F351353

General Info

Members Datasets Scaffolds Average Seq Length
238 170 477 244

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0037543|Ga0501033_0037543_1475_2332
Length 285
Sequence MRAPGPGAAGAPPPRPDRRGMRPQPLRGGRPGGTVGVMTIRAVLWDVDDTLFDYTTADRTGMRAHLLAERLLDRYGSVEEALAQWRRITDEQWARFSAGEVSFDEQRRERVRAFLGRPELTDAEAEDWFARYLRHYESAWAVFPDVLPALDRLAVGYRHAVLSNSGLHVQEHKLRVLGLRDRFEAVLCAAELGVSKPRARAFHAACEALGLPPHQVAYVGDHPEIDARGAAAAGLLPVWIDRTDMSPDGAAGGPPGPGVHRISSLAELPALLGADTRFGARSTFR

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
9 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
10 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
11 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
12 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
13 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
14 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
15 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
16 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
20 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
21 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
22 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
23 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
24 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
25 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
26 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
27 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
28 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
29 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
30 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
31 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
32 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
33 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
34 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
35 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
36 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
37 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
38 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
39 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
40 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
41 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
42 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
43 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
44 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
45 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
46 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
47 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
48 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
49 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
50 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
51 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
52 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
53 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
54 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
55 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
56 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
57 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
58 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
59 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
60 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
63 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
64 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
65 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
66 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
67 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
68 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
69 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
70 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
71 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
72 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
73 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
74 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
75 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
76 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
77 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
78 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
79 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
80 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
81 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
82 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
83 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
84 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
85 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
89 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
90 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
91 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
92 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
93 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
94 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
95 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
96 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
97 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
98 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
99 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
107 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
108 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
111 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
112 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
130 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
131 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
132 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
133 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
134 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
135 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
136 2643221647 Streptomyces sp. Root369 Isolate Unclassified
137 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
138 2643221714 Streptomyces sp. Root264 Isolate Unclassified
139 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
140 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
141 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
142 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
143 2808606448 Streptomyces sp. 193411 Isolate Unclassified
144 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
145 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
146 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
147 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
148 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
149 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
150 2867428634 Streptomyces sp. RP5T Isolate Unclassified
151 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
152 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
153 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
154 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
155 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
156 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
157 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
158 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
159 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
160 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
161 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
162 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
163 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
164 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
165 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
166 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
167 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
168 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
169 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
170 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 83.61
Metatranscriptomes 0.42
Isolates 15.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0
Rhizoplane 0
Rhizosphere 83.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0037543 3300049570 Bacteria 3625
2 JGI24739J22299_10050029 3300001989 Bacteria 1353
3 JGI24735J21928_10022941 3300002067 Bacteria 1895
4 rootH1_10011552 3300003316 Bacteria 2595
5 rootH1_10011552 3300003323 Bacteria 4539
6 rootH1_10038917 3300003323 Bacteria 2763
7 rootH1_10056597 3300003323 Bacteria 2225
8 rootH1_10147009 3300003323 Bacteria 1335
9 Ga0006562J51391_1194610 3300003578 Bacteria 1468
10 Ga0068853_100064542 3300005539 Bacteria 3176
11 Ga0075363_100007608 3300006048 Bacteria 4991
12 Ga0075370_10194932 3300006353 Bacteria 1194
13 Ga0105243_10205157 3300009148 Bacteria 1732
14 Ga0105238_10482046 3300009551 Bacteria 1240
15 Ga0105239_10292950 3300010375 Bacteria 1833
16 Ga0105246_10042956 3300011119 Bacteria 3064
17 Ga0183367_1013 3300015688 Bacteria 334176
18 Ga0209758_1006247 3300025297 Bacteria 8675
19 Ga0207647_10010580 3300025904 Bacteria 6507
20 Ga0207639_10046195 3300026041 Bacteria 3285
21 Ga0207702_10306408 3300026078 Bacteria 1509
22 Ga0209371_1029248 3300027312 Bacteria 1219
23 Ga0307512_10037608 3300030522 Bacteria 4084
24 Ga0307513_10471173 3300031456 Bacteria 977
25 Ga0307508_10020801 3300031616 Bacteria 5961
26 Ga0307508_10027741 3300031616 Bacteria 5125
27 Ga0307514_10002072 3300031649 Bacteria 21644
28 Ga0307514_10098574 3300031649 Bacteria 2105
29 Ga0307516_10334005 3300031730 Bacteria 1184
30 Ga0307518_10135929 3300031838 Bacteria 1721
31 Ga0307507_10112846 3300033179 Bacteria 2212
32 Ga0307510_10094828 3300033180 Bacteria 2807
33 Ga0395898_0004957 3300037466 Bacteria 14451
34 Ga0395898_0470994 3300037466 Bacteria 1195
35 Ga0395905_0901619 3300037471 Bacteria 787
36 Ga0395901_0743239 3300038443 Bacteria 975
37 Ga0439436_0017154 3300041404 Bacteria 2167
38 Ga0439436_0031871 3300041404 Bacteria 1529
39 Ga0439439_0010883 3300041406 Bacteria 2181
40 Ga0451837_1590385 3300041494 Bacteria 2900
41 Ga0451853_1784956 3300041512 Bacteria 1957
42 Ga0451853_1797326 3300041512 Bacteria 1161
43 Ga0439433_0010092 3300041999 Bacteria 2061
44 Ga0439449_0077629 3300042007 Bacteria 1224
45 Ga0439449_0086403 3300042007 Bacteria 1157
46 Ga0439455_0032958 3300042012 Bacteria 1297
47 Ga0439457_007138 3300042014 Bacteria 2694
48 Ga0439462_0030372 3300042015 Bacteria 1429
49 Ga0450894_001262 3300042131 Bacteria 3713
50 Ga0450895_000890 3300042132 Bacteria 1920
51 Ga0450896_014642 3300042133 Bacteria 1120
52 Ga0450898_000400 3300042134 Bacteria 5029
53 Ga0450900_014203 3300042136 Bacteria 1060
54 Ga0450903_000939 3300042138 Bacteria 5582
55 Ga0450906_002745 3300042145 Bacteria 3829
56 Ga0439458_0001393 3300042157 Bacteria 6108
57 Ga0466969_0117301 3300044656 Bacteria 1241
58 Ga0466972_0012772 3300044658 Bacteria 4217
59 Ga0466972_0090054 3300044658 Bacteria 1455
60 Ga0466972_0139629 3300044658 Bacteria 1140
61 Ga0466965_0017638 3300044683 Bacteria 3415
62 Ga0466965_0075298 3300044683 Bacteria 1702
63 Ga0466965_0136112 3300044683 Bacteria 1276
64 Ga0466966_0092996 3300044684 Bacteria 1870
65 Ga0466966_0166290 3300044684 Bacteria 1341
66 Ga0466961_0001921 3300044693 Bacteria 12946
67 Ga0466961_0011705 3300044693 Bacteria 5608
68 Ga0466963_0003732 3300044694 Bacteria 8765
69 Ga0466963_0175966 3300044694 Bacteria 1493
70 Ga0466964_0011571 3300044706 Bacteria 3335
71 Ga0466971_0072786 3300044719 Bacteria 1561
72 Ga0466971_0076282 3300044719 Bacteria 1525
73 Ga0466971_0221495 3300044719 Bacteria 897
74 Ga0466968_0040386 3300044735 Bacteria 1967
75 Ga0466970_0001824 3300044765 Bacteria 10278
76 Ga0466970_0015706 3300044765 Bacteria 3897
77 Ga0466957_0001080 3300044842 Bacteria 14067
78 Ga0466959_0047655 3300045049 Bacteria 3151
79 Ga0466959_0203374 3300045049 Bacteria 1378
80 Ga0466958_0002568 3300045836 Bacteria 9162
81 Ga0466967_0055808 3300045976 Bacteria 3480
82 Ga0466967_0303515 3300045976 Bacteria 1536
83 Ga0466967_0327054 3300045976 Bacteria 1480
84 Ga0495627_046152 3300046453 Bacteria 1325
85 Ga0495603_0018922 3300046455 Bacteria 4168
86 Ga0495629_0104314 3300046459 Bacteria 1977
87 Ga0495629_0168932 3300046459 Bacteria 1518
88 Ga0495629_0169759 3300046459 Bacteria 1514
89 Ga0495580_0356398 3300046472 Bacteria 990
90 Ga0495605_0004410 3300046474 Bacteria 8282
91 Ga0495605_0031618 3300046474 Bacteria 2702
92 Ga0495662_0066966 3300046476 Bacteria 1737
93 Ga0495664_0030402 3300046477 Bacteria 3163
94 Ga0495664_0134626 3300046477 Bacteria 1497
95 Ga0495594_0036461 3300046499 Bacteria 2681
96 Ga0495583_0010462 3300046506 Bacteria 5407
97 Ga0495583_0182528 3300046506 Bacteria 858
98 Ga0495606_0007436 3300046507 Bacteria 9800
99 Ga0495608_0028234 3300046511 Bacteria 3814
100 Ga0495616_0003547 3300046513 Bacteria 9969
101 Ga0495618_0183712 3300046514 Bacteria 1328
102 Ga0495620_0007165 3300046515 Bacteria 6078
103 Ga0495620_0007748 3300046515 Bacteria 5801
104 Ga0495628_0196568 3300046516 Bacteria 1521
105 Ga0495628_0257036 3300046516 Bacteria 1302
106 Ga0495631_0002870 3300046518 Bacteria 9567
107 Ga0495632_0087310 3300046519 Bacteria 1483
108 Ga0495643_0004046 3300046522 Bacteria 10453
109 Ga0495648_0028104 3300046524 Bacteria 3750
110 Ga0495648_0054886 3300046524 Bacteria 2404
111 Ga0495666_0023651 3300046526 Bacteria 3038
112 Ga0495652_0060856 3300046529 Bacteria 3189
113 Ga0495640_0012622 3300046533 Bacteria 6448
114 Ga0495640_0319211 3300046533 Bacteria 962
115 Ga0495609_0016901 3300046538 Bacteria 3395
116 Ga0495597_0013667 3300046542 Bacteria 3883
117 Ga0495597_0020913 3300046542 Bacteria 3043
118 Ga0495667_0197536 3300046559 Bacteria 1288
119 Ga0495634_0196890 3300046642 Bacteria 1253
120 Ga0495634_0236382 3300046642 Bacteria 1122
121 Ga0495611_0007348 3300046648 Bacteria 4678
122 Ga0495611_0049385 3300046648 Bacteria 1893
123 Ga0495611_0099303 3300046648 Bacteria 1351
124 Ga0495625_0079582 3300046660 Bacteria 2284
125 Ga0495625_0171741 3300046660 Bacteria 1447
126 Ga0495635_0136389 3300046663 Bacteria 1672
127 Ga0495635_0268599 3300046663 Bacteria 1147
128 Ga0495661_0095724 3300046665 Bacteria 1680
129 Ga0495588_0048653 3300046674 Bacteria 2178
130 Ga0495657_0016849 3300046675 Bacteria 5314
131 Ga0495657_0049839 3300046675 Bacteria 2818
132 Ga0495657_0152956 3300046675 Bacteria 1431
133 Ga0495613_0039615 3300046689 Bacteria 3493
134 Ga0495613_0081629 3300046689 Bacteria 2348
135 Ga0495613_0107201 3300046689 Bacteria 2015
136 Ga0495624_0023862 3300046690 Bacteria 4029
137 Ga0495624_0025477 3300046690 Bacteria 3882
138 Ga0495649_0012867 3300046694 Bacteria 4849
139 Ga0495649_0061100 3300046694 Bacteria 2026
140 Ga0495649_0087882 3300046694 Bacteria 1658
141 Ga0495589_0006771 3300046794 Bacteria 6035
142 Ga0495589_0099428 3300046794 Bacteria 1408
143 Ga0495600_0113492 3300046809 Bacteria 1764
144 Ga0495660_0015464 3300046810 Bacteria 4407
145 Ga0495604_0065052 3300047317 Bacteria 2777
146 Ga0495604_0081268 3300047317 Bacteria 2426
147 Ga0495636_0022341 3300047318 Bacteria 2556
148 Ga0495636_0030695 3300047318 Bacteria 2199
149 Ga0495636_0087548 3300047318 Bacteria 1348
150 Ga0495636_0157352 3300047318 Bacteria 1022
151 Ga0495674_0136485 3300047319 Bacteria 2063
152 Ga0495672_0018172 3300047320 Bacteria 4679
153 Ga0495676_0076295 3300047321 Bacteria 2559
154 Ga0495676_0257058 3300047321 Bacteria 1189
155 Ga0495680_0012540 3300047322 Bacteria 7453
156 Ga0495683_0056289 3300047323 Bacteria 1956
157 Ga0495683_0091714 3300047323 Bacteria 1471
158 Ga0495687_015657 3300047443 Bacteria 3848
159 Ga0495687_047913 3300047443 Bacteria 1836
160 Ga0495685_030122 3300047447 Bacteria 1866
161 Ga0495685_033594 3300047447 Bacteria 1762
162 Ga0495686_0143518 3300047472 Bacteria 1407
163 Ga0495593_0088270 3300047673 Bacteria 1598
164 Ga0495614_0083318 3300048089 Bacteria 1387
165 Ga0495626_0005954 3300048091 Bacteria 7013
166 Ga0495626_0050238 3300048091 Bacteria 1927
167 Ga0501032_0105071 3300049569 Bacteria 1871
168 Ga0501034_0010749 3300049571 Bacteria 9506
169 Ga0501034_0016268 3300049571 Bacteria 7635
170 Ga0501034_0144672 3300049571 Bacteria 2355
171 Ga0501036_0076385 3300049572 Bacteria 2833
172 Ga0501036_0107514 3300049572 Bacteria 2358
173 Ga0501037_0179597 3300049573 Bacteria 1502
174 Ga0501038_0001438 3300049574 Bacteria 21853
175 Ga0501038_0220224 3300049574 Bacteria 1514
176 Ga0501039_0005758 3300049575 Bacteria 9381
177 Ga0501043_0081823 3300049579 Bacteria 2537
178 Ga0501043_0356580 3300049579 Bacteria 1110
179 Ga0501046_0130817 3300049580 Bacteria 1904
180 Ga0501047_0124328 3300049581 Bacteria 2460
181 Ga0501047_0303183 3300049581 Bacteria 1439
182 Ga0501047_0385625 3300049581 Bacteria 1235
183 Ga0501069_0319324 3300049585 Bacteria 912
184 Ga0501070_0006871 3300049586 Bacteria 9679
185 Ga0501073_0252474 3300049589 Bacteria 1217
186 Ga0501074_0143520 3300049590 Bacteria 1707
187 Ga0501035_0019535 3300049822 Bacteria 6228
188 Ga0501035_0045687 3300049822 Bacteria 3939
189 Ga0501035_0053783 3300049822 Bacteria 3599
190 Ga0501035_0175036 3300049822 Bacteria 1852
191 Ga0501044_0017651 3300049823 Bacteria 7654
192 Ga0501044_0092872 3300049823 Bacteria 3043
193 Ga0501044_0322963 3300049823 Bacteria 1467
194 Ga0501044_0602597 3300049823 Bacteria 991
195 Ga0501045_0177960 3300049824 Bacteria 1585
196 nmdc:mga03n38_99953_c1 3300050490 Bacteria 1397
197 nmdc:mga07m45_91901_c1 3300050496 Bacteria 1739
198 Ga0500600_0104404 3300053149 Bacteria 1489
199 Ga0500600_0167990 3300053149 Bacteria 1070
200 Ga0466962_0000188 3300061719 Bacteria 25723
201 Ga0466962_0106018 3300061719 Bacteria 1351
202 2547410408 2547132111 Bacteria 8013147
203 2585311345 2582581313 Bacteria 10042643
204 2616699946 2616644814 Bacteria 11555299
205 2644269517 2643221647 Bacteria 10741251
206 2644437839 2643221678 Bacteria 9540101
207 2644629775 2643221714 Bacteria 9015452
208 2676475570 2675903058 Bacteria 6822861
209 2784590571 2784132148 Bacteria 8627943
210 2786672846 2786546132 Bacteria 10419719
211 2808844194 2808606359 Bacteria 9866990
212 2809234264 2808606448 Bacteria 8656184
213 2812355768 2811994879 Bacteria 9313447
214 2812478583 2811994917 Bacteria 7761064
215 2827634564 2827628540 Bacteria 6858585
216 2852639654 2852635781 Bacteria 8251373
217 2862284412 2862281513 Bacteria 9621493
218 2862511267 2862507626 Bacteria 9425308
219 2867430370 2867428634 Bacteria 9590268
220 2877678855 2877676314 Bacteria 9512378
221 2912762972 2912757875 Bacteria 7940295
222 2919472423 2919468124 Bacteria 9133025
223 2946070024 2946064051 Bacteria 8957905
224 2946077913 2946072368 Bacteria 8999607
225 2947226751 2947224130 Bacteria 9938529
226 2954383819 2954380949 Bacteria 10050426
227 2954679150 2954673503 Bacteria 9685905
228 2954685002 2954682443 Bacteria 9862841
229 2954694617 2954691527 Bacteria 10720516
230 2954709821 2954701450 Bacteria 10834262
231 2954714118 2954711539 Bacteria 10867210
232 2954724071 2954721474 Bacteria 10456478
233 2954737768 2954731030 Bacteria 10243860
234 2954742969 2954740390 Bacteria 10229294
235 2954756604 2954749733 Bacteria 10366972
236 2954761927 2954759201 Bacteria 9358192
237 8008576976 8008574985 Bacteria 7815457
238 8023624782 8023623736 Bacteria 8593882
239 8025532598 8025530807 Bacteria 8495698
240 Ga0501033_0037543
241 JGI24739J22299_10050029
242 JGI24735J21928_10022941
243 rootH1_10011552
244 rootH1_10038917
245 rootH1_10056597
246 rootH1_10147009
247 Ga0006562J51391_1194610
248 Ga0068853_100064542
249 Ga0075363_100007608
250 Ga0075370_10194932
251 Ga0105243_10205157
252 Ga0105238_10482046
253 Ga0105239_10292950
254 Ga0105246_10042956
255 Ga0183367_1013
256 Ga0209758_1006247
257 Ga0207647_10010580
258 Ga0207639_10046195
259 Ga0207702_10306408
260 Ga0209371_1029248
261 Ga0307512_10037608
262 Ga0307513_10471173
263 Ga0307508_10020801
264 Ga0307508_10027741
265 Ga0307514_10002072
266 Ga0307514_10098574
267 Ga0307516_10334005
268 Ga0307518_10135929
269 Ga0307507_10112846
270 Ga0307510_10094828
271 Ga0395898_0004957
272 Ga0395898_0470994
273 Ga0395905_0901619
274 Ga0395901_0743239
275 Ga0439436_0017154
276 Ga0439436_0031871
277 Ga0439439_0010883
278 Ga0451837_1590385
279 Ga0451853_1784956
280 Ga0451853_1797326
281 Ga0439433_0010092
282 Ga0439449_0077629
283 Ga0439449_0086403
284 Ga0439455_0032958
285 Ga0439457_007138
286 Ga0439462_0030372
287 Ga0450894_001262
288 Ga0450895_000890
289 Ga0450896_014642
290 Ga0450898_000400
291 Ga0450900_014203
292 Ga0450903_000939
293 Ga0450906_002745
294 Ga0439458_0001393
295 Ga0466969_0117301
296 Ga0466972_0012772
297 Ga0466972_0090054
298 Ga0466972_0139629
299 Ga0466965_0017638
300 Ga0466965_0075298
301 Ga0466965_0136112
302 Ga0466966_0092996
303 Ga0466966_0166290
304 Ga0466961_0001921
305 Ga0466961_0011705
306 Ga0466963_0003732
307 Ga0466963_0175966
308 Ga0466964_0011571
309 Ga0466971_0072786
310 Ga0466971_0076282
311 Ga0466971_0221495
312 Ga0466968_0040386
313 Ga0466970_0001824
314 Ga0466970_0015706
315 Ga0466957_0001080
316 Ga0466959_0047655
317 Ga0466959_0203374
318 Ga0466958_0002568
319 Ga0466967_0055808
320 Ga0466967_0303515
321 Ga0466967_0327054
322 Ga0495627_046152
323 Ga0495603_0018922
324 Ga0495629_0104314
325 Ga0495629_0168932
326 Ga0495629_0169759
327 Ga0495580_0356398
328 Ga0495605_0004410
329 Ga0495605_0031618
330 Ga0495662_0066966
331 Ga0495664_0030402
332 Ga0495664_0134626
333 Ga0495594_0036461
334 Ga0495583_0010462
335 Ga0495583_0182528
336 Ga0495606_0007436
337 Ga0495608_0028234
338 Ga0495616_0003547
339 Ga0495618_0183712
340 Ga0495620_0007165
341 Ga0495620_0007748
342 Ga0495628_0196568
343 Ga0495628_0257036
344 Ga0495631_0002870
345 Ga0495632_0087310
346 Ga0495643_0004046
347 Ga0495648_0028104
348 Ga0495648_0054886
349 Ga0495666_0023651
350 Ga0495652_0060856
351 Ga0495640_0012622
352 Ga0495640_0319211
353 Ga0495609_0016901
354 Ga0495597_0013667
355 Ga0495597_0020913
356 Ga0495667_0197536
357 Ga0495634_0196890
358 Ga0495634_0236382
359 Ga0495611_0007348
360 Ga0495611_0049385
361 Ga0495611_0099303
362 Ga0495625_0079582
363 Ga0495625_0171741
364 Ga0495635_0136389
365 Ga0495635_0268599
366 Ga0495661_0095724
367 Ga0495588_0048653
368 Ga0495657_0016849
369 Ga0495657_0049839
370 Ga0495657_0152956
371 Ga0495613_0039615
372 Ga0495613_0081629
373 Ga0495613_0107201
374 Ga0495624_0023862
375 Ga0495624_0025477
376 Ga0495649_0012867
377 Ga0495649_0061100
378 Ga0495649_0087882
379 Ga0495589_0006771
380 Ga0495589_0099428
381 Ga0495600_0113492
382 Ga0495660_0015464
383 Ga0495604_0065052
384 Ga0495604_0081268
385 Ga0495636_0022341
386 Ga0495636_0030695
387 Ga0495636_0087548
388 Ga0495636_0157352
389 Ga0495674_0136485
390 Ga0495672_0018172
391 Ga0495676_0076295
392 Ga0495676_0257058
393 Ga0495680_0012540
394 Ga0495683_0056289
395 Ga0495683_0091714
396 Ga0495687_015657
397 Ga0495687_047913
398 Ga0495685_030122
399 Ga0495685_033594
400 Ga0495686_0143518
401 Ga0495593_0088270
402 Ga0495614_0083318
403 Ga0495626_0005954
404 Ga0495626_0050238
405 Ga0501032_0105071
406 Ga0501034_0010749
407 Ga0501034_0016268
408 Ga0501034_0144672
409 Ga0501036_0076385
410 Ga0501036_0107514
411 Ga0501037_0179597
412 Ga0501038_0001438
413 Ga0501038_0220224
414 Ga0501039_0005758
415 Ga0501043_0081823
416 Ga0501043_0356580
417 Ga0501046_0130817
418 Ga0501047_0124328
419 Ga0501047_0303183
420 Ga0501047_0385625
421 Ga0501069_0319324
422 Ga0501070_0006871
423 Ga0501073_0252474
424 Ga0501074_0143520
425 Ga0501035_0019535
426 Ga0501035_0045687
427 Ga0501035_0053783
428 Ga0501035_0175036
429 Ga0501044_0017651
430 Ga0501044_0092872
431 Ga0501044_0322963
432 Ga0501044_0602597
433 Ga0501045_0177960
434 nmdc:mga03n38_99953_c1
435 nmdc:mga07m45_91901_c1
436 Ga0500600_0104404
437 Ga0500600_0167990
438 Ga0466962_0000188
439 Ga0466962_0106018
440 2547410408
441 2585311345
442 2616699946
443 2644269517
444 2644437839
445 2644629775
446 2676475570
447 2784590571
448 2786672846
449 2808844194
450 2809234264
451 2812355768
452 2812478583
453 2827634564
454 2852639654
455 2862284412
456 2862511267
457 2867430370
458 2877678855
459 2912762972
460 2919472423
461 2946070024
462 2946077913
463 2947226751
464 2954383819
465 2954679150
466 2954685002
467 2954694617
468 2954709821
469 2954714118
470 2954724071
471 2954737768
472 2954742969
473 2954756604
474 2954761927
475 8008576976
476 8023624782
477 8025532598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

40

234

0.88

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

43

240

0.83

PF13242

Hydrolase_like

HAD-hyrolase-like

193

268

0.81

PF12710

HAD

haloacid dehalogenase-like hydrolase

43

224

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i8b-assembly1.cif.gz_J outer shell and inner layer structures of autographa californica multiple nucleopolyhedrovirus (acmnpv) 0.8861 106 150
3qnm-assembly1.cif.gz_A haloalkane dehalogenase family member from bacteroides thetaiotaomicron of unknown function 0.8514 1 230
3qnm-assembly1.cif.gz_A haloalkane dehalogenase family member from bacteroides thetaiotaomicron of unknown function 0.8447 1 230
3ib6-assembly1.cif.gz_C crystal structure of an uncharacterized protein from listeria monocytogenes serotype 4b 0.8121 101 230
6q7q-assembly1.cif.gz_A crystal structure of oe1.3 0.8103 3 229
ID Description Score Start End Superfamily
af_Q8I3U9_47_225_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.919 102 150 3.40.50.1000
3vayB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9143 104 230 3.40.50.1000
1zrmA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9136 104 229 3.40.50.1000
af_Q7T012_106_236_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9136 105 228 3.40.50.1000
af_Q9W4J7_113_224_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9109 100 197 3.40.50.1000
ID Description Score Start End GO Terms
AF-L8EJ41-F1-model_v4 deleted 0.9466 2 243
AF-Q82JR4-F1-model_v4 Hydrolase 0.9332 2 243 GO:0016791
GO:0044283
AF-L8EJ41-F1-model_v4 deleted 0.9316 2 243
AF-A0A3Q9HRV5-F1-model_v4 HAD family hydrolase 0.9307 5 229 GO:0016791
GO:0044283
AF-A0A1V4AU77-F1-model_v4 Haloacid dehalogenase 0.9288 6 225 GO:0016791
GO:0044283

Map