F351224

General Info

Members Datasets Scaffolds Average Seq Length
238 137 476 141

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_1044512|Ga0451576_1044512_110_604
Length 164
Sequence MNKDNLDPQKLARAQSAFAGVPYAKFLGLQLGEVRPGEVSIHLDVRGELKQNQGVVHGGAIASLIDTAAAFAVLTQIDVDERVTTTDLTIHYLRPARSGRLTATARTIRGGRRLFVLSVDVHDPDNTLVAAAVTTYIKIEKNLPKSSANSQEITVDNTVGKMPE

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
136 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
137 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 0
Rhizosphere 99.58
Stem 0
Stem Tuber 0
Unclassified 36.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_1044512 3300045051 Unclassified 856
2 MBSR1b_contig_8364786 2162886012 Bacteria 809
3 JGI24748J21848_1000035 3300002074 Bacteria 73922
4 JGI24034J26672_10000039 3300002239 Bacteria 73907
5 Ga0065704_10106326 3300005289 Bacteria 2086
6 Ga0065707_10006336 3300005295 Bacteria 4266
7 Ga0065707_10142205 3300005295 Bacteria 1758
8 Ga0070676_10458856 3300005328 Unclassified 897
9 Ga0070690_100005576 3300005330 Bacteria 7081
10 Ga0068868_101503889 3300005338 Unclassified 630
11 Ga0070687_100142114 3300005343 Unclassified 1399
12 Ga0070687_100727498 3300005343 Unclassified 696
13 Ga0070669_100008592 3300005353 Bacteria 7290
14 Ga0070669_100010769 3300005353 Bacteria 6492
15 Ga0070669_100489226 3300005353 Unclassified 1019
16 Ga0070671_100120980 3300005355 Bacteria 2203
17 Ga0070674_100238308 3300005356 Bacteria 1423
18 Ga0070673_100290681 3300005364 Unclassified 1436
19 Ga0070673_100442822 3300005364 Bacteria 1168
20 Ga0070673_100637489 3300005364 Bacteria 974
21 Ga0070688_100198654 3300005365 Unclassified 1402
22 Ga0070703_10000060 3300005406 Bacteria 54329
23 Ga0070709_10295786 3300005434 Unclassified 1181
24 Ga0070709_10443931 3300005434 Unclassified 976
25 Ga0070701_10176491 3300005438 Bacteria 1248
26 Ga0070701_10518778 3300005438 Unclassified 776
27 Ga0070711_100508626 3300005439 Bacteria 994
28 Ga0070705_100047489 3300005440 Unclassified 2482
29 Ga0070705_100101030 3300005440 Unclassified 1821
30 Ga0070705_100241937 3300005440 Unclassified 1261
31 Ga0070694_100000723 3300005444 Bacteria 18418
32 Ga0070694_100013335 3300005444 Bacteria 5134
33 Ga0070694_100191702 3300005444 Bacteria 1518
34 Ga0070708_100039767 3300005445 Bacteria 4117
35 Ga0070708_100081938 3300005445 Bacteria 2922
36 Ga0070708_100530886 3300005445 Bacteria 1110
37 Ga0070708_100911854 3300005445 Unclassified 825
38 Ga0070678_100518212 3300005456 Bacteria 1054
39 Ga0070678_101590699 3300005456 Unclassified 613
40 Ga0068867_101005726 3300005459 Bacteria 756
41 Ga0068867_101707345 3300005459 Unclassified 590
42 Ga0070685_10048541 3300005466 Bacteria 2445
43 Ga0070706_100062264 3300005467 Bacteria 3447
44 Ga0070707_100021587 3300005468 Bacteria 6087
45 Ga0070707_100075770 3300005468 Bacteria 3245
46 Ga0070707_100148216 3300005468 Bacteria 2284
47 Ga0070707_100970603 3300005468 Bacteria 815
48 Ga0070707_101021766 3300005468 Bacteria 792
49 Ga0070698_100000107 3300005471 Bacteria 69457
50 Ga0070698_100043827 3300005471 Bacteria 4585
51 Ga0070698_100258876 3300005471 Bacteria 1672
52 Ga0070698_100304081 3300005471 Bacteria 1525
53 Ga0070698_100941918 3300005471 Unclassified 810
54 Ga0070699_100022973 3300005518 Bacteria 5372
55 Ga0070699_100156969 3300005518 Bacteria 2013
56 Ga0070699_100315445 3300005518 Unclassified 1404
57 Ga0070699_100429673 3300005518 Unclassified 1196
58 Ga0070699_100551680 3300005518 Unclassified 1049
59 Ga0070697_100025825 3300005536 Bacteria 4685
60 Ga0070697_100042331 3300005536 Unclassified 3685
61 Ga0070672_100185225 3300005543 Bacteria 1736
62 Ga0070686_100062396 3300005544 Bacteria 2411
63 Ga0070686_100111036 3300005544 Bacteria 1868
64 Ga0070695_100038670 3300005545 Bacteria 3012
65 Ga0070695_100164742 3300005545 Bacteria 1559
66 Ga0070695_100190627 3300005545 Bacteria 1459
67 Ga0070695_100310409 3300005545 Unclassified 1169
68 Ga0070695_101127755 3300005545 Unclassified 643
69 Ga0070696_100036908 3300005546 Bacteria 3371
70 Ga0070704_100073102 3300005549 Bacteria 2497
71 Ga0070704_100090843 3300005549 Bacteria 2275
72 Ga0068857_100118474 3300005577 Unclassified 2383
73 Ga0068854_100208485 3300005578 Bacteria 1540
74 Ga0070702_100146878 3300005615 Unclassified 1509
75 Ga0070702_100222097 3300005615 Unclassified 1264
76 Ga0070702_101276519 3300005615 Unclassified 595
77 Ga0068859_100001026 3300005617 Bacteria 28618
78 Ga0068859_100561212 3300005617 Bacteria 1236
79 Ga0068864_100069225 3300005618 Unclassified 3068
80 Ga0068864_100489978 3300005618 Unclassified 1181
81 Ga0068864_100993457 3300005618 Bacteria 832
82 Ga0068861_100031511 3300005719 Bacteria 3895
83 Ga0068861_100517318 3300005719 Unclassified 1082
84 Ga0068861_100551832 3300005719 Unclassified 1050
85 Ga0068863_100160067 3300005841 Bacteria 2157
86 Ga0068858_100000053 3300005842 Bacteria 119869
87 Ga0068858_100114913 3300005842 Bacteria 2515
88 Ga0068860_100045025 3300005843 Bacteria 4206
89 Ga0068860_100048136 3300005843 Unclassified 4064
90 Ga0068862_100021067 3300005844 Bacteria 5448
91 Ga0068862_100115095 3300005844 Bacteria 2365
92 Ga0070715_10000006 3300006163 Bacteria 216296
93 Ga0070715_10182034 3300006163 Bacteria 1054
94 Ga0070716_100400906 3300006173 Bacteria 986
95 Ga0070716_100752154 3300006173 Unclassified 750
96 Ga0070712_100716124 3300006175 Bacteria 854
97 Ga0097621_101027161 3300006237 Unclassified 772
98 Ga0068871_100635862 3300006358 Unclassified 973
99 Ga0075428_100198488 3300006844 Bacteria 2170
100 Ga0075428_100957945 3300006844 Unclassified 907
101 Ga0075434_101237658 3300006871 Unclassified 758
102 Ga0075429_100003847 3300006880 Bacteria 12819
103 Ga0068865_100453983 3300006881 Bacteria 1060
104 Ga0075436_100000007 3300006914 Bacteria 288785
105 Ga0075436_101187192 3300006914 Bacteria 576
106 Ga0097620_100001026 3300006931 Bacteria 28618
107 Ga0097620_100561143 3300006931 Bacteria 1236
108 Ga0075435_100013850 3300007076 Bacteria 6012
109 Ga0075435_100436429 3300007076 Bacteria 1129
110 Ga0099794_10127844 3300007265 Bacteria 1282
111 Ga0099794_10181829 3300007265 Bacteria 1073
112 Ga0099795_10222007 3300007788 Bacteria 805
113 Ga0105240_11297480 3300009093 Unclassified 768
114 Ga0111539_10131582 3300009094 Bacteria 2930
115 Ga0105245_11043148 3300009098 Bacteria 863
116 Ga0105247_10000052 3300009101 Bacteria 141465
117 Ga0114129_11225338 3300009147 Bacteria 933
118 Ga0105243_10000371 3300009148 Bacteria 48179
119 Ga0105243_10041786 3300009148 Bacteria 3586
120 Ga0105243_10323008 3300009148 Unclassified 1407
121 Ga0105243_10923070 3300009148 Unclassified 870
122 Ga0105243_12226520 3300009148 Bacteria 585
123 Ga0105242_10000477 3300009176 Bacteria 31836
124 Ga0105242_10004664 3300009176 Bacteria 10617
125 Ga0105242_11121060 3300009176 Unclassified 802
126 Ga0105242_11755770 3300009176 Unclassified 658
127 Ga0105248_10064998 3300009177 Bacteria 4095
128 Ga0105248_10192279 3300009177 Unclassified 2299
129 Ga0105249_10163138 3300009553 Unclassified 2155
130 Ga0105249_10209493 3300009553 Unclassified 1912
131 Ga0099796_10169337 3300010159 Bacteria 871
132 Ga0105239_10332405 3300010375 Unclassified 1714
133 Ga0105246_10255420 3300011119 Unclassified 1393
134 Ga0105246_10879118 3300011119 Bacteria 802
135 Ga0105246_11589844 3300011119 Unclassified 617
136 Ga0157378_10041489 3300013297 Bacteria 4082
137 Ga0157378_10048598 3300013297 Bacteria 3773
138 Ga0157378_10442738 3300013297 Unclassified 1288
139 Ga0157378_11377880 3300013297 Unclassified 748
140 Ga0157378_12543652 3300013297 Bacteria 564
141 Ga0163162_10130556 3300013306 Bacteria 2621
142 Ga0163162_11439021 3300013306 Bacteria 784
143 Ga0157375_10216885 3300013308 Bacteria 2071
144 Ga0157375_10494348 3300013308 Bacteria 1388
145 Ga0163163_10475608 3300014325 Unclassified 1310
146 Ga0157380_10005705 3300014326 Bacteria 8711
147 Ga0157380_10503427 3300014326 Unclassified 1177
148 Ga0157379_10114940 3300014968 Bacteria 2419
149 Ga0157379_10121065 3300014968 Bacteria 2354
150 Ga0163161_10064042 3300017792 Bacteria 2681
151 Ga0163161_10371486 3300017792 Bacteria 1141
152 Ga0163161_10870681 3300017792 Unclassified 761
153 Ga0207672_1000059 3300025223 Bacteria 14491
154 Ga0207653_10000145 3300025885 Bacteria 50672
155 Ga0207642_10068025 3300025899 Bacteria 1683
156 Ga0207710_10000004 3300025900 Bacteria 846540
157 Ga0207685_10000010 3300025905 Bacteria 216792
158 Ga0207699_10093386 3300025906 Unclassified 1894
159 Ga0207684_10010331 3300025910 Bacteria 8217
160 Ga0207684_10057340 3300025910 Bacteria 3305
161 Ga0207693_10836514 3300025915 Bacteria 708
162 Ga0207662_10010551 3300025918 Bacteria 5106
163 Ga0207662_10168038 3300025918 Bacteria 1405
164 Ga0207662_10170710 3300025918 Unclassified 1394
165 Ga0207646_10000225 3300025922 Bacteria 77485
166 Ga0207646_10002258 3300025922 Bacteria 22924
167 Ga0207646_10022885 3300025922 Bacteria 5746
168 Ga0207646_10072771 3300025922 Bacteria 3070
169 Ga0207646_10373605 3300025922 Unclassified 1288
170 Ga0207646_10850846 3300025922 Bacteria 811
171 Ga0207646_10906656 3300025922 Bacteria 782
172 Ga0207681_10000934 3300025923 Bacteria 19027
173 Ga0207681_10078746 3300025923 Bacteria 2320
174 Ga0207650_10018841 3300025925 Bacteria 4848
175 Ga0207687_10280220 3300025927 Bacteria 1336
176 Ga0207687_10518011 3300025927 Bacteria 997
177 Ga0207644_10000470 3300025931 Bacteria 25963
178 Ga0207644_10609669 3300025931 Unclassified 907
179 Ga0207644_10923657 3300025931 Bacteria 732
180 Ga0207686_10000009 3300025934 Bacteria 241706
181 Ga0207686_10000152 3300025934 Bacteria 53030
182 Ga0207686_11000750 3300025934 Unclassified 678
183 Ga0207709_10000048 3300025935 Bacteria 238474
184 Ga0207704_10420112 3300025938 Bacteria 1060
185 Ga0207665_10023454 3300025939 Bacteria 4066
186 Ga0207665_10727566 3300025939 Unclassified 781
187 Ga0207711_10710739 3300025941 Bacteria 937
188 Ga0207689_10254177 3300025942 Bacteria 1453
189 Ga0207651_10092019 3300025960 Bacteria 2223
190 Ga0207651_10246480 3300025960 Unclassified 1459
191 Ga0207651_10615837 3300025960 Bacteria 950
192 Ga0207712_10416862 3300025961 Unclassified 1132
193 Ga0207712_11050910 3300025961 Bacteria 724
194 Ga0207640_10420033 3300025981 Bacteria 1094
195 Ga0207677_11586663 3300026023 Unclassified 606
196 Ga0207703_10002563 3300026035 Bacteria 15697
197 Ga0207703_10227582 3300026035 Unclassified 1670
198 Ga0207708_10016515 3300026075 Bacteria 5552
199 Ga0207708_10484702 3300026075 Unclassified 1034
200 Ga0207641_10185054 3300026088 Unclassified 1910
201 Ga0207676_10215757 3300026095 Unclassified 1705
202 Ga0207676_11283455 3300026095 Unclassified 727
203 Ga0207676_11904088 3300026095 Unclassified 593
204 Ga0207674_10118500 3300026116 Unclassified 2617
205 Ga0207674_12044291 3300026116 Unclassified 537
206 Ga0207675_100049111 3300026118 Bacteria 3939
207 Ga0207675_100186833 3300026118 Unclassified 1986
208 Ga0207683_11856813 3300026121 Unclassified 551
209 Ga0207698_11943585 3300026142 Unclassified 603
210 Ga0207428_10013140 3300027907 Bacteria 7248
211 Ga0268265_10226936 3300028380 Bacteria 1638
212 Ga0268264_10025486 3300028381 Bacteria 4832
213 Ga0268264_10454645 3300028381 Unclassified 1241
214 Ga0373955_0250033 3300035172 Bacteria 1063
215 Ga0373924_0249546 3300035410 Unclassified 786
216 Ga0373935_0373708 3300035692 Bacteria 1020
217 Ga0373937_0278050 3300036401 Unclassified 1581
218 Ga0451577_1059483 3300042876 Unclassified 727
219 Ga0451576_0254690 3300045051 Bacteria 1835
220 Ga0495639_0122516 3300046475 Unclassified 1241
221 Ga0495618_0085634 3300046514 Bacteria 2015
222 Ga0495630_0038943 3300046517 Unclassified 3556
223 Ga0495621_0159710 3300046539 Bacteria 891
224 Ga0495635_0131690 3300046663 Bacteria 1705
225 Ga0495658_0238895 3300046683 Unclassified 1141
226 Ga0495613_0122710 3300046689 Bacteria 1865
227 Ga0495624_0345552 3300046690 Unclassified 895
228 Ga0495581_0286668 3300047315 Bacteria 963
229 Ga0495684_0194320 3300047471 Bacteria 1499
230 Ga0495614_0170031 3300048089 Unclassified 978
231 Ga0501069_0200035 3300049585 Unclassified 1158
232 nmdc:mga09592_193577_c1 3300050508 Unclassified 1760
233 nmdc:mga08y16_32718_c1 3300050511 Bacteria 5467
234 nmdc:mga0n895_141177_c1 3300050512 Unclassified 2437
235 nmdc:mga0rr50_1129056_c1 3300050513 Unclassified 666
236 nmdc:mga08x19_141_c1 3300050514 Bacteria 63622
237 Ga0495655_0005643 3300053083 Bacteria 2223
238 Ga0500566_0182546 3300053094 Unclassified 1075
239 Ga0451576_1044512
240 MBSR1b_contig_8364786
241 JGI24748J21848_1000035
242 JGI24034J26672_10000039
243 Ga0065704_10106326
244 Ga0065707_10006336
245 Ga0065707_10142205
246 Ga0070676_10458856
247 Ga0070690_100005576
248 Ga0068868_101503889
249 Ga0070687_100142114
250 Ga0070687_100727498
251 Ga0070669_100008592
252 Ga0070669_100010769
253 Ga0070669_100489226
254 Ga0070671_100120980
255 Ga0070674_100238308
256 Ga0070673_100290681
257 Ga0070673_100442822
258 Ga0070673_100637489
259 Ga0070688_100198654
260 Ga0070703_10000060
261 Ga0070709_10295786
262 Ga0070709_10443931
263 Ga0070701_10176491
264 Ga0070701_10518778
265 Ga0070711_100508626
266 Ga0070705_100047489
267 Ga0070705_100101030
268 Ga0070705_100241937
269 Ga0070694_100000723
270 Ga0070694_100013335
271 Ga0070694_100191702
272 Ga0070708_100039767
273 Ga0070708_100081938
274 Ga0070708_100530886
275 Ga0070708_100911854
276 Ga0070678_100518212
277 Ga0070678_101590699
278 Ga0068867_101005726
279 Ga0068867_101707345
280 Ga0070685_10048541
281 Ga0070706_100062264
282 Ga0070707_100021587
283 Ga0070707_100075770
284 Ga0070707_100148216
285 Ga0070707_100970603
286 Ga0070707_101021766
287 Ga0070698_100000107
288 Ga0070698_100043827
289 Ga0070698_100258876
290 Ga0070698_100304081
291 Ga0070698_100941918
292 Ga0070699_100022973
293 Ga0070699_100156969
294 Ga0070699_100315445
295 Ga0070699_100429673
296 Ga0070699_100551680
297 Ga0070697_100025825
298 Ga0070697_100042331
299 Ga0070672_100185225
300 Ga0070686_100062396
301 Ga0070686_100111036
302 Ga0070695_100038670
303 Ga0070695_100164742
304 Ga0070695_100190627
305 Ga0070695_100310409
306 Ga0070695_101127755
307 Ga0070696_100036908
308 Ga0070704_100073102
309 Ga0070704_100090843
310 Ga0068857_100118474
311 Ga0068854_100208485
312 Ga0070702_100146878
313 Ga0070702_100222097
314 Ga0070702_101276519
315 Ga0068859_100001026
316 Ga0068859_100561212
317 Ga0068864_100069225
318 Ga0068864_100489978
319 Ga0068864_100993457
320 Ga0068861_100031511
321 Ga0068861_100517318
322 Ga0068861_100551832
323 Ga0068863_100160067
324 Ga0068858_100000053
325 Ga0068858_100114913
326 Ga0068860_100045025
327 Ga0068860_100048136
328 Ga0068862_100021067
329 Ga0068862_100115095
330 Ga0070715_10000006
331 Ga0070715_10182034
332 Ga0070716_100400906
333 Ga0070716_100752154
334 Ga0070712_100716124
335 Ga0097621_101027161
336 Ga0068871_100635862
337 Ga0075428_100198488
338 Ga0075428_100957945
339 Ga0075434_101237658
340 Ga0075429_100003847
341 Ga0068865_100453983
342 Ga0075436_100000007
343 Ga0075436_101187192
344 Ga0097620_100001026
345 Ga0097620_100561143
346 Ga0075435_100013850
347 Ga0075435_100436429
348 Ga0099794_10127844
349 Ga0099794_10181829
350 Ga0099795_10222007
351 Ga0105240_11297480
352 Ga0111539_10131582
353 Ga0105245_11043148
354 Ga0105247_10000052
355 Ga0114129_11225338
356 Ga0105243_10000371
357 Ga0105243_10041786
358 Ga0105243_10323008
359 Ga0105243_10923070
360 Ga0105243_12226520
361 Ga0105242_10000477
362 Ga0105242_10004664
363 Ga0105242_11121060
364 Ga0105242_11755770
365 Ga0105248_10064998
366 Ga0105248_10192279
367 Ga0105249_10163138
368 Ga0105249_10209493
369 Ga0099796_10169337
370 Ga0105239_10332405
371 Ga0105246_10255420
372 Ga0105246_10879118
373 Ga0105246_11589844
374 Ga0157378_10041489
375 Ga0157378_10048598
376 Ga0157378_10442738
377 Ga0157378_11377880
378 Ga0157378_12543652
379 Ga0163162_10130556
380 Ga0163162_11439021
381 Ga0157375_10216885
382 Ga0157375_10494348
383 Ga0163163_10475608
384 Ga0157380_10005705
385 Ga0157380_10503427
386 Ga0157379_10114940
387 Ga0157379_10121065
388 Ga0163161_10064042
389 Ga0163161_10371486
390 Ga0163161_10870681
391 Ga0207672_1000059
392 Ga0207653_10000145
393 Ga0207642_10068025
394 Ga0207710_10000004
395 Ga0207685_10000010
396 Ga0207699_10093386
397 Ga0207684_10010331
398 Ga0207684_10057340
399 Ga0207693_10836514
400 Ga0207662_10010551
401 Ga0207662_10168038
402 Ga0207662_10170710
403 Ga0207646_10000225
404 Ga0207646_10002258
405 Ga0207646_10022885
406 Ga0207646_10072771
407 Ga0207646_10373605
408 Ga0207646_10850846
409 Ga0207646_10906656
410 Ga0207681_10000934
411 Ga0207681_10078746
412 Ga0207650_10018841
413 Ga0207687_10280220
414 Ga0207687_10518011
415 Ga0207644_10000470
416 Ga0207644_10609669
417 Ga0207644_10923657
418 Ga0207686_10000009
419 Ga0207686_10000152
420 Ga0207686_11000750
421 Ga0207709_10000048
422 Ga0207704_10420112
423 Ga0207665_10023454
424 Ga0207665_10727566
425 Ga0207711_10710739
426 Ga0207689_10254177
427 Ga0207651_10092019
428 Ga0207651_10246480
429 Ga0207651_10615837
430 Ga0207712_10416862
431 Ga0207712_11050910
432 Ga0207640_10420033
433 Ga0207677_11586663
434 Ga0207703_10002563
435 Ga0207703_10227582
436 Ga0207708_10016515
437 Ga0207708_10484702
438 Ga0207641_10185054
439 Ga0207676_10215757
440 Ga0207676_11283455
441 Ga0207676_11904088
442 Ga0207674_10118500
443 Ga0207674_12044291
444 Ga0207675_100049111
445 Ga0207675_100186833
446 Ga0207683_11856813
447 Ga0207698_11943585
448 Ga0207428_10013140
449 Ga0268265_10226936
450 Ga0268264_10025486
451 Ga0268264_10454645
452 Ga0373955_0250033
453 Ga0373924_0249546
454 Ga0373935_0373708
455 Ga0373937_0278050
456 Ga0451577_1059483
457 Ga0451576_0254690
458 Ga0495639_0122516
459 Ga0495618_0085634
460 Ga0495630_0038943
461 Ga0495621_0159710
462 Ga0495635_0131690
463 Ga0495658_0238895
464 Ga0495613_0122710
465 Ga0495624_0345552
466 Ga0495581_0286668
467 Ga0495684_0194320
468 Ga0495614_0170031
469 Ga0501069_0200035
470 nmdc:mga09592_193577_c1
471 nmdc:mga08y16_32718_c1
472 nmdc:mga0n895_141177_c1
473 nmdc:mga0rr50_1129056_c1
474 nmdc:mga08x19_141_c1
475 Ga0495655_0005643
476 Ga0500566_0182546

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

53

130

0.98

PF14539

DUF4442

Domain of unknown function (DUF4442)

12

137

0.89

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

47

137

0.86

PF20789

4HBT_3C

Acyl-CoA thioesterase C-terminal domain

22

135

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.9635 22 139
1wlu-assembly1.cif.gz_A crystal structure of tt0310 protein from thermus thermophilus hb8 0.9591 22 139
5ep5-assembly1.cif.gz_B the crystal structure of the hypothetical protein sav0944 mutant (glu47ala) from staphylococcus aureus. 0.9588 23 139
4ybv-assembly1.cif.gz_D crystal structure of mutant of (q32a) thioesterase enzyme sav0944 from staphylococcus aureus subsp. aureus mu50 0.9534 23 140
3s4k-assembly1.cif.gz_A structure of a putative esterase rv1847/mt1895 from mycobacterium tuberculosis 0.9487 21 140
ID Description Score Start End Superfamily
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9644 21 140 3.10.129.10
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9591 22 139 3.10.129.10
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9491 21 140 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9491 21 140 3.10.129.10
3r32A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9415 24 138 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7W0G0I7-F1-model_v4 PaaI family thioesterase 0.9937 30 140 GO:0047617
AF-A0A7V8Z7T4-F1-model_v4 PaaI family thioesterase 0.9877 5 140 GO:0047617
AF-A0A7W0G0I7-F1-model_v4 PaaI family thioesterase 0.9849 30 140 GO:0047617
AF-A0A7V4CZE7-F1-model_v4 PaaI family thioesterase 0.9806 21 139 GO:0047617
AF-A0A7W0MKE1-F1-model_v4 PaaI family thioesterase 0.9803 5 140 GO:0047617

Map