F351302
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 238 | 149 | 234 | 245 |
Family's Representative Sequence
| Representative Sequence | 3300047320|Ga0495672_0000632|Ga0495672_0000632_13841_14659 |
| Length | 272 |
| Sequence | LAACLAGEIYAGTYAGTKEKIMAARRPLIAGNWKMYGRVADLAQISATFEAVGAGAKAVDIVFCLPAQLIALAAKDCPASALGGQXXAETAADAAQTGDISAAMLADVGAGYVIVGHSERRAKRRDDNESVRLKAEAALAAGLQPIICVGETAAERASGRAEAVVAGQVAASLPTAEGMVSVAYEPVWAIGGDRTPTLEEIAAIHRVVRQELAKRYGPAAEAVRVLYGGSVNPKNARDIFAVEGVDGALVGRASLKSADFAALIMSHPRVAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 2 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 3 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 4 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 5 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 32 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 33 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 34 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 36 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 38 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 39 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 56 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 57 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 58 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 94 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 95 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 97 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 98 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 99 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 100 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 101 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 102 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 104 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 105 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 106 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 107 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 108 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 109 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 110 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 111 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 112 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 113 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 114 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 115 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 116 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 117 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 118 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 129 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 130 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 131 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 132 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 133 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 134 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 139 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 140 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 141 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 142 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 143 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 144 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 145 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 146 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 147 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 148 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 149 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.9 |
| Metatranscriptomes | 0.42 |
| Isolates | 1.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.66 |
| Nodule | 0 |
| Rhizoplane | 2.1 |
| Rhizosphere | 79.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055530_10000685 | 3300003791 | Bacteria | 28722 |
| 2 | Ga0055531_10004322 | 3300003794 | Bacteria | 8702 |
| 3 | Ga0070670_100000037 | 3300005331 | Bacteria | 156070 |
| 4 | Ga0070670_100040335 | 3300005331 | Bacteria | 4015 |
| 5 | Ga0070666_10230375 | 3300005335 | Bacteria | 1308 |
| 6 | Ga0070680_100025744 | 3300005336 | Bacteria | 4703 |
| 7 | Ga0070660_100347043 | 3300005339 | Bacteria | 1222 |
| 8 | Ga0070691_10011443 | 3300005341 | Bacteria | 4052 |
| 9 | Ga0070668_100000097 | 3300005347 | Bacteria | 53800 |
| 10 | Ga0070668_100018957 | 3300005347 | Bacteria | 5170 |
| 11 | Ga0070669_100007690 | 3300005353 | Bacteria | 7706 |
| 12 | Ga0070671_100000342 | 3300005355 | Bacteria | 32006 |
| 13 | Ga0070671_100131586 | 3300005355 | Bacteria | 2107 |
| 14 | Ga0070659_100000206 | 3300005366 | Bacteria | 45867 |
| 15 | Ga0070659_100013775 | 3300005366 | Bacteria | 6031 |
| 16 | Ga0070667_100000083 | 3300005367 | Bacteria | 118261 |
| 17 | Ga0070667_100015622 | 3300005367 | Bacteria | 6277 |
| 18 | Ga0070667_100286697 | 3300005367 | Bacteria | 1480 |
| 19 | Ga0070681_10017736 | 3300005458 | Bacteria | 7114 |
| 20 | Ga0070706_100260560 | 3300005467 | Bacteria | 1618 |
| 21 | Ga0070706_100280043 | 3300005467 | Bacteria | 1556 |
| 22 | Ga0070707_100406537 | 3300005468 | Unclassified | 1321 |
| 23 | Ga0070698_100004235 | 3300005471 | Bacteria | 15769 |
| 24 | Ga0070679_100003462 | 3300005530 | Bacteria | 14454 |
| 25 | Ga0070697_100064937 | 3300005536 | Bacteria | 2981 |
| 26 | Ga0068853_100074102 | 3300005539 | Bacteria | 2970 |
| 27 | Ga0068853_100517171 | 3300005539 | Bacteria | 1128 |
| 28 | Ga0070665_100000116 | 3300005548 | Bacteria | 150141 |
| 29 | Ga0070665_100000278 | 3300005548 | Bacteria | 84248 |
| 30 | Ga0070665_100000483 | 3300005548 | Bacteria | 57237 |
| 31 | Ga0070665_100129119 | 3300005548 | Bacteria | 2530 |
| 32 | Ga0070665_100258217 | 3300005548 | Bacteria | 1743 |
| 33 | Ga0068855_100048334 | 3300005563 | Bacteria | 5021 |
| 34 | Ga0068855_100051066 | 3300005563 | Bacteria | 4871 |
| 35 | Ga0068855_100220141 | 3300005563 | Bacteria | 2129 |
| 36 | Ga0068855_100266855 | 3300005563 | Bacteria | 1905 |
| 37 | Ga0070664_100025727 | 3300005564 | Bacteria | 4880 |
| 38 | Ga0068852_100120426 | 3300005616 | Bacteria | 2401 |
| 39 | Ga0068852_100128448 | 3300005616 | Bacteria | 2331 |
| 40 | Ga0068859_100000435 | 3300005617 | Bacteria | 41931 |
| 41 | Ga0068859_100298525 | 3300005617 | Bacteria | 1704 |
| 42 | Ga0068859_100317741 | 3300005617 | Bacteria | 1651 |
| 43 | Ga0068864_100000786 | 3300005618 | Bacteria | 26635 |
| 44 | Ga0068863_100001697 | 3300005841 | Bacteria | 21819 |
| 45 | Ga0068863_100014231 | 3300005841 | Bacteria | 7665 |
| 46 | Ga0068863_100172768 | 3300005841 | Bacteria | 2073 |
| 47 | Ga0068858_100021274 | 3300005842 | Bacteria | 6059 |
| 48 | Ga0068858_100578672 | 3300005842 | Bacteria | 1088 |
| 49 | Ga0068860_100000128 | 3300005843 | Bacteria | 122731 |
| 50 | Ga0068860_100731772 | 3300005843 | Bacteria | 1000 |
| 51 | Ga0068862_100001627 | 3300005844 | Bacteria | 20442 |
| 52 | Ga0068862_100005242 | 3300005844 | Bacteria | 10873 |
| 53 | Ga0068862_100007701 | 3300005844 | Bacteria | 8910 |
| 54 | Ga0070717_10352215 | 3300006028 | Bacteria | 1316 |
| 55 | Ga0075364_10000306 | 3300006051 | Bacteria | 23963 |
| 56 | Ga0070716_100144120 | 3300006173 | Bacteria | 1523 |
| 57 | Ga0075367_10015158 | 3300006178 | Bacteria | 4183 |
| 58 | Ga0075369_10021117 | 3300006186 | Bacteria | 2672 |
| 59 | Ga0075370_10019459 | 3300006353 | Bacteria | 3698 |
| 60 | Ga0068871_100414194 | 3300006358 | Bacteria | 1202 |
| 61 | Ga0068865_100005340 | 3300006881 | Bacteria | 7781 |
| 62 | Ga0097620_100000435 | 3300006931 | Bacteria | 41931 |
| 63 | Ga0097620_100298527 | 3300006931 | Bacteria | 1704 |
| 64 | Ga0097620_100317746 | 3300006931 | Bacteria | 1651 |
| 65 | Ga0105240_10066735 | 3300009093 | Bacteria | 4462 |
| 66 | Ga0105240_10119671 | 3300009093 | Bacteria | 3172 |
| 67 | Ga0105240_10571616 | 3300009093 | Bacteria | 1248 |
| 68 | Ga0105247_10120849 | 3300009101 | Bacteria | 1697 |
| 69 | Ga0105248_10007787 | 3300009177 | Bacteria | 11756 |
| 70 | Ga0105248_10156746 | 3300009177 | Bacteria | 2569 |
| 71 | Ga0105248_10332704 | 3300009177 | Bacteria | 1710 |
| 72 | Ga0105238_10156107 | 3300009551 | Bacteria | 2257 |
| 73 | Ga0105249_10010617 | 3300009553 | Bacteria | 8090 |
| 74 | Ga0105239_10249639 | 3300010375 | Bacteria | 1993 |
| 75 | Ga0105239_10290314 | 3300010375 | Bacteria | 1842 |
| 76 | Ga0157373_10001429 | 3300013100 | Bacteria | 18213 |
| 77 | Ga0157373_10008774 | 3300013100 | Bacteria | 7490 |
| 78 | Ga0157370_10079389 | 3300013104 | Bacteria | 3090 |
| 79 | Ga0157370_10196112 | 3300013104 | Bacteria | 1874 |
| 80 | Ga0157370_10300514 | 3300013104 | Bacteria | 1482 |
| 81 | Ga0157370_10544606 | 3300013104 | Bacteria | 1064 |
| 82 | Ga0157369_10071812 | 3300013105 | Bacteria | 3715 |
| 83 | Ga0163162_10027619 | 3300013306 | Bacteria | 5613 |
| 84 | Ga0163162_10046155 | 3300013306 | Bacteria | 4367 |
| 85 | Ga0163163_10014023 | 3300014325 | Bacteria | 7354 |
| 86 | Ga0163163_10058081 | 3300014325 | Bacteria | 3825 |
| 87 | Ga0163163_10075508 | 3300014325 | Bacteria | 3364 |
| 88 | Ga0157379_10006808 | 3300014968 | Bacteria | 9879 |
| 89 | Ga0157379_10007276 | 3300014968 | Bacteria | 9581 |
| 90 | Ga0213872_10015402 | 3300021361 | Bacteria | 3558 |
| 91 | Ga0213876_10000320 | 3300021384 | Bacteria | 42027 |
| 92 | Ga0213876_10007130 | 3300021384 | Bacteria | 6091 |
| 93 | Ga0213876_10120234 | 3300021384 | Bacteria | 1394 |
| 94 | Ga0213875_10093728 | 3300021388 | Bacteria | 1400 |
| 95 | Ga0213875_10207252 | 3300021388 | Bacteria | 923 |
| 96 | Ga0209758_1001665 | 3300025297 | Bacteria | 25124 |
| 97 | Ga0209050_1000101 | 3300025298 | Bacteria | 230076 |
| 98 | Ga0209257_1000221 | 3300025304 | Bacteria | 134870 |
| 99 | Ga0209257_1002453 | 3300025304 | Bacteria | 18398 |
| 100 | Ga0207710_10047865 | 3300025900 | Bacteria | 1912 |
| 101 | Ga0207680_10013441 | 3300025903 | Bacteria | 4205 |
| 102 | Ga0207680_10152461 | 3300025903 | Bacteria | 1542 |
| 103 | Ga0207705_10232616 | 3300025909 | Bacteria | 1402 |
| 104 | Ga0207705_10270835 | 3300025909 | Bacteria | 1298 |
| 105 | Ga0207684_10048196 | 3300025910 | Bacteria | 3613 |
| 106 | Ga0207707_10013828 | 3300025912 | Bacteria | 7038 |
| 107 | Ga0207695_10001229 | 3300025913 | Bacteria | 43850 |
| 108 | Ga0207695_10040013 | 3300025913 | Bacteria | 5033 |
| 109 | Ga0207695_10056250 | 3300025913 | Bacteria | 4095 |
| 110 | Ga0207695_10267226 | 3300025913 | Bacteria | 1607 |
| 111 | Ga0207657_10054993 | 3300025919 | Bacteria | 3439 |
| 112 | Ga0207652_10165766 | 3300025921 | Bacteria | 1981 |
| 113 | Ga0207652_10226356 | 3300025921 | Bacteria | 1685 |
| 114 | Ga0207646_10371218 | 3300025922 | Bacteria | 1292 |
| 115 | Ga0207681_10020979 | 3300025923 | Bacteria | 4147 |
| 116 | Ga0207694_10127464 | 3300025924 | Bacteria | 2037 |
| 117 | Ga0207650_10000062 | 3300025925 | Bacteria | 149776 |
| 118 | Ga0207650_10028294 | 3300025925 | Bacteria | 4017 |
| 119 | Ga0207644_10002578 | 3300025931 | Bacteria | 11664 |
| 120 | Ga0207690_10000129 | 3300025932 | Bacteria | 62350 |
| 121 | Ga0207706_10654579 | 3300025933 | Bacteria | 899 |
| 122 | Ga0207704_10000400 | 3300025938 | Bacteria | 19733 |
| 123 | Ga0207665_10035907 | 3300025939 | Unclassified | 3293 |
| 124 | Ga0207711_10192753 | 3300025941 | Bacteria | 1858 |
| 125 | Ga0207679_10018430 | 3300025945 | Bacteria | 4677 |
| 126 | Ga0207667_10039007 | 3300025949 | Bacteria | 5065 |
| 127 | Ga0207667_10105523 | 3300025949 | Bacteria | 2907 |
| 128 | Ga0207667_10136262 | 3300025949 | Bacteria | 2528 |
| 129 | Ga0207667_10177018 | 3300025949 | Bacteria | 2191 |
| 130 | Ga0207667_10793450 | 3300025949 | Bacteria | 944 |
| 131 | Ga0207712_10001004 | 3300025961 | Bacteria | 20092 |
| 132 | Ga0207668_10000028 | 3300025972 | Bacteria | 125361 |
| 133 | Ga0207668_10000507 | 3300025972 | Bacteria | 24393 |
| 134 | Ga0207668_10001494 | 3300025972 | Bacteria | 13660 |
| 135 | Ga0207658_10000209 | 3300025986 | Bacteria | 61041 |
| 136 | Ga0207658_10005903 | 3300025986 | Bacteria | 8364 |
| 137 | Ga0207658_10372792 | 3300025986 | Bacteria | 1248 |
| 138 | Ga0207703_10003741 | 3300026035 | Bacteria | 12658 |
| 139 | Ga0207639_10033221 | 3300026041 | Bacteria | 3804 |
| 140 | Ga0207641_10000341 | 3300026088 | Bacteria | 56155 |
| 141 | Ga0207641_10240162 | 3300026088 | Bacteria | 1688 |
| 142 | Ga0207676_10000797 | 3300026095 | Bacteria | 24574 |
| 143 | Ga0207698_10561179 | 3300026142 | Bacteria | 1121 |
| 144 | Ga0209813_10002036 | 3300027866 | Bacteria | 4586 |
| 145 | Ga0268266_10000064 | 3300028379 | Bacteria | 249533 |
| 146 | Ga0268266_10000792 | 3300028379 | Bacteria | 42146 |
| 147 | Ga0268266_10001340 | 3300028379 | Bacteria | 29786 |
| 148 | Ga0268265_10002811 | 3300028380 | Bacteria | 12812 |
| 149 | Ga0268265_10004003 | 3300028380 | Bacteria | 10375 |
| 150 | Ga0268265_10037939 | 3300028380 | Bacteria | 3540 |
| 151 | Ga0268264_10000046 | 3300028381 | Bacteria | 364597 |
| 152 | Ga0268264_10000059 | 3300028381 | Bacteria | 306927 |
| 153 | Ga0268264_10091708 | 3300028381 | Bacteria | 2621 |
| 154 | Ga0268264_10523274 | 3300028381 | Bacteria | 1160 |
| 155 | Ga0265334_10010379 | 3300028573 | Bacteria | 3935 |
| 156 | Ga0307517_10063398 | 3300028786 | Bacteria | 3457 |
| 157 | Ga0265338_10009139 | 3300028800 | Bacteria | 11899 |
| 158 | Ga0265338_10019638 | 3300028800 | Bacteria | 7153 |
| 159 | Ga0265327_10000682 | 3300031251 | Bacteria | 54560 |
| 160 | Ga0265327_10034801 | 3300031251 | Bacteria | 2791 |
| 161 | Ga0307513_10000448 | 3300031456 | Bacteria | 59427 |
| 162 | Ga0316576_10020795 | 3300031727 | Bacteria | 4527 |
| 163 | Ga0316576_10043412 | 3300031727 | Bacteria | 3244 |
| 164 | Ga0316576_10063715 | 3300031727 | Bacteria | 2706 |
| 165 | Ga0316578_10049680 | 3300031728 | Bacteria | 2452 |
| 166 | Ga0316578_10250784 | 3300031728 | Bacteria | 1062 |
| 167 | Ga0307414_10033024 | 3300032004 | Bacteria | 3415 |
| 168 | Ga0307414_10394014 | 3300032004 | Bacteria | 1201 |
| 169 | Ga0307510_10078953 | 3300033180 | Bacteria | 3214 |
| 170 | Ga0316596_1025108 | 3300033541 | Bacteria | 1532 |
| 171 | Ga0373960_0031795 | 3300035121 | Bacteria | 1478 |
| 172 | Ga0316574_0008955 | 3300035398 | Bacteria | 5589 |
| 173 | Ga0316574_0014936 | 3300035398 | Bacteria | 4499 |
| 174 | Ga0316574_0034825 | 3300035398 | Bacteria | 3073 |
| 175 | Ga0316582_0242480 | 3300036647 | Bacteria | 1235 |
| 176 | Ga0316584_0011355 | 3300036712 | Bacteria | 6256 |
| 177 | Ga0316584_0109343 | 3300036712 | Bacteria | 2069 |
| 178 | Ga0316584_0129442 | 3300036712 | Bacteria | 1885 |
| 179 | Ga0395899_0023296 | 3300037312 | Bacteria | 4693 |
| 180 | Ga0395900_0122448 | 3300037418 | Bacteria | 2668 |
| 181 | Ga0395898_0102107 | 3300037466 | Bacteria | 2753 |
| 182 | Ga0395905_0016382 | 3300037471 | Bacteria | 7042 |
| 183 | Ga0395905_0393991 | 3300037471 | Bacteria | 1279 |
| 184 | Ga0436364_0369116 | 3300037853 | Bacteria | 954 |
| 185 | Ga0436364_1349678 | 3300037853 | Bacteria | 1329 |
| 186 | Ga0395901_0016144 | 3300038443 | Bacteria | 7606 |
| 187 | Ga0395901_0033445 | 3300038443 | Bacteria | 5309 |
| 188 | Ga0436365_0629243 | 3300039437 | Bacteria | 13018 |
| 189 | Ga0436365_0678918 | 3300039437 | Bacteria | 6672 |
| 190 | Ga0436365_0787469 | 3300039437 | Bacteria | 3493 |
| 191 | Ga0436365_1225891 | 3300039437 | Bacteria | 1954 |
| 192 | Ga0436365_1465422 | 3300039437 | Bacteria | 1634 |
| 193 | Ga0436365_1655540 | 3300039437 | Bacteria | 20314 |
| 194 | Ga0436361_0686811 | 3300039447 | Bacteria | 1838 |
| 195 | Ga0436361_1173302 | 3300039447 | Bacteria | 1453 |
| 196 | Ga0436363_0577559 | 3300039450 | Bacteria | 1670 |
| 197 | Ga0450901_004293 | 3300042533 | Bacteria | 1476 |
| 198 | Ga0466964_0166334 | 3300044706 | Bacteria | 1035 |
| 199 | Ga0495638_0004783 | 3300046460 | Bacteria | 10208 |
| 200 | Ga0495642_0020031 | 3300046528 | Bacteria | 2624 |
| 201 | Ga0495597_0001737 | 3300046542 | Bacteria | 15014 |
| 202 | Ga0495633_0001548 | 3300046558 | Bacteria | 17646 |
| 203 | Ga0495668_0044084 | 3300046616 | Bacteria | 2479 |
| 204 | Ga0495625_0149041 | 3300046660 | Bacteria | 1574 |
| 205 | Ga0495625_0262319 | 3300046660 | Bacteria | 1117 |
| 206 | Ga0495669_0000024 | 3300046684 | Bacteria | 113943 |
| 207 | Ga0495669_0000199 | 3300046684 | Bacteria | 36829 |
| 208 | Ga0495649_0000538 | 3300046694 | Bacteria | 32158 |
| 209 | Ga0495672_0000632 | 3300047320 | Bacteria | 39290 |
| 210 | Ga0495677_0047312 | 3300047445 | Bacteria | 1579 |
| 211 | Ga0495677_0072970 | 3300047445 | Bacteria | 1280 |
| 212 | Ga0496103_0066355 | 3300048906 | Bacteria | 2252 |
| 213 | Ga0496106_0277296 | 3300048909 | Bacteria | 1343 |
| 214 | Ga0496107_0174991 | 3300048910 | Bacteria | 1593 |
| 215 | Ga0496115_0003418 | 3300048918 | Bacteria | 11405 |
| 216 | Ga0496115_0101515 | 3300048918 | Bacteria | 2359 |
| 217 | Ga0496123_0001713 | 3300048926 | Bacteria | 29280 |
| 218 | Ga0496125_0002624 | 3300048928 | Bacteria | 23043 |
| 219 | Ga0501032_0114368 | 3300049569 | Bacteria | 1785 |
| 220 | Ga0501033_0055218 | 3300049570 | Bacteria | 2937 |
| 221 | Ga0501070_0200914 | 3300049586 | Bacteria | 1637 |
| 222 | Ga0501044_0218134 | 3300049823 | Bacteria | 1859 |
| 223 | nmdc:mga00v17_423_c1 | 3300050491 | Bacteria | 23976 |
| 224 | nmdc:mga06z11_15466_c1 | 3300050494 | Bacteria | 3407 |
| 225 | nmdc:mga04h51_1841_c1 | 3300050495 | Bacteria | 4961 |
| 226 | nmdc:mga07m45_1047_c1 | 3300050496 | Bacteria | 12323 |
| 227 | Ga0500643_005940 | 3300053087 | Bacteria | 5178 |
| 228 | Ga0500647_0001478 | 3300053091 | Bacteria | 8090 |
| 229 | Ga0500641_0000513 | 3300053096 | Bacteria | 13949 |
| 230 | Ga0500569_001981 | 3300053109 | Bacteria | 3969 |
| 231 | Ga0500559_0000077 | 3300053136 | Bacteria | 76287 |
| 232 | Ga0500577_0009592 | 3300053142 | Bacteria | 2816 |
| 233 | Ga0500638_157765 | 3300053162 | Bacteria | 1002 |
| 234 | Ga0500636_0012949 | 3300053177 | Bacteria | 4894 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013105 | Ga0157369_10071812 | Ga0157369_100718122 | 213 |
| 2 | 3300006051 | Ga0075364_10000306 | Ga0075364_100003066 | 217 |
| 3 | 3300006178 | Ga0075367_10015158 | Ga0075367_100151584 | 217 |
| 4 | 3300006186 | Ga0075369_10021117 | Ga0075369_100211172 | 217 |
| 5 | 3300027866 | Ga0209813_10002036 | Ga0209813_100020362 | 217 |
| 6 | 3300035398 | Ga0316574_0034825 | Ga0316574_0034825_27_686 | 217 |
| 7 | 3300050491 | nmdc:mga00v17_423_c1 | nmdc:mga00v17_423_c1_5012_5755 | 217 |
| 8 | 3300050494 | nmdc:mga06z11_15466_c1 | nmdc:mga06z11_15466_c1_538_1281 | 217 |
| 9 | 3300050495 | nmdc:mga04h51_1841_c1 | nmdc:mga04h51_1841_c1_1975_2718 | 217 |
| 10 | 3300050496 | nmdc:mga07m45_1047_c1 | nmdc:mga07m45_1047_c1_1574_2317 | 217 |
| 11 | 3300005467 | Ga0070706_100280043 | Ga0070706_1002800432 | 223 |
| 12 | 3300005468 | Ga0070707_100406537 | Ga0070707_1004065372 | 223 |
| 13 | 3300005536 | Ga0070697_100064937 | Ga0070697_1000649372 | 223 |
| 14 | 3300039447 | Ga0436361_1173302 | Ga0436361_1173302_736_1440 | 223 |
| 15 | 3300006353 | Ga0075370_10019459 | Ga0075370_100194595 | 225 |
| 16 | 3300035121 | Ga0373960_0031795 | Ga0373960_0031795_704_1459 | 226 |
| 17 | 3300025304 | Ga0209257_1002453 | Ga0209257_10024532 | 227 |
| 18 | 3300037853 | Ga0436364_0369116 | Ga0436364_0369116_230_937 | 233 |
| 19 | 3300053142 | Ga0500577_0009592 | Ga0500577_0009592_400_1110 | 233 |
| 20 | 3300005341 | Ga0070691_10011443 | Ga0070691_100114435 | 234 |
| 21 | 3300005458 | Ga0070681_10017736 | Ga0070681_100177366 | 234 |
| 22 | 3300005530 | Ga0070679_100003462 | Ga0070679_10000346218 | 234 |
| 23 | 3300005563 | Ga0068855_100051066 | Ga0068855_1000510662 | 234 |
| 24 | 3300013104 | Ga0157370_10079389 | Ga0157370_100793892 | 234 |
| 25 | 3300021384 | Ga0213876_10000320 | Ga0213876_1000032042 | 234 |
| 26 | 3300021388 | Ga0213875_10207252 | Ga0213875_102072521 | 234 |
| 27 | 3300025912 | Ga0207707_10013828 | Ga0207707_100138283 | 234 |
| 28 | 3300025913 | Ga0207695_10001229 | Ga0207695_1000122939 | 234 |
| 29 | 3300025921 | Ga0207652_10165766 | Ga0207652_101657662 | 234 |
| 30 | 3300025949 | Ga0207667_10177018 | Ga0207667_101770182 | 234 |
| 31 | 3300037312 | Ga0395899_0023296 | Ga0395899_0023296_1259_1972 | 234 |
| 32 | 3300037418 | Ga0395900_0122448 | Ga0395900_0122448_263_976 | 234 |
| 33 | 3300038443 | Ga0395901_0016144 | Ga0395901_0016144_874_1587 | 234 |
| 34 | 3300039450 | Ga0436363_0577559 | Ga0436363_0577559_938_1648 | 234 |
| 35 | 3300046528 | Ga0495642_0020031 | Ga0495642_0020031_1505_2209 | 234 |
| 36 | 3300046660 | Ga0495625_0149041 | Ga0495625_0149041_140_844 | 234 |
| 37 | 3300046684 | Ga0495669_0000024 | Ga0495669_0000024_65891_66595 | 234 |
| 38 | 3300047445 | Ga0495677_0047312 | Ga0495677_0047312_859_1563 | 234 |
| 39 | 3300047445 | Ga0495677_0072970 | Ga0495677_0072970_130_834 | 234 |
| 40 | 3300048909 | Ga0496106_0277296 | Ga0496106_0277296_250_963 | 234 |
| 41 | 3300048910 | Ga0496107_0174991 | Ga0496107_0174991_848_1561 | 234 |
| 42 | 3300048918 | Ga0496115_0101515 | Ga0496115_0101515_1277_1990 | 234 |
| 43 | 3300005367 | Ga0070667_100286697 | Ga0070667_1002866972 | 235 |
| 44 | 3300005617 | Ga0068859_100317741 | Ga0068859_1003177412 | 235 |
| 45 | 3300005844 | Ga0068862_100007701 | Ga0068862_10000770111 | 235 |
| 46 | 3300006931 | Ga0097620_100317746 | Ga0097620_1003177462 | 235 |
| 47 | 3300025986 | Ga0207658_10372792 | Ga0207658_103727921 | 235 |
| 48 | 3300028380 | Ga0268265_10004003 | Ga0268265_100040033 | 235 |
| 49 | 3300046660 | Ga0495625_0262319 | Ga0495625_0262319_68_829 | 235 |
| 50 | 3300044706 | Ga0466964_0166334 | Ga0466964_0166334_68_811 | 239 |
| 51 | 3300053177 | Ga0500636_0012949 | Ga0500636_0012949_4094_4846 | 240 |
| 52 | 3300053136 | Ga0500559_0000077 | Ga0500559_0000077_68545_69279 | 241 |
| 53 | iso_pu_bacteria | 2739367756 | 2739791365 | 241 |
| 54 | 3300047320 | Ga0495672_0000632 | Ga0495672_0000632_13841_14659 | 243 |
| 55 | 3300053091 | Ga0500647_0001478 | Ga0500647_0001478_5979_6719 | 243 |
| 56 | iso_pu_bacteria | 2928972540 | 2928975081 | 243 |
| 57 | iso_pu_bacteria | 2941485952 | 2941488495 | 243 |
| 58 | iso_pu_bacteria | 2977240413 | 2977241926 | 243 |
| 59 | 3300005355 | Ga0070671_100131586 | Ga0070671_1001315862 | 244 |
| 60 | 3300021388 | Ga0213875_10093728 | Ga0213875_100937281 | 244 |
| 61 | 3300039437 | Ga0436365_1225891 | Ga0436365_1225891_1028_1768 | 244 |
| 62 | 3300049569 | Ga0501032_0114368 | Ga0501032_0114368_75_821 | 244 |
| 63 | 3300049570 | Ga0501033_0055218 | Ga0501033_0055218_1140_1886 | 244 |
| 64 | 3300049586 | Ga0501070_0200914 | Ga0501070_0200914_796_1542 | 244 |
| 65 | 3300049823 | Ga0501044_0218134 | Ga0501044_0218134_399_1145 | 244 |
| 66 | 3300005471 | Ga0070698_100004235 | Ga0070698_1000042352 | 245 |
| 67 | 3300005539 | Ga0068853_100517171 | Ga0068853_1005171711 | 245 |
| 68 | 3300006028 | Ga0070717_10352215 | Ga0070717_103522152 | 245 |
| 69 | 3300006173 | Ga0070716_100144120 | Ga0070716_1001441202 | 245 |
| 70 | 3300025939 | Ga0207665_10035907 | Ga0207665_100359073 | 245 |
| 71 | 3300026041 | Ga0207639_10033221 | Ga0207639_100332214 | 245 |
| 72 | 3300031727 | Ga0316576_10043412 | Ga0316576_100434122 | 245 |
| 73 | 3300031727 | Ga0316576_10063715 | Ga0316576_100637152 | 245 |
| 74 | 3300031728 | Ga0316578_10049680 | Ga0316578_100496803 | 245 |
| 75 | 3300035398 | Ga0316574_0008955 | Ga0316574_0008955_4428_5177 | 245 |
| 76 | 3300035398 | Ga0316574_0014936 | Ga0316574_0014936_1312_2058 | 245 |
| 77 | 3300036647 | Ga0316582_0242480 | Ga0316582_0242480_49_795 | 245 |
| 78 | 3300036712 | Ga0316584_0011355 | Ga0316584_0011355_4616_5365 | 245 |
| 79 | 3300036712 | Ga0316584_0109343 | Ga0316584_0109343_193_942 | 245 |
| 80 | 3300039437 | Ga0436365_0629243 | Ga0436365_0629243_5361_6134 | 245 |
| 81 | 3300039447 | Ga0436361_0686811 | Ga0436361_0686811_82_852 | 245 |
| 82 | 3300053096 | Ga0500641_0000513 | Ga0500641_0000513_5052_5795 | 245 |
| 83 | 3300028573 | Ga0265334_10010379 | Ga0265334_100103792 | 246 |
| 84 | 3300028800 | Ga0265338_10019638 | Ga0265338_100196387 | 246 |
| 85 | 3300032004 | Ga0307414_10033024 | Ga0307414_100330242 | 246 |
| 86 | 3300003791 | Ga0055530_10000685 | Ga0055530_1000068529 | 247 |
| 87 | 3300003794 | Ga0055531_10004322 | Ga0055531_100043223 | 247 |
| 88 | 3300005331 | Ga0070670_100000037 | Ga0070670_10000003771 | 247 |
| 89 | 3300005331 | Ga0070670_100040335 | Ga0070670_1000403352 | 247 |
| 90 | 3300005335 | Ga0070666_10230375 | Ga0070666_102303751 | 247 |
| 91 | 3300005336 | Ga0070680_100025744 | Ga0070680_1000257442 | 247 |
| 92 | 3300005339 | Ga0070660_100347043 | Ga0070660_1003470431 | 247 |
| 93 | 3300005347 | Ga0070668_100000097 | Ga0070668_10000009748 | 247 |
| 94 | 3300005347 | Ga0070668_100018957 | Ga0070668_1000189573 | 247 |
| 95 | 3300005353 | Ga0070669_100007690 | Ga0070669_1000076908 | 247 |
| 96 | 3300005355 | Ga0070671_100000342 | Ga0070671_10000034232 | 247 |
| 97 | 3300005366 | Ga0070659_100000206 | Ga0070659_10000020649 | 247 |
| 98 | 3300005366 | Ga0070659_100013775 | Ga0070659_1000137752 | 247 |
| 99 | 3300005367 | Ga0070667_100000083 | Ga0070667_10000008371 | 247 |
| 100 | 3300005367 | Ga0070667_100015622 | Ga0070667_1000156221 | 247 |
| 101 | 3300005467 | Ga0070706_100260560 | Ga0070706_1002605602 | 247 |
| 102 | 3300005539 | Ga0068853_100074102 | Ga0068853_1000741022 | 247 |
| 103 | 3300005548 | Ga0070665_100000116 | Ga0070665_10000011675 | 247 |
| 104 | 3300005548 | Ga0070665_100000278 | Ga0070665_1000002789 | 247 |
| 105 | 3300005548 | Ga0070665_100000483 | Ga0070665_10000048323 | 247 |
| 106 | 3300005548 | Ga0070665_100129119 | Ga0070665_1001291192 | 247 |
| 107 | 3300005548 | Ga0070665_100258217 | Ga0070665_1002582172 | 247 |
| 108 | 3300005563 | Ga0068855_100048334 | Ga0068855_1000483343 | 247 |
| 109 | 3300005563 | Ga0068855_100220141 | Ga0068855_1002201412 | 247 |
| 110 | 3300005563 | Ga0068855_100266855 | Ga0068855_1002668552 | 247 |
| 111 | 3300005564 | Ga0070664_100025727 | Ga0070664_1000257273 | 247 |
| 112 | 3300005616 | Ga0068852_100120426 | Ga0068852_1001204262 | 247 |
| 113 | 3300005616 | Ga0068852_100128448 | Ga0068852_1001284482 | 247 |
| 114 | 3300005617 | Ga0068859_100000435 | Ga0068859_10000043531 | 247 |
| 115 | 3300005617 | Ga0068859_100298525 | Ga0068859_1002985252 | 247 |
| 116 | 3300005618 | Ga0068864_100000786 | Ga0068864_10000078622 | 247 |
| 117 | 3300005841 | Ga0068863_100001697 | Ga0068863_10000169721 | 247 |
| 118 | 3300005841 | Ga0068863_100014231 | Ga0068863_1000142318 | 247 |
| 119 | 3300005841 | Ga0068863_100172768 | Ga0068863_1001727682 | 247 |
| 120 | 3300005842 | Ga0068858_100021274 | Ga0068858_1000212745 | 247 |
| 121 | 3300005842 | Ga0068858_100578672 | Ga0068858_1005786722 | 247 |
| 122 | 3300005843 | Ga0068860_100000128 | Ga0068860_10000012813 | 247 |
| 123 | 3300005843 | Ga0068860_100731772 | Ga0068860_1007317721 | 247 |
| 124 | 3300005844 | Ga0068862_100001627 | Ga0068862_10000162715 | 247 |
| 125 | 3300005844 | Ga0068862_100005242 | Ga0068862_1000052424 | 247 |
| 126 | 3300006358 | Ga0068871_100414194 | Ga0068871_1004141941 | 247 |
| 127 | 3300006881 | Ga0068865_100005340 | Ga0068865_1000053403 | 247 |
| 128 | 3300006931 | Ga0097620_100000435 | Ga0097620_10000043531 | 247 |
| 129 | 3300006931 | Ga0097620_100298527 | Ga0097620_1002985272 | 247 |
| 130 | 3300009093 | Ga0105240_10066735 | Ga0105240_100667354 | 247 |
| 131 | 3300009093 | Ga0105240_10119671 | Ga0105240_101196714 | 247 |
| 132 | 3300009093 | Ga0105240_10571616 | Ga0105240_105716162 | 247 |
| 133 | 3300009101 | Ga0105247_10120849 | Ga0105247_101208492 | 247 |
| 134 | 3300009177 | Ga0105248_10007787 | Ga0105248_100077876 | 247 |
| 135 | 3300009177 | Ga0105248_10156746 | Ga0105248_101567462 | 247 |
| 136 | 3300009177 | Ga0105248_10332704 | Ga0105248_103327042 | 247 |
| 137 | 3300009551 | Ga0105238_10156107 | Ga0105238_101561072 | 247 |
| 138 | 3300009553 | Ga0105249_10010617 | Ga0105249_100106178 | 247 |
| 139 | 3300010375 | Ga0105239_10249639 | Ga0105239_102496392 | 247 |
| 140 | 3300010375 | Ga0105239_10290314 | Ga0105239_102903142 | 247 |
| 141 | 3300013100 | Ga0157373_10001429 | Ga0157373_100014292 | 247 |
| 142 | 3300013100 | Ga0157373_10008774 | Ga0157373_100087747 | 247 |
| 143 | 3300013104 | Ga0157370_10196112 | Ga0157370_101961123 | 247 |
| 144 | 3300013104 | Ga0157370_10300514 | Ga0157370_103005141 | 247 |
| 145 | 3300013104 | Ga0157370_10544606 | Ga0157370_105446061 | 247 |
| 146 | 3300013306 | Ga0163162_10027619 | Ga0163162_100276195 | 247 |
| 147 | 3300013306 | Ga0163162_10046155 | Ga0163162_100461553 | 247 |
| 148 | 3300014325 | Ga0163163_10014023 | Ga0163163_100140233 | 247 |
| 149 | 3300014325 | Ga0163163_10058081 | Ga0163163_100580812 | 247 |
| 150 | 3300014325 | Ga0163163_10075508 | Ga0163163_100755083 | 247 |
| 151 | 3300014968 | Ga0157379_10006808 | Ga0157379_1000680810 | 247 |
| 152 | 3300014968 | Ga0157379_10007276 | Ga0157379_100072763 | 247 |
| 153 | 3300021361 | Ga0213872_10015402 | Ga0213872_100154023 | 247 |
| 154 | 3300021384 | Ga0213876_10007130 | Ga0213876_100071303 | 247 |
| 155 | 3300021384 | Ga0213876_10120234 | Ga0213876_101202341 | 247 |
| 156 | 3300025297 | Ga0209758_1001665 | Ga0209758_10016654 | 247 |
| 157 | 3300025298 | Ga0209050_1000101 | Ga0209050_1000101223 | 247 |
| 158 | 3300025304 | Ga0209257_1000221 | Ga0209257_100022129 | 247 |
| 159 | 3300025900 | Ga0207710_10047865 | Ga0207710_100478652 | 247 |
| 160 | 3300025903 | Ga0207680_10013441 | Ga0207680_100134412 | 247 |
| 161 | 3300025903 | Ga0207680_10152461 | Ga0207680_101524612 | 247 |
| 162 | 3300025909 | Ga0207705_10232616 | Ga0207705_102326161 | 247 |
| 163 | 3300025909 | Ga0207705_10270835 | Ga0207705_102708352 | 247 |
| 164 | 3300025910 | Ga0207684_10048196 | Ga0207684_100481963 | 247 |
| 165 | 3300025913 | Ga0207695_10040013 | Ga0207695_100400135 | 247 |
| 166 | 3300025913 | Ga0207695_10056250 | Ga0207695_100562504 | 247 |
| 167 | 3300025913 | Ga0207695_10267226 | Ga0207695_102672262 | 247 |
| 168 | 3300025919 | Ga0207657_10054993 | Ga0207657_100549933 | 247 |
| 169 | 3300025921 | Ga0207652_10226356 | Ga0207652_102263562 | 247 |
| 170 | 3300025922 | Ga0207646_10371218 | Ga0207646_103712182 | 247 |
| 171 | 3300025923 | Ga0207681_10020979 | Ga0207681_100209792 | 247 |
| 172 | 3300025924 | Ga0207694_10127464 | Ga0207694_101274642 | 247 |
| 173 | 3300025925 | Ga0207650_10000062 | Ga0207650_1000006219 | 247 |
| 174 | 3300025925 | Ga0207650_10028294 | Ga0207650_100282943 | 247 |
| 175 | 3300025931 | Ga0207644_10002578 | Ga0207644_100025786 | 247 |
| 176 | 3300025932 | Ga0207690_10000129 | Ga0207690_1000012917 | 247 |
| 177 | 3300025933 | Ga0207706_10654579 | Ga0207706_106545791 | 247 |
| 178 | 3300025938 | Ga0207704_10000400 | Ga0207704_1000040019 | 247 |
| 179 | 3300025941 | Ga0207711_10192753 | Ga0207711_101927532 | 247 |
| 180 | 3300025945 | Ga0207679_10018430 | Ga0207679_100184303 | 247 |
| 181 | 3300025949 | Ga0207667_10039007 | Ga0207667_100390072 | 247 |
| 182 | 3300025949 | Ga0207667_10105523 | Ga0207667_101055232 | 247 |
| 183 | 3300025949 | Ga0207667_10136262 | Ga0207667_101362621 | 247 |
| 184 | 3300025949 | Ga0207667_10793450 | Ga0207667_107934501 | 247 |
| 185 | 3300025961 | Ga0207712_10001004 | Ga0207712_1000100419 | 247 |
| 186 | 3300025972 | Ga0207668_10000028 | Ga0207668_1000002869 | 247 |
| 187 | 3300025972 | Ga0207668_10000507 | Ga0207668_1000050717 | 247 |
| 188 | 3300025972 | Ga0207668_10001494 | Ga0207668_1000149410 | 247 |
| 189 | 3300025986 | Ga0207658_10000209 | Ga0207658_1000020950 | 247 |
| 190 | 3300025986 | Ga0207658_10005903 | Ga0207658_100059032 | 247 |
| 191 | 3300026035 | Ga0207703_10003741 | Ga0207703_100037414 | 247 |
| 192 | 3300026088 | Ga0207641_10000341 | Ga0207641_1000034115 | 247 |
| 193 | 3300026088 | Ga0207641_10240162 | Ga0207641_102401621 | 247 |
| 194 | 3300026095 | Ga0207676_10000797 | Ga0207676_1000079723 | 247 |
| 195 | 3300026142 | Ga0207698_10561179 | Ga0207698_105611792 | 247 |
| 196 | 3300028379 | Ga0268266_10000064 | Ga0268266_10000064181 | 247 |
| 197 | 3300028379 | Ga0268266_10000792 | Ga0268266_1000079231 | 247 |
| 198 | 3300028379 | Ga0268266_10001340 | Ga0268266_1000134023 | 247 |
| 199 | 3300028380 | Ga0268265_10002811 | Ga0268265_100028119 | 247 |
| 200 | 3300028380 | Ga0268265_10037939 | Ga0268265_100379393 | 247 |
| 201 | 3300028381 | Ga0268264_10000046 | Ga0268264_10000046143 | 247 |
| 202 | 3300028381 | Ga0268264_10000059 | Ga0268264_10000059239 | 247 |
| 203 | 3300028381 | Ga0268264_10091708 | Ga0268264_100917083 | 247 |
| 204 | 3300028381 | Ga0268264_10523274 | Ga0268264_105232741 | 247 |
| 205 | 3300028786 | Ga0307517_10063398 | Ga0307517_100633983 | 247 |
| 206 | 3300028800 | Ga0265338_10009139 | Ga0265338_100091398 | 247 |
| 207 | 3300031251 | Ga0265327_10000682 | Ga0265327_1000068255 | 247 |
| 208 | 3300031251 | Ga0265327_10034801 | Ga0265327_100348012 | 247 |
| 209 | 3300031456 | Ga0307513_10000448 | Ga0307513_1000044828 | 247 |
| 210 | 3300031727 | Ga0316576_10020795 | Ga0316576_100207953 | 247 |
| 211 | 3300031728 | Ga0316578_10250784 | Ga0316578_102507842 | 247 |
| 212 | 3300032004 | Ga0307414_10394014 | Ga0307414_103940142 | 247 |
| 213 | 3300033180 | Ga0307510_10078953 | Ga0307510_100789532 | 247 |
| 214 | 3300033541 | Ga0316596_1025108 | Ga0316596_10251082 | 247 |
| 215 | 3300036712 | Ga0316584_0129442 | Ga0316584_0129442_173_958 | 247 |
| 216 | 3300037466 | Ga0395898_0102107 | Ga0395898_0102107_933_1676 | 247 |
| 217 | 3300037471 | Ga0395905_0016382 | Ga0395905_0016382_4702_5445 | 247 |
| 218 | 3300037471 | Ga0395905_0393991 | Ga0395905_0393991_244_987 | 247 |
| 219 | 3300037853 | Ga0436364_1349678 | Ga0436364_1349678_202_951 | 247 |
| 220 | 3300038443 | Ga0395901_0033445 | Ga0395901_0033445_4005_4748 | 247 |
| 221 | 3300039437 | Ga0436365_0678918 | Ga0436365_0678918_4254_4997 | 247 |
| 222 | 3300039437 | Ga0436365_0787469 | Ga0436365_0787469_848_1606 | 247 |
| 223 | 3300039437 | Ga0436365_1465422 | Ga0436365_1465422_592_1341 | 247 |
| 224 | 3300039437 | Ga0436365_1655540 | Ga0436365_1655540_17474_18223 | 247 |
| 225 | 3300042533 | Ga0450901_004293 | Ga0450901_004293_493_1242 | 247 |
| 226 | 3300046460 | Ga0495638_0004783 | Ga0495638_0004783_5825_6586 | 247 |
| 227 | 3300046542 | Ga0495597_0001737 | Ga0495597_0001737_13520_14263 | 247 |
| 228 | 3300046558 | Ga0495633_0001548 | Ga0495633_0001548_12034_12786 | 247 |
| 229 | 3300046616 | Ga0495668_0044084 | Ga0495668_0044084_1048_1809 | 247 |
| 230 | 3300046684 | Ga0495669_0000199 | Ga0495669_0000199_33408_34151 | 247 |
| 231 | 3300046694 | Ga0495649_0000538 | Ga0495649_0000538_23787_24539 | 247 |
| 232 | 3300048906 | Ga0496103_0066355 | Ga0496103_0066355_1034_1777 | 247 |
| 233 | 3300048918 | Ga0496115_0003418 | Ga0496115_0003418_2122_2865 | 247 |
| 234 | 3300048926 | Ga0496123_0001713 | Ga0496123_0001713_8962_9714 | 247 |
| 235 | 3300048928 | Ga0496125_0002624 | Ga0496125_0002624_6794_7543 | 247 |
| 236 | 3300053087 | Ga0500643_005940 | Ga0500643_005940_1557_2300 | 247 |
| 237 | 3300053109 | Ga0500569_001981 | Ga0500569_001981_1460_2203 | 247 |
| 238 | 3300053162 | Ga0500638_157765 | Ga0500638_157765_51_803 | 247 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nvt-assembly2.cif.gz_B | crystal structure of triosephosphate isomerase from brucella melitensis | 0.9598 | 6 | 246 |
| 3kxq-assembly1.cif.gz_A | crystal structure of triosephosphate isomerase from bartonella henselae at 1.6a resolution | 0.9582 | 6 | 246 |
| 3kxq-assembly1.cif.gz_B | crystal structure of triosephosphate isomerase from bartonella henselae at 1.6a resolution | 0.9543 | 6 | 246 |
| 4y9a-assembly2.cif.gz_C | crystal structure of triosephosphate isomerase from streptomyces coelicolor | 0.9501 | 5 | 246 |
| 4nvt-assembly2.cif.gz_C | crystal structure of triosephosphate isomerase from brucella melitensis | 0.9497 | 6 | 246 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4nvtA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9738 | 6 | 246 | 3.20.20.70 |
| af_P0A858_1_255_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9544 | 4 | 246 | 3.20.20.70 |
| 3taoB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9489 | 3 | 246 | 3.20.20.70 |
| 4nvtA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9468 | 6 | 246 | 3.20.20.70 |
| 4g1kC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9372 | 4 | 246 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A435EAS4-F1-model_v4 | deleted | 0.9809 | 45 | 246 |
|
| AF-V4Q861-F1-model_v4 | Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) | 0.9805 | 4 | 246 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-A0A7T8Y0K9-F1-model_v4 | deleted | 0.9799 | 2 | 247 |
|
| AF-A0A3M2E7I9-F1-model_v4 | Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) | 0.9799 | 4 | 247 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-A0A0P1E0U1-F1-model_v4 | Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) | 0.9797 | 2 | 246 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar