F351302

General Info

Members Datasets Scaffolds Average Seq Length
238 149 234 245

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0000632|Ga0495672_0000632_13841_14659
Length 272
Sequence LAACLAGEIYAGTYAGTKEKIMAARRPLIAGNWKMYGRVADLAQISATFEAVGAGAKAVDIVFCLPAQLIALAAKDCPASALGGQXXAETAADAAQTGDISAAMLADVGAGYVIVGHSERRAKRRDDNESVRLKAEAALAAGLQPIICVGETAAERASGRAEAVVAGQVAASLPTAEGMVSVAYEPVWAIGGDRTPTLEEIAAIHRVVRQELAKRYGPAAEAVRVLYGGSVNPKNARDIFAVEGVDGALVGRASLKSADFAALIMSHPRVAV

Samples

Sample ID Description Type Environment
1 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
2 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
3 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
4 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
94 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
99 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
102 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
104 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
105 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
120 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
121 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
133 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
141 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
142 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
143 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
144 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
145 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
146 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
147 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
148 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
149 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 0.42
Isolates 1.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.66
Nodule 0
Rhizoplane 2.1
Rhizosphere 79.41
Stem 0
Stem Tuber 0
Unclassified 8.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055530_10000685 3300003791 Bacteria 28722
2 Ga0055531_10004322 3300003794 Bacteria 8702
3 Ga0070670_100000037 3300005331 Bacteria 156070
4 Ga0070670_100040335 3300005331 Bacteria 4015
5 Ga0070666_10230375 3300005335 Bacteria 1308
6 Ga0070680_100025744 3300005336 Bacteria 4703
7 Ga0070660_100347043 3300005339 Bacteria 1222
8 Ga0070691_10011443 3300005341 Bacteria 4052
9 Ga0070668_100000097 3300005347 Bacteria 53800
10 Ga0070668_100018957 3300005347 Bacteria 5170
11 Ga0070669_100007690 3300005353 Bacteria 7706
12 Ga0070671_100000342 3300005355 Bacteria 32006
13 Ga0070671_100131586 3300005355 Bacteria 2107
14 Ga0070659_100000206 3300005366 Bacteria 45867
15 Ga0070659_100013775 3300005366 Bacteria 6031
16 Ga0070667_100000083 3300005367 Bacteria 118261
17 Ga0070667_100015622 3300005367 Bacteria 6277
18 Ga0070667_100286697 3300005367 Bacteria 1480
19 Ga0070681_10017736 3300005458 Bacteria 7114
20 Ga0070706_100260560 3300005467 Bacteria 1618
21 Ga0070706_100280043 3300005467 Bacteria 1556
22 Ga0070707_100406537 3300005468 Unclassified 1321
23 Ga0070698_100004235 3300005471 Bacteria 15769
24 Ga0070679_100003462 3300005530 Bacteria 14454
25 Ga0070697_100064937 3300005536 Bacteria 2981
26 Ga0068853_100074102 3300005539 Bacteria 2970
27 Ga0068853_100517171 3300005539 Bacteria 1128
28 Ga0070665_100000116 3300005548 Bacteria 150141
29 Ga0070665_100000278 3300005548 Bacteria 84248
30 Ga0070665_100000483 3300005548 Bacteria 57237
31 Ga0070665_100129119 3300005548 Bacteria 2530
32 Ga0070665_100258217 3300005548 Bacteria 1743
33 Ga0068855_100048334 3300005563 Bacteria 5021
34 Ga0068855_100051066 3300005563 Bacteria 4871
35 Ga0068855_100220141 3300005563 Bacteria 2129
36 Ga0068855_100266855 3300005563 Bacteria 1905
37 Ga0070664_100025727 3300005564 Bacteria 4880
38 Ga0068852_100120426 3300005616 Bacteria 2401
39 Ga0068852_100128448 3300005616 Bacteria 2331
40 Ga0068859_100000435 3300005617 Bacteria 41931
41 Ga0068859_100298525 3300005617 Bacteria 1704
42 Ga0068859_100317741 3300005617 Bacteria 1651
43 Ga0068864_100000786 3300005618 Bacteria 26635
44 Ga0068863_100001697 3300005841 Bacteria 21819
45 Ga0068863_100014231 3300005841 Bacteria 7665
46 Ga0068863_100172768 3300005841 Bacteria 2073
47 Ga0068858_100021274 3300005842 Bacteria 6059
48 Ga0068858_100578672 3300005842 Bacteria 1088
49 Ga0068860_100000128 3300005843 Bacteria 122731
50 Ga0068860_100731772 3300005843 Bacteria 1000
51 Ga0068862_100001627 3300005844 Bacteria 20442
52 Ga0068862_100005242 3300005844 Bacteria 10873
53 Ga0068862_100007701 3300005844 Bacteria 8910
54 Ga0070717_10352215 3300006028 Bacteria 1316
55 Ga0075364_10000306 3300006051 Bacteria 23963
56 Ga0070716_100144120 3300006173 Bacteria 1523
57 Ga0075367_10015158 3300006178 Bacteria 4183
58 Ga0075369_10021117 3300006186 Bacteria 2672
59 Ga0075370_10019459 3300006353 Bacteria 3698
60 Ga0068871_100414194 3300006358 Bacteria 1202
61 Ga0068865_100005340 3300006881 Bacteria 7781
62 Ga0097620_100000435 3300006931 Bacteria 41931
63 Ga0097620_100298527 3300006931 Bacteria 1704
64 Ga0097620_100317746 3300006931 Bacteria 1651
65 Ga0105240_10066735 3300009093 Bacteria 4462
66 Ga0105240_10119671 3300009093 Bacteria 3172
67 Ga0105240_10571616 3300009093 Bacteria 1248
68 Ga0105247_10120849 3300009101 Bacteria 1697
69 Ga0105248_10007787 3300009177 Bacteria 11756
70 Ga0105248_10156746 3300009177 Bacteria 2569
71 Ga0105248_10332704 3300009177 Bacteria 1710
72 Ga0105238_10156107 3300009551 Bacteria 2257
73 Ga0105249_10010617 3300009553 Bacteria 8090
74 Ga0105239_10249639 3300010375 Bacteria 1993
75 Ga0105239_10290314 3300010375 Bacteria 1842
76 Ga0157373_10001429 3300013100 Bacteria 18213
77 Ga0157373_10008774 3300013100 Bacteria 7490
78 Ga0157370_10079389 3300013104 Bacteria 3090
79 Ga0157370_10196112 3300013104 Bacteria 1874
80 Ga0157370_10300514 3300013104 Bacteria 1482
81 Ga0157370_10544606 3300013104 Bacteria 1064
82 Ga0157369_10071812 3300013105 Bacteria 3715
83 Ga0163162_10027619 3300013306 Bacteria 5613
84 Ga0163162_10046155 3300013306 Bacteria 4367
85 Ga0163163_10014023 3300014325 Bacteria 7354
86 Ga0163163_10058081 3300014325 Bacteria 3825
87 Ga0163163_10075508 3300014325 Bacteria 3364
88 Ga0157379_10006808 3300014968 Bacteria 9879
89 Ga0157379_10007276 3300014968 Bacteria 9581
90 Ga0213872_10015402 3300021361 Bacteria 3558
91 Ga0213876_10000320 3300021384 Bacteria 42027
92 Ga0213876_10007130 3300021384 Bacteria 6091
93 Ga0213876_10120234 3300021384 Bacteria 1394
94 Ga0213875_10093728 3300021388 Bacteria 1400
95 Ga0213875_10207252 3300021388 Bacteria 923
96 Ga0209758_1001665 3300025297 Bacteria 25124
97 Ga0209050_1000101 3300025298 Bacteria 230076
98 Ga0209257_1000221 3300025304 Bacteria 134870
99 Ga0209257_1002453 3300025304 Bacteria 18398
100 Ga0207710_10047865 3300025900 Bacteria 1912
101 Ga0207680_10013441 3300025903 Bacteria 4205
102 Ga0207680_10152461 3300025903 Bacteria 1542
103 Ga0207705_10232616 3300025909 Bacteria 1402
104 Ga0207705_10270835 3300025909 Bacteria 1298
105 Ga0207684_10048196 3300025910 Bacteria 3613
106 Ga0207707_10013828 3300025912 Bacteria 7038
107 Ga0207695_10001229 3300025913 Bacteria 43850
108 Ga0207695_10040013 3300025913 Bacteria 5033
109 Ga0207695_10056250 3300025913 Bacteria 4095
110 Ga0207695_10267226 3300025913 Bacteria 1607
111 Ga0207657_10054993 3300025919 Bacteria 3439
112 Ga0207652_10165766 3300025921 Bacteria 1981
113 Ga0207652_10226356 3300025921 Bacteria 1685
114 Ga0207646_10371218 3300025922 Bacteria 1292
115 Ga0207681_10020979 3300025923 Bacteria 4147
116 Ga0207694_10127464 3300025924 Bacteria 2037
117 Ga0207650_10000062 3300025925 Bacteria 149776
118 Ga0207650_10028294 3300025925 Bacteria 4017
119 Ga0207644_10002578 3300025931 Bacteria 11664
120 Ga0207690_10000129 3300025932 Bacteria 62350
121 Ga0207706_10654579 3300025933 Bacteria 899
122 Ga0207704_10000400 3300025938 Bacteria 19733
123 Ga0207665_10035907 3300025939 Unclassified 3293
124 Ga0207711_10192753 3300025941 Bacteria 1858
125 Ga0207679_10018430 3300025945 Bacteria 4677
126 Ga0207667_10039007 3300025949 Bacteria 5065
127 Ga0207667_10105523 3300025949 Bacteria 2907
128 Ga0207667_10136262 3300025949 Bacteria 2528
129 Ga0207667_10177018 3300025949 Bacteria 2191
130 Ga0207667_10793450 3300025949 Bacteria 944
131 Ga0207712_10001004 3300025961 Bacteria 20092
132 Ga0207668_10000028 3300025972 Bacteria 125361
133 Ga0207668_10000507 3300025972 Bacteria 24393
134 Ga0207668_10001494 3300025972 Bacteria 13660
135 Ga0207658_10000209 3300025986 Bacteria 61041
136 Ga0207658_10005903 3300025986 Bacteria 8364
137 Ga0207658_10372792 3300025986 Bacteria 1248
138 Ga0207703_10003741 3300026035 Bacteria 12658
139 Ga0207639_10033221 3300026041 Bacteria 3804
140 Ga0207641_10000341 3300026088 Bacteria 56155
141 Ga0207641_10240162 3300026088 Bacteria 1688
142 Ga0207676_10000797 3300026095 Bacteria 24574
143 Ga0207698_10561179 3300026142 Bacteria 1121
144 Ga0209813_10002036 3300027866 Bacteria 4586
145 Ga0268266_10000064 3300028379 Bacteria 249533
146 Ga0268266_10000792 3300028379 Bacteria 42146
147 Ga0268266_10001340 3300028379 Bacteria 29786
148 Ga0268265_10002811 3300028380 Bacteria 12812
149 Ga0268265_10004003 3300028380 Bacteria 10375
150 Ga0268265_10037939 3300028380 Bacteria 3540
151 Ga0268264_10000046 3300028381 Bacteria 364597
152 Ga0268264_10000059 3300028381 Bacteria 306927
153 Ga0268264_10091708 3300028381 Bacteria 2621
154 Ga0268264_10523274 3300028381 Bacteria 1160
155 Ga0265334_10010379 3300028573 Bacteria 3935
156 Ga0307517_10063398 3300028786 Bacteria 3457
157 Ga0265338_10009139 3300028800 Bacteria 11899
158 Ga0265338_10019638 3300028800 Bacteria 7153
159 Ga0265327_10000682 3300031251 Bacteria 54560
160 Ga0265327_10034801 3300031251 Bacteria 2791
161 Ga0307513_10000448 3300031456 Bacteria 59427
162 Ga0316576_10020795 3300031727 Bacteria 4527
163 Ga0316576_10043412 3300031727 Bacteria 3244
164 Ga0316576_10063715 3300031727 Bacteria 2706
165 Ga0316578_10049680 3300031728 Bacteria 2452
166 Ga0316578_10250784 3300031728 Bacteria 1062
167 Ga0307414_10033024 3300032004 Bacteria 3415
168 Ga0307414_10394014 3300032004 Bacteria 1201
169 Ga0307510_10078953 3300033180 Bacteria 3214
170 Ga0316596_1025108 3300033541 Bacteria 1532
171 Ga0373960_0031795 3300035121 Bacteria 1478
172 Ga0316574_0008955 3300035398 Bacteria 5589
173 Ga0316574_0014936 3300035398 Bacteria 4499
174 Ga0316574_0034825 3300035398 Bacteria 3073
175 Ga0316582_0242480 3300036647 Bacteria 1235
176 Ga0316584_0011355 3300036712 Bacteria 6256
177 Ga0316584_0109343 3300036712 Bacteria 2069
178 Ga0316584_0129442 3300036712 Bacteria 1885
179 Ga0395899_0023296 3300037312 Bacteria 4693
180 Ga0395900_0122448 3300037418 Bacteria 2668
181 Ga0395898_0102107 3300037466 Bacteria 2753
182 Ga0395905_0016382 3300037471 Bacteria 7042
183 Ga0395905_0393991 3300037471 Bacteria 1279
184 Ga0436364_0369116 3300037853 Bacteria 954
185 Ga0436364_1349678 3300037853 Bacteria 1329
186 Ga0395901_0016144 3300038443 Bacteria 7606
187 Ga0395901_0033445 3300038443 Bacteria 5309
188 Ga0436365_0629243 3300039437 Bacteria 13018
189 Ga0436365_0678918 3300039437 Bacteria 6672
190 Ga0436365_0787469 3300039437 Bacteria 3493
191 Ga0436365_1225891 3300039437 Bacteria 1954
192 Ga0436365_1465422 3300039437 Bacteria 1634
193 Ga0436365_1655540 3300039437 Bacteria 20314
194 Ga0436361_0686811 3300039447 Bacteria 1838
195 Ga0436361_1173302 3300039447 Bacteria 1453
196 Ga0436363_0577559 3300039450 Bacteria 1670
197 Ga0450901_004293 3300042533 Bacteria 1476
198 Ga0466964_0166334 3300044706 Bacteria 1035
199 Ga0495638_0004783 3300046460 Bacteria 10208
200 Ga0495642_0020031 3300046528 Bacteria 2624
201 Ga0495597_0001737 3300046542 Bacteria 15014
202 Ga0495633_0001548 3300046558 Bacteria 17646
203 Ga0495668_0044084 3300046616 Bacteria 2479
204 Ga0495625_0149041 3300046660 Bacteria 1574
205 Ga0495625_0262319 3300046660 Bacteria 1117
206 Ga0495669_0000024 3300046684 Bacteria 113943
207 Ga0495669_0000199 3300046684 Bacteria 36829
208 Ga0495649_0000538 3300046694 Bacteria 32158
209 Ga0495672_0000632 3300047320 Bacteria 39290
210 Ga0495677_0047312 3300047445 Bacteria 1579
211 Ga0495677_0072970 3300047445 Bacteria 1280
212 Ga0496103_0066355 3300048906 Bacteria 2252
213 Ga0496106_0277296 3300048909 Bacteria 1343
214 Ga0496107_0174991 3300048910 Bacteria 1593
215 Ga0496115_0003418 3300048918 Bacteria 11405
216 Ga0496115_0101515 3300048918 Bacteria 2359
217 Ga0496123_0001713 3300048926 Bacteria 29280
218 Ga0496125_0002624 3300048928 Bacteria 23043
219 Ga0501032_0114368 3300049569 Bacteria 1785
220 Ga0501033_0055218 3300049570 Bacteria 2937
221 Ga0501070_0200914 3300049586 Bacteria 1637
222 Ga0501044_0218134 3300049823 Bacteria 1859
223 nmdc:mga00v17_423_c1 3300050491 Bacteria 23976
224 nmdc:mga06z11_15466_c1 3300050494 Bacteria 3407
225 nmdc:mga04h51_1841_c1 3300050495 Bacteria 4961
226 nmdc:mga07m45_1047_c1 3300050496 Bacteria 12323
227 Ga0500643_005940 3300053087 Bacteria 5178
228 Ga0500647_0001478 3300053091 Bacteria 8090
229 Ga0500641_0000513 3300053096 Bacteria 13949
230 Ga0500569_001981 3300053109 Bacteria 3969
231 Ga0500559_0000077 3300053136 Bacteria 76287
232 Ga0500577_0009592 3300053142 Bacteria 2816
233 Ga0500638_157765 3300053162 Bacteria 1002
234 Ga0500636_0012949 3300053177 Bacteria 4894

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_10071812 Ga0157369_100718122 213
2 3300006051 Ga0075364_10000306 Ga0075364_100003066 217
3 3300006178 Ga0075367_10015158 Ga0075367_100151584 217
4 3300006186 Ga0075369_10021117 Ga0075369_100211172 217
5 3300027866 Ga0209813_10002036 Ga0209813_100020362 217
6 3300035398 Ga0316574_0034825 Ga0316574_0034825_27_686 217
7 3300050491 nmdc:mga00v17_423_c1 nmdc:mga00v17_423_c1_5012_5755 217
8 3300050494 nmdc:mga06z11_15466_c1 nmdc:mga06z11_15466_c1_538_1281 217
9 3300050495 nmdc:mga04h51_1841_c1 nmdc:mga04h51_1841_c1_1975_2718 217
10 3300050496 nmdc:mga07m45_1047_c1 nmdc:mga07m45_1047_c1_1574_2317 217
11 3300005467 Ga0070706_100280043 Ga0070706_1002800432 223
12 3300005468 Ga0070707_100406537 Ga0070707_1004065372 223
13 3300005536 Ga0070697_100064937 Ga0070697_1000649372 223
14 3300039447 Ga0436361_1173302 Ga0436361_1173302_736_1440 223
15 3300006353 Ga0075370_10019459 Ga0075370_100194595 225
16 3300035121 Ga0373960_0031795 Ga0373960_0031795_704_1459 226
17 3300025304 Ga0209257_1002453 Ga0209257_10024532 227
18 3300037853 Ga0436364_0369116 Ga0436364_0369116_230_937 233
19 3300053142 Ga0500577_0009592 Ga0500577_0009592_400_1110 233
20 3300005341 Ga0070691_10011443 Ga0070691_100114435 234
21 3300005458 Ga0070681_10017736 Ga0070681_100177366 234
22 3300005530 Ga0070679_100003462 Ga0070679_10000346218 234
23 3300005563 Ga0068855_100051066 Ga0068855_1000510662 234
24 3300013104 Ga0157370_10079389 Ga0157370_100793892 234
25 3300021384 Ga0213876_10000320 Ga0213876_1000032042 234
26 3300021388 Ga0213875_10207252 Ga0213875_102072521 234
27 3300025912 Ga0207707_10013828 Ga0207707_100138283 234
28 3300025913 Ga0207695_10001229 Ga0207695_1000122939 234
29 3300025921 Ga0207652_10165766 Ga0207652_101657662 234
30 3300025949 Ga0207667_10177018 Ga0207667_101770182 234
31 3300037312 Ga0395899_0023296 Ga0395899_0023296_1259_1972 234
32 3300037418 Ga0395900_0122448 Ga0395900_0122448_263_976 234
33 3300038443 Ga0395901_0016144 Ga0395901_0016144_874_1587 234
34 3300039450 Ga0436363_0577559 Ga0436363_0577559_938_1648 234
35 3300046528 Ga0495642_0020031 Ga0495642_0020031_1505_2209 234
36 3300046660 Ga0495625_0149041 Ga0495625_0149041_140_844 234
37 3300046684 Ga0495669_0000024 Ga0495669_0000024_65891_66595 234
38 3300047445 Ga0495677_0047312 Ga0495677_0047312_859_1563 234
39 3300047445 Ga0495677_0072970 Ga0495677_0072970_130_834 234
40 3300048909 Ga0496106_0277296 Ga0496106_0277296_250_963 234
41 3300048910 Ga0496107_0174991 Ga0496107_0174991_848_1561 234
42 3300048918 Ga0496115_0101515 Ga0496115_0101515_1277_1990 234
43 3300005367 Ga0070667_100286697 Ga0070667_1002866972 235
44 3300005617 Ga0068859_100317741 Ga0068859_1003177412 235
45 3300005844 Ga0068862_100007701 Ga0068862_10000770111 235
46 3300006931 Ga0097620_100317746 Ga0097620_1003177462 235
47 3300025986 Ga0207658_10372792 Ga0207658_103727921 235
48 3300028380 Ga0268265_10004003 Ga0268265_100040033 235
49 3300046660 Ga0495625_0262319 Ga0495625_0262319_68_829 235
50 3300044706 Ga0466964_0166334 Ga0466964_0166334_68_811 239
51 3300053177 Ga0500636_0012949 Ga0500636_0012949_4094_4846 240
52 3300053136 Ga0500559_0000077 Ga0500559_0000077_68545_69279 241
53 iso_pu_bacteria 2739367756 2739791365 241
54 3300047320 Ga0495672_0000632 Ga0495672_0000632_13841_14659 243
55 3300053091 Ga0500647_0001478 Ga0500647_0001478_5979_6719 243
56 iso_pu_bacteria 2928972540 2928975081 243
57 iso_pu_bacteria 2941485952 2941488495 243
58 iso_pu_bacteria 2977240413 2977241926 243
59 3300005355 Ga0070671_100131586 Ga0070671_1001315862 244
60 3300021388 Ga0213875_10093728 Ga0213875_100937281 244
61 3300039437 Ga0436365_1225891 Ga0436365_1225891_1028_1768 244
62 3300049569 Ga0501032_0114368 Ga0501032_0114368_75_821 244
63 3300049570 Ga0501033_0055218 Ga0501033_0055218_1140_1886 244
64 3300049586 Ga0501070_0200914 Ga0501070_0200914_796_1542 244
65 3300049823 Ga0501044_0218134 Ga0501044_0218134_399_1145 244
66 3300005471 Ga0070698_100004235 Ga0070698_1000042352 245
67 3300005539 Ga0068853_100517171 Ga0068853_1005171711 245
68 3300006028 Ga0070717_10352215 Ga0070717_103522152 245
69 3300006173 Ga0070716_100144120 Ga0070716_1001441202 245
70 3300025939 Ga0207665_10035907 Ga0207665_100359073 245
71 3300026041 Ga0207639_10033221 Ga0207639_100332214 245
72 3300031727 Ga0316576_10043412 Ga0316576_100434122 245
73 3300031727 Ga0316576_10063715 Ga0316576_100637152 245
74 3300031728 Ga0316578_10049680 Ga0316578_100496803 245
75 3300035398 Ga0316574_0008955 Ga0316574_0008955_4428_5177 245
76 3300035398 Ga0316574_0014936 Ga0316574_0014936_1312_2058 245
77 3300036647 Ga0316582_0242480 Ga0316582_0242480_49_795 245
78 3300036712 Ga0316584_0011355 Ga0316584_0011355_4616_5365 245
79 3300036712 Ga0316584_0109343 Ga0316584_0109343_193_942 245
80 3300039437 Ga0436365_0629243 Ga0436365_0629243_5361_6134 245
81 3300039447 Ga0436361_0686811 Ga0436361_0686811_82_852 245
82 3300053096 Ga0500641_0000513 Ga0500641_0000513_5052_5795 245
83 3300028573 Ga0265334_10010379 Ga0265334_100103792 246
84 3300028800 Ga0265338_10019638 Ga0265338_100196387 246
85 3300032004 Ga0307414_10033024 Ga0307414_100330242 246
86 3300003791 Ga0055530_10000685 Ga0055530_1000068529 247
87 3300003794 Ga0055531_10004322 Ga0055531_100043223 247
88 3300005331 Ga0070670_100000037 Ga0070670_10000003771 247
89 3300005331 Ga0070670_100040335 Ga0070670_1000403352 247
90 3300005335 Ga0070666_10230375 Ga0070666_102303751 247
91 3300005336 Ga0070680_100025744 Ga0070680_1000257442 247
92 3300005339 Ga0070660_100347043 Ga0070660_1003470431 247
93 3300005347 Ga0070668_100000097 Ga0070668_10000009748 247
94 3300005347 Ga0070668_100018957 Ga0070668_1000189573 247
95 3300005353 Ga0070669_100007690 Ga0070669_1000076908 247
96 3300005355 Ga0070671_100000342 Ga0070671_10000034232 247
97 3300005366 Ga0070659_100000206 Ga0070659_10000020649 247
98 3300005366 Ga0070659_100013775 Ga0070659_1000137752 247
99 3300005367 Ga0070667_100000083 Ga0070667_10000008371 247
100 3300005367 Ga0070667_100015622 Ga0070667_1000156221 247
101 3300005467 Ga0070706_100260560 Ga0070706_1002605602 247
102 3300005539 Ga0068853_100074102 Ga0068853_1000741022 247
103 3300005548 Ga0070665_100000116 Ga0070665_10000011675 247
104 3300005548 Ga0070665_100000278 Ga0070665_1000002789 247
105 3300005548 Ga0070665_100000483 Ga0070665_10000048323 247
106 3300005548 Ga0070665_100129119 Ga0070665_1001291192 247
107 3300005548 Ga0070665_100258217 Ga0070665_1002582172 247
108 3300005563 Ga0068855_100048334 Ga0068855_1000483343 247
109 3300005563 Ga0068855_100220141 Ga0068855_1002201412 247
110 3300005563 Ga0068855_100266855 Ga0068855_1002668552 247
111 3300005564 Ga0070664_100025727 Ga0070664_1000257273 247
112 3300005616 Ga0068852_100120426 Ga0068852_1001204262 247
113 3300005616 Ga0068852_100128448 Ga0068852_1001284482 247
114 3300005617 Ga0068859_100000435 Ga0068859_10000043531 247
115 3300005617 Ga0068859_100298525 Ga0068859_1002985252 247
116 3300005618 Ga0068864_100000786 Ga0068864_10000078622 247
117 3300005841 Ga0068863_100001697 Ga0068863_10000169721 247
118 3300005841 Ga0068863_100014231 Ga0068863_1000142318 247
119 3300005841 Ga0068863_100172768 Ga0068863_1001727682 247
120 3300005842 Ga0068858_100021274 Ga0068858_1000212745 247
121 3300005842 Ga0068858_100578672 Ga0068858_1005786722 247
122 3300005843 Ga0068860_100000128 Ga0068860_10000012813 247
123 3300005843 Ga0068860_100731772 Ga0068860_1007317721 247
124 3300005844 Ga0068862_100001627 Ga0068862_10000162715 247
125 3300005844 Ga0068862_100005242 Ga0068862_1000052424 247
126 3300006358 Ga0068871_100414194 Ga0068871_1004141941 247
127 3300006881 Ga0068865_100005340 Ga0068865_1000053403 247
128 3300006931 Ga0097620_100000435 Ga0097620_10000043531 247
129 3300006931 Ga0097620_100298527 Ga0097620_1002985272 247
130 3300009093 Ga0105240_10066735 Ga0105240_100667354 247
131 3300009093 Ga0105240_10119671 Ga0105240_101196714 247
132 3300009093 Ga0105240_10571616 Ga0105240_105716162 247
133 3300009101 Ga0105247_10120849 Ga0105247_101208492 247
134 3300009177 Ga0105248_10007787 Ga0105248_100077876 247
135 3300009177 Ga0105248_10156746 Ga0105248_101567462 247
136 3300009177 Ga0105248_10332704 Ga0105248_103327042 247
137 3300009551 Ga0105238_10156107 Ga0105238_101561072 247
138 3300009553 Ga0105249_10010617 Ga0105249_100106178 247
139 3300010375 Ga0105239_10249639 Ga0105239_102496392 247
140 3300010375 Ga0105239_10290314 Ga0105239_102903142 247
141 3300013100 Ga0157373_10001429 Ga0157373_100014292 247
142 3300013100 Ga0157373_10008774 Ga0157373_100087747 247
143 3300013104 Ga0157370_10196112 Ga0157370_101961123 247
144 3300013104 Ga0157370_10300514 Ga0157370_103005141 247
145 3300013104 Ga0157370_10544606 Ga0157370_105446061 247
146 3300013306 Ga0163162_10027619 Ga0163162_100276195 247
147 3300013306 Ga0163162_10046155 Ga0163162_100461553 247
148 3300014325 Ga0163163_10014023 Ga0163163_100140233 247
149 3300014325 Ga0163163_10058081 Ga0163163_100580812 247
150 3300014325 Ga0163163_10075508 Ga0163163_100755083 247
151 3300014968 Ga0157379_10006808 Ga0157379_1000680810 247
152 3300014968 Ga0157379_10007276 Ga0157379_100072763 247
153 3300021361 Ga0213872_10015402 Ga0213872_100154023 247
154 3300021384 Ga0213876_10007130 Ga0213876_100071303 247
155 3300021384 Ga0213876_10120234 Ga0213876_101202341 247
156 3300025297 Ga0209758_1001665 Ga0209758_10016654 247
157 3300025298 Ga0209050_1000101 Ga0209050_1000101223 247
158 3300025304 Ga0209257_1000221 Ga0209257_100022129 247
159 3300025900 Ga0207710_10047865 Ga0207710_100478652 247
160 3300025903 Ga0207680_10013441 Ga0207680_100134412 247
161 3300025903 Ga0207680_10152461 Ga0207680_101524612 247
162 3300025909 Ga0207705_10232616 Ga0207705_102326161 247
163 3300025909 Ga0207705_10270835 Ga0207705_102708352 247
164 3300025910 Ga0207684_10048196 Ga0207684_100481963 247
165 3300025913 Ga0207695_10040013 Ga0207695_100400135 247
166 3300025913 Ga0207695_10056250 Ga0207695_100562504 247
167 3300025913 Ga0207695_10267226 Ga0207695_102672262 247
168 3300025919 Ga0207657_10054993 Ga0207657_100549933 247
169 3300025921 Ga0207652_10226356 Ga0207652_102263562 247
170 3300025922 Ga0207646_10371218 Ga0207646_103712182 247
171 3300025923 Ga0207681_10020979 Ga0207681_100209792 247
172 3300025924 Ga0207694_10127464 Ga0207694_101274642 247
173 3300025925 Ga0207650_10000062 Ga0207650_1000006219 247
174 3300025925 Ga0207650_10028294 Ga0207650_100282943 247
175 3300025931 Ga0207644_10002578 Ga0207644_100025786 247
176 3300025932 Ga0207690_10000129 Ga0207690_1000012917 247
177 3300025933 Ga0207706_10654579 Ga0207706_106545791 247
178 3300025938 Ga0207704_10000400 Ga0207704_1000040019 247
179 3300025941 Ga0207711_10192753 Ga0207711_101927532 247
180 3300025945 Ga0207679_10018430 Ga0207679_100184303 247
181 3300025949 Ga0207667_10039007 Ga0207667_100390072 247
182 3300025949 Ga0207667_10105523 Ga0207667_101055232 247
183 3300025949 Ga0207667_10136262 Ga0207667_101362621 247
184 3300025949 Ga0207667_10793450 Ga0207667_107934501 247
185 3300025961 Ga0207712_10001004 Ga0207712_1000100419 247
186 3300025972 Ga0207668_10000028 Ga0207668_1000002869 247
187 3300025972 Ga0207668_10000507 Ga0207668_1000050717 247
188 3300025972 Ga0207668_10001494 Ga0207668_1000149410 247
189 3300025986 Ga0207658_10000209 Ga0207658_1000020950 247
190 3300025986 Ga0207658_10005903 Ga0207658_100059032 247
191 3300026035 Ga0207703_10003741 Ga0207703_100037414 247
192 3300026088 Ga0207641_10000341 Ga0207641_1000034115 247
193 3300026088 Ga0207641_10240162 Ga0207641_102401621 247
194 3300026095 Ga0207676_10000797 Ga0207676_1000079723 247
195 3300026142 Ga0207698_10561179 Ga0207698_105611792 247
196 3300028379 Ga0268266_10000064 Ga0268266_10000064181 247
197 3300028379 Ga0268266_10000792 Ga0268266_1000079231 247
198 3300028379 Ga0268266_10001340 Ga0268266_1000134023 247
199 3300028380 Ga0268265_10002811 Ga0268265_100028119 247
200 3300028380 Ga0268265_10037939 Ga0268265_100379393 247
201 3300028381 Ga0268264_10000046 Ga0268264_10000046143 247
202 3300028381 Ga0268264_10000059 Ga0268264_10000059239 247
203 3300028381 Ga0268264_10091708 Ga0268264_100917083 247
204 3300028381 Ga0268264_10523274 Ga0268264_105232741 247
205 3300028786 Ga0307517_10063398 Ga0307517_100633983 247
206 3300028800 Ga0265338_10009139 Ga0265338_100091398 247
207 3300031251 Ga0265327_10000682 Ga0265327_1000068255 247
208 3300031251 Ga0265327_10034801 Ga0265327_100348012 247
209 3300031456 Ga0307513_10000448 Ga0307513_1000044828 247
210 3300031727 Ga0316576_10020795 Ga0316576_100207953 247
211 3300031728 Ga0316578_10250784 Ga0316578_102507842 247
212 3300032004 Ga0307414_10394014 Ga0307414_103940142 247
213 3300033180 Ga0307510_10078953 Ga0307510_100789532 247
214 3300033541 Ga0316596_1025108 Ga0316596_10251082 247
215 3300036712 Ga0316584_0129442 Ga0316584_0129442_173_958 247
216 3300037466 Ga0395898_0102107 Ga0395898_0102107_933_1676 247
217 3300037471 Ga0395905_0016382 Ga0395905_0016382_4702_5445 247
218 3300037471 Ga0395905_0393991 Ga0395905_0393991_244_987 247
219 3300037853 Ga0436364_1349678 Ga0436364_1349678_202_951 247
220 3300038443 Ga0395901_0033445 Ga0395901_0033445_4005_4748 247
221 3300039437 Ga0436365_0678918 Ga0436365_0678918_4254_4997 247
222 3300039437 Ga0436365_0787469 Ga0436365_0787469_848_1606 247
223 3300039437 Ga0436365_1465422 Ga0436365_1465422_592_1341 247
224 3300039437 Ga0436365_1655540 Ga0436365_1655540_17474_18223 247
225 3300042533 Ga0450901_004293 Ga0450901_004293_493_1242 247
226 3300046460 Ga0495638_0004783 Ga0495638_0004783_5825_6586 247
227 3300046542 Ga0495597_0001737 Ga0495597_0001737_13520_14263 247
228 3300046558 Ga0495633_0001548 Ga0495633_0001548_12034_12786 247
229 3300046616 Ga0495668_0044084 Ga0495668_0044084_1048_1809 247
230 3300046684 Ga0495669_0000199 Ga0495669_0000199_33408_34151 247
231 3300046694 Ga0495649_0000538 Ga0495649_0000538_23787_24539 247
232 3300048906 Ga0496103_0066355 Ga0496103_0066355_1034_1777 247
233 3300048918 Ga0496115_0003418 Ga0496115_0003418_2122_2865 247
234 3300048926 Ga0496123_0001713 Ga0496123_0001713_8962_9714 247
235 3300048928 Ga0496125_0002624 Ga0496125_0002624_6794_7543 247
236 3300053087 Ga0500643_005940 Ga0500643_005940_1557_2300 247
237 3300053109 Ga0500569_001981 Ga0500569_001981_1460_2203 247
238 3300053162 Ga0500638_157765 Ga0500638_157765_51_803 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

27

267

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nvt-assembly2.cif.gz_B crystal structure of triosephosphate isomerase from brucella melitensis 0.9598 6 246
3kxq-assembly1.cif.gz_A crystal structure of triosephosphate isomerase from bartonella henselae at 1.6a resolution 0.9582 6 246
3kxq-assembly1.cif.gz_B crystal structure of triosephosphate isomerase from bartonella henselae at 1.6a resolution 0.9543 6 246
4y9a-assembly2.cif.gz_C crystal structure of triosephosphate isomerase from streptomyces coelicolor 0.9501 5 246
4nvt-assembly2.cif.gz_C crystal structure of triosephosphate isomerase from brucella melitensis 0.9497 6 246
ID Description Score Start End Superfamily
4nvtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9738 6 246 3.20.20.70
af_P0A858_1_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9544 4 246 3.20.20.70
3taoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9489 3 246 3.20.20.70
4nvtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9468 6 246 3.20.20.70
4g1kC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9372 4 246 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A435EAS4-F1-model_v4 deleted 0.9809 45 246
AF-V4Q861-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9805 4 246 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A7T8Y0K9-F1-model_v4 deleted 0.9799 2 247
AF-A0A3M2E7I9-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9799 4 247 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A0P1E0U1-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9797 2 246 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166

Feature Viewer

pLDDT pTM Quality
94.12 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map