415_100054476 3300032126 Bacteria 2731
114 Ga0373933_0552545 3300035724 Bacteria 755
115 Ga0373937_1117203 3300036401 Bacteria 737
116 Ga0395899_0020657 3300037312 Bacteria 4992
117 Ga0395900_0002485 3300037418 Bacteria 20252
118 Ga0395900_0009229 3300037418 Bacteria 10114
119 Ga0395900_0324618 3300037418 Bacteria 1519
120 Ga0395900_0541551 3300037418 Bacteria 1110
121 Ga0395900_0784153 3300037418 Bacteria 882
122 Ga0395898_0016919 3300037466 Bacteria 7444
123 Ga0395898_0068187 3300037466 Bacteria 3442
124 Ga0395905_0010860 3300037471 Bacteria 8822
125 Ga0395905_0319164 3300037471 Bacteria 1443
126 Ga0436364_0927039 3300037853 Bacteria 972
127 Ga0395901_0010169 3300038443 Bacteria 9532
128 Ga0395901_0019171 3300038443 Bacteria 6994
129 Ga0395901_0021273 3300038443 Bacteria 6644
130 Ga0395901_0032741 3300038443 Bacteria 5362
131 Ga0451853_0057597 3300041512 Bacteria 5740
132 Ga0439440_0005824 3300042993 Bacteria 2458
133 Ga0495584_0322867 3300046491 Bacteria 784
134 Ga0495616_0270117 3300046513 Bacteria 725
135 Ga0495589_0079130 3300046794 Bacteria 1600
136 Ga0495672_0072746 3300047320 Bacteria 1941
137 Ga0496104_0223655 3300048907 Bacteria 1794
138 Ga0496105_0203812 3300048908 Bacteria 1614
139 Ga0496107_0177146 3300048910 Bacteria 1583
140 Ga0496119_0001739 3300048922 Bacteria 25383
141 Ga0496120_0010384 3300048923 Bacteria 6500
142 Ga0496121_0176308 3300048924 Bacteria 1547
143 Ga0496121_0502759 3300048924 Bacteria 769
144 Ga0496124_0064879 3300048927 Bacteria 3047
145 Ga0496126_0086843 3300048929 Bacteria 2757
146 Ga0501032_0001005 3300049569 Bacteria 22740
147 Ga0501033_0000159 3300049570 Bacteria 64757
148 Ga0501034_0010328 3300049571 Bacteria 9731
149 Ga0501034_0101360 3300049571 Bacteria 2873
150 Ga0501036_0000279 3300049572 Bacteria 35206
151 Ga0501037_0000327 3300049573 Bacteria 40321
152 Ga0501038_0000166 3300049574 Bacteria 55718
153 Ga0501039_0008737 3300049575 Bacteria 7716
154 Ga0501040_0035596 3300049576 Bacteria 3377
155 Ga0501040_0269710 3300049576 Bacteria 1215
156 Ga0501041_0022365 3300049577 Bacteria 3785
157 Ga0501043_0000376 3300049579 Bacteria 40497
158 Ga0501046_0000469 3300049580 Bacteria 40385
159 Ga0501047_0000716 3300049581 Bacteria 34570
160 Ga0501047_0088872 3300049581 Bacteria 2967
161 Ga0501047_0178861 3300049581 Bacteria 1988
162 Ga0501048_0000174 3300049582 Bacteria 40380
163 Ga0501048_0035914 3300049582 Bacteria 3565
164 Ga0501067_0119396 3300049583 Bacteria 1466
165 Ga0501068_0008452 3300049584 Bacteria 5728
166 Ga0501068_0154124 3300049584 Bacteria 1445
167 Ga0501069_0043200 3300049585 Bacteria 2494
168 Ga0501070_0000131 3300049586 Bacteria 67175
169 Ga0501070_0008214 3300049586 Bacteria 8828
170 Ga0501070_0029851 3300049586 Bacteria 4568
171 Ga0501070_0054550 3300049586 Bacteria 3314
172 Ga0501070_0231891 3300049586 Bacteria 1512
173 Ga0501072_0121721 3300049588 Bacteria 2079
174 Ga0501072_0140364 3300049588 Bacteria 1926
175 Ga0501073_0001466 3300049589 Bacteria 17473
176 Ga0501073_0017509 3300049589 Bacteria 5190
177 Ga0501074_0016031 3300049590 Bacteria 5446
178 Ga0501074_0028776 3300049590 Bacteria 4025
179 Ga0501074_0237728 3300049590 Bacteria 1296
180 Ga0501076_0562700 3300049592 Bacteria 940
181 Ga0501079_0003381 3300049741 Bacteria 11707
182 Ga0501079_0406664 3300049741 Bacteria 1068
183 Ga0501079_0423568 3300049741 Bacteria 1045
184 Ga0501080_0008127 3300049742 Bacteria 9506
185 Ga0501080_0029358 3300049742 Bacteria 5119
186 Ga0501081_0213276 3300049743 Bacteria 1403
187 Ga0501083_0000435 3300049744 Bacteria 26857
188 Ga0501083_0088697 3300049744 Bacteria 2045
189 Ga0501035_0008091 3300049822 Bacteria 9798
190 Ga0501044_0004146 3300049823 Bacteria 16279
191 Ga0501044_0072325 3300049823 Bacteria 3506
192 Ga0501045_0051080 3300049824 Bacteria 3017
193 Ga0501045_0193805 3300049824 Bacteria 1514
194 Ga0501045_0312002 3300049824 Bacteria 1170
195 nmdc:mga03n38_115066_c1 3300050490 Bacteria 1315
196 nmdc:mga03n38_21271_c1 3300050490 Bacteria 2608
197 nmdc:mga03n38_31423_c1 3300050490 Bacteria 2241
198 nmdc:mga03n38_60473_c1 3300050490 Bacteria 1722
199 nmdc:mga00v17_134224_c1 3300050491 Bacteria 1584
200 nmdc:mga00v17_137739_c1 3300050491 Bacteria 1563
201 nmdc:mga00v17_21454_c1 3300050491 Bacteria 3713
202 nmdc:mga00v17_474801_c1 3300050491 Bacteria 811
203 nmdc:mga00v17_66570_c1 3300050491 Bacteria 2224
204 nmdc:mga00v17_87465_c1 3300050491 Bacteria 1953
205 nmdc:mga0yw44_120567_c1 3300050492 Bacteria 1689
206 nmdc:mga0yw44_3167_c1 3300050492 Bacteria 7226
207 nmdc:mga0yw44_34164_c1 3300050492 Bacteria 2978
208 nmdc:mga0yw44_629238_c1 3300050492 Bacteria 729
209 nmdc:mga0yw44_98759_c1 3300050492 Bacteria 1857
210 nmdc:mga04h51_133713_c1 3300050495 Bacteria 935
211 nmdc:mga05p37_1697700_c1 3300050507 Bacteria 616
212 nmdc:mga05p37_18117_c1 3300050507 Bacteria 7292
213 nmdc:mga05p37_181723_c1 3300050507 Bacteria 2558
214 nmdc:mga05p37_193169_c1 3300050507 Bacteria 2470
215 nmdc:mga05p37_282619_c1 3300050507 Bacteria 1978
216 nmdc:mga05p37_2914_c1 3300050507 Bacteria 19858
217 nmdc:mga05p37_85956_c1 3300050507 Bacteria 3876
218 nmdc:mga09592_181115_c1 3300050508 Bacteria 1823
219 nmdc:mga09592_544161_c1 3300050508 Bacteria 997
220 nmdc:mga0qj67_18721_c1 3300050509 Bacteria 5280
221 nmdc:mga0qj67_315941_c1 3300050509 Bacteria 1265
222 nmdc:mga0qj67_64111_c1 3300050509 Bacteria 2922
223 nmdc:mga0qj67_641585_c1 3300050509 Bacteria 848
224 nmdc:mga06r32_162846_c1 3300050510 Bacteria 2213
225 nmdc:mga06r32_163442_c1 3300050510 Bacteria 2209
226 nmdc:mga06r32_20287_c1 3300050510 Bacteria 6116
227 nmdc:mga06r32_40940_c1 3300050510 Bacteria 4401
228 nmdc:mga08y16_121553_c1 3300050511 Bacteria 2717
229 nmdc:mga08y16_502680_c1 3300050511 Bacteria 1231
230 nmdc:mga08y16_7104_c1 3300050511 Bacteria 11755
231 nmdc:mga0n895_110737_c1 3300050512 Bacteria 2762
232 nmdc:mga0a205_152696_c1 3300050515 Bacteria 2208
233 nmdc:mga0sz30_63105_c1 3300050516 Bacteria 1585
234 Ga0495655_0037596 3300053083 Bacteria 1217
235 Ga0495655_0083559 3300053083 Bacteria 917
236 Ga0501084_0046338 3300054114 Bacteria 3642
237 Ga0501082_0003963 3300060353 Bacteria 12925
238 Ga0501082_0124337 3300060353 Bacteria 2237
239 nmdc:mga09592_498133_c1
240 JGI25407J50210_10020780
241 JGI25407J50210_10062720
242 Ga0070683_100122089
243 Ga0070668_100201473
244 Ga0070674_100009328
245 Ga0070674_100156543
246 Ga0070659_100116859
247 Ga0070667_100066789
248 Ga0070713_100285307
249 Ga0070710_10337611
250 Ga0070662_100088500
251 Ga0070707_100125797
252 Ga0070695_100124263
253 Ga0070696_100081216
254 Ga0070665_100276997
255 Ga0070704_101100248
256 Ga0070664_100589811
257 Ga0068857_100909775
258 Ga0070702_100173464
259 Ga0068852_101245758
260 Ga0068861_100159188
261 Ga0068861_100161729
262 Ga0081455_10021210
263 Ga0081538_10000018
264 Ga0081538_10001203
265 Ga0081538_10002046
266 Ga0081538_10002253
267 Ga0081538_10004441
268 Ga0081538_10006807
269 Ga0081538_10011391
270 Ga0081538_10012606
271 Ga0081538_10012876
272 Ga0081538_10017827
273 Ga0081538_10118597
274 Ga0081538_10166366
275 Ga0081540_1039197
276 Ga0070717_10129408
277 Ga0075365_10014056
278 Ga0075365_10016761
279 Ga0075365_10032446
280 Ga0075365_10038607
281 Ga0075368_10028745
282 Ga0075368_10245871
283 Ga0075363_100046677
284 Ga0075363_100235700
285 Ga0075363_100456340
286 Ga0075364_10025894
287 Ga0075364_10079857
288 Ga0075432_10031773
289 Ga0070712_100154265
290 Ga0075369_10333208
291 Ga0075428_100055407
292 Ga0075428_100091843
293 Ga0075428_100251260
294 Ga0075428_100349579
295 Ga0075428_101291520
296 Ga0075430_100008692
297 Ga0075430_100091983
298 Ga0075430_100285774
299 Ga0075431_100003260
300 Ga0075431_100004773
301 Ga0075431_100031831
302 Ga0075431_100366924
303 Ga0075431_100446365
304 Ga0075433_10294579
305 Ga0075429_100337400
306 Ga0075429_100514547
307 Ga0111539_10004135
308 Ga0111539_10841936
309 Ga0105245_10012744
310 Ga0105247_10215636
311 Ga0114129_10013696
312 Ga0114129_10108263
313 Ga0114129_10125752
314 Ga0114129_10165331
315 Ga0114129_10234533
316 Ga0114129_11143876
317 Ga0114129_11176430
318 Ga0114129_11264505
319 Ga0105243_10045280
320 Ga0105242_10724845
321 Ga0105249_10005418
322 Ga0105249_11417339
323 Ga0105239_10189920
324 Ga0105239_10981344
325 Ga0163162_10103680
326 Ga0163163_10320042
327 Ga0207693_10073898
328 Ga0207663_10211998
329 Ga0207646_10275349
330 Ga0207681_10276197
331 Ga0207687_10105496
332 Ga0207706_10014303
333 Ga0207669_10102146
334 Ga0207669_10924095
335 Ga0207665_10030772
336 Ga0207689_10699848
337 Ga0207661_10140232
338 Ga0207712_10397748
339 Ga0207712_10524449
340 Ga0207658_10023377
341 Ga0207675_100006164
342 Ga0207675_100182031
343 Ga0209813_10187151
344 Ga0268266_10000614
345 Ga0268266_10033614
346 Ga0307413_10394806
347 Ga0307407_10320297
348 Ga0307409_100158519
349 Ga0307416_100002570
350 Ga0307416_100828412
351 Ga0307415_100054476
352 Ga0373933_0552545
353 Ga0373937_1117203
354 Ga0395899_0020657
355 Ga0395900_0002485
356 Ga0395900_0009229
357 Ga0395900_0324618
358 Ga0395900_0541551
359 Ga0395900_0784153
360 Ga0395898_0016919
361 Ga0395898_0068187
362 Ga0395905_0010860
363 Ga0395905_0319164
364 Ga0436364_0927039
365 Ga0395901_0010169
366 Ga0395901_0019171
367 Ga0395901_0021273
368 Ga0395901_0032741
369 Ga0451853_0057597
370 Ga0439440_0005824
371 Ga0495584_0322867
372 Ga0495616_0270117
373 Ga0495589_0079130
374 Ga0495672_0072746
375 Ga0496104_0223655
376 Ga0496105_0203812
377 Ga0496107_0177146
378 Ga0496119_0001739
379 Ga0496120_0010384
380 Ga0496121_0176308
381 Ga0496121_0502759
382 Ga0496124_0064879
383 Ga0496126_0086843
384 Ga0501032_0001005
385 Ga0501033_0000159
386 Ga0501034_0010328
387 Ga0501034_0101360
388 Ga0501036_0000279
389 Ga0501037_0000327
390 Ga0501038_0000166
391 Ga0501039_0008737
392 Ga0501040_0035596
393 Ga0501040_0269710
394 Ga0501041_0022365
395 Ga0501043_0000376
396 Ga0501046_0000469
397 Ga0501047_0000716
398 Ga0501047_0088872
399 Ga0501047_0178861
400 Ga0501048_0000174
401 Ga0501048_0035914
402 Ga0501067_0119396
403 Ga0501068_0008452
404 Ga0501068_0154124
405 Ga0501069_0043200
406 Ga0501070_0000131
407 Ga0501070_0008214
408 Ga0501070_0029851
409 Ga0501070_0054550
410 Ga0501070_0231891
411 Ga0501072_0121721
412 Ga0501072_0140364
413 Ga0501073_0001466
414 Ga0501073_0017509
415 Ga0501074_0016031
416 Ga0501074_0028776
417 Ga0501074_0237728
418 Ga0501076_0562700
419 Ga0501079_0003381
420 Ga0501079_0406664
421 Ga0501079_0423568
422 Ga0501080_0008127
423 Ga0501080_0029358
424 Ga0501081_0213276
425 Ga0501083_0000435
426 Ga0501083_0088697
427 Ga0501035_0008091
428 Ga0501044_0004146
429 Ga0501044_0072325
430 Ga0501045_0051080
431 Ga0501045_0193805
432 Ga0501045_0312002
433 nmdc:mga03n38_115066_c1
434 nmdc:mga03n38_21271_c1
435 nmdc:mga03n38_31423_c1
436 nmdc:mga03n38_60473_c1
437 nmdc:mga00v17_134224_c1
438 nmdc:mga00v17_137739_c1
439 nmdc:mga00v17_21454_c1
440 nmdc:mga00v17_474801_c1
441 nmdc:mga00v17_66570_c1
442 nmdc:mga00v17_87465_c1
443 nmdc:mga0yw44_120567_c1
444 nmdc:mga0yw44_3167_c1
445 nmdc:mga0yw44_34164_c1
446 nmdc:mga0yw44_629238_c1
447 nmdc:mga0yw44_98759_c1
448 nmdc:mga04h51_133713_c1
449 nmdc:mga05p37_1697700_c1
450 nmdc:mga05p37_18117_c1
451 nmdc:mga05p37_181723_c1
452 nmdc:mga05p37_193169_c1
453 nmdc:mga05p37_282619_c1
454 nmdc:mga05p37_2914_c1
455 nmdc:mga05p37_85956_c1
456 nmdc:mga09592_181115_c1
457 nmdc:mga09592_544161_c1
458 nmdc:mga0qj67_18721_c1
459 nmdc:mga0qj67_315941_c1
460 nmdc:mga0qj67_64111_c1
461 nmdc:mga0qj67_641585_c1
462 nmdc:mga06r32_162846_c1
463 nmdc:mga06r32_163442_c1
464 nmdc:mga06r32_20287_c1
465 nmdc:mga06r32_40940_c1
466 nmdc:mga08y16_121553_c1
467 nmdc:mga08y16_502680_c1
468 nmdc:mga08y16_7104_c1
469 nmdc:mga0n895_110737_c1
470 nmdc:mga0a205_152696_c1
471 nmdc:mga0sz30_63105_c1
472 Ga0495655_0037596
473 Ga0495655_0083559
474 Ga0501084_0046338
475 Ga0501082_0003963
476 Ga0501082_0124337

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

114

169

0.95

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

38

121

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.9166 51 192
2ca4-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella mutant 0.9154 35 185
2c9x-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella y236f mutant 0.9146 35 185
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.9145 46 192
2bpb-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella 0.8992 35 185
ID Description Score Start End Superfamily
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9131 46 193 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8577 49 179 3.90.420.10
4pw9A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8524 48 179 3.90.420.10
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8343 35 204 3.90.420.10
2xtsA01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8231 43 197 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A7Y6A7Q0-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9739 25 194
AF-A0A0B0SBN4-F1-model_v4 Molybdopterin-binding protein 0.9726 24 152
AF-A0A259N8T7-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.966 24 168
AF-A0A1G1F991-F1-model_v4 Oxidoreductase 0.9647 26 160
AF-A0A1V4EXX7-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9625 44 191 GO:0016020
GO:0022904

Map