F351145

General Info

Members Datasets Scaffolds Average Seq Length
238 95 476 194

Family's Representative Sequence

Representative Sequence 3300036647|Ga0316582_0010133|Ga0316582_0010133_4292_4966
Length 224
Sequence MTDEGRACSIVVHRWPELDAKGATQSMTTWRTFIAVELDEELRDGLQGLQDRLREKLSPRSVRWVRPEGIHLTLKFLGDTPVGRIDEVQAALALAAVEARPFTFTVGGLGCFPNTRRARVVWVGLQEVTGTLARLRDSVEAHVAPLGFPTERRPFNPHLTLGRVQRHASKSEVREIGEVVGASAIGTVGQMAVTAVSYIKSDLRPSGAVYTTLLEAKLGDGERG

Samples

Sample ID Description Type Environment
1 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
43 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
44 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
45 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
46 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
47 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
50 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
51 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
52 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
53 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
54 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
55 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
56 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
57 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
58 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
59 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
60 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
61 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
64 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
65 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
77 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
78 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
79 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
80 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
81 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
82 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
83 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
84 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
86 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
87 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
88 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
89 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
90 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
91 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
92 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
93 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
94 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
95 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 97.48
Stem 0
Stem Tuber 0
Unclassified 28.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316582_0010133 3300036647 Bacteria 5149
2 SwRhRL3b_contig_2659082 2162886006 Unclassified 941
3 SwRhRL2b_contig_929780 2162886007 Bacteria 3504
4 Ga0065704_10000294 3300005289 Bacteria 47445
5 Ga0065704_10081416 3300005289 Bacteria 3764
6 Ga0065707_10000503 3300005295 Bacteria 28730
7 Ga0065707_10082633 3300005295 Bacteria 13141
8 Ga0065707_10087080 3300005295 Bacteria 5158
9 Ga0070680_100026336 3300005336 Unclassified 4651
10 Ga0070680_100974611 3300005336 Bacteria 732
11 Ga0070689_100037398 3300005340 Unclassified 3711
12 Ga0070687_100204815 3300005343 Unclassified 1198
13 Ga0070692_10001653 3300005345 Bacteria 8226
14 Ga0070692_10293933 3300005345 Bacteria 989
15 Ga0070700_100395225 3300005441 Unclassified 1038
16 Ga0070694_100000261 3300005444 Bacteria 27988
17 Ga0070694_100019950 3300005444 Bacteria 4269
18 Ga0070694_100086438 3300005444 Bacteria 2191
19 Ga0070694_100102111 3300005444 Bacteria 2030
20 Ga0070694_100912593 3300005444 Bacteria 726
21 Ga0070706_100067281 3300005467 Bacteria 3313
22 Ga0070706_100127230 3300005467 Unclassified 2376
23 Ga0070707_100065406 3300005468 Bacteria 3492
24 Ga0070707_100195474 3300005468 Unclassified 1972
25 Ga0070698_100020523 3300005471 Bacteria 6927
26 Ga0070698_100087899 3300005471 Bacteria 3093
27 Ga0070698_100372182 3300005471 Unclassified 1361
28 Ga0070699_100016565 3300005518 Bacteria 6326
29 Ga0070697_100000369 3300005536 Bacteria 35090
30 Ga0070697_100065048 3300005536 Bacteria 2979
31 Ga0070697_100204973 3300005536 Bacteria 1677
32 Ga0070697_100229986 3300005536 Bacteria 1582
33 Ga0070697_100290465 3300005536 Bacteria 1404
34 Ga0070697_100371154 3300005536 Bacteria 1238
35 Ga0070697_101008298 3300005536 Bacteria 740
36 Ga0070695_100036054 3300005545 Bacteria 3111
37 Ga0070695_100089632 3300005545 Unclassified 2051
38 Ga0070695_100294317 3300005545 Bacteria 1198
39 Ga0070704_100015439 3300005549 Bacteria 4797
40 Ga0070704_100168534 3300005549 Bacteria 1739
41 Ga0070704_100643043 3300005549 Bacteria 936
42 Ga0068857_100084074 3300005577 Bacteria 2844
43 Ga0068859_100063032 3300005617 Unclassified 3737
44 Ga0068870_10058924 3300005840 Unclassified 2057
45 Ga0068862_100331768 3300005844 Bacteria 1407
46 Ga0081539_10021805 3300005985 Unclassified 4264
47 Ga0075428_100019539 3300006844 Bacteria 7497
48 Ga0075428_101426511 3300006844 Unclassified 726
49 Ga0075430_100368967 3300006846 Unclassified 1185
50 Ga0075430_100800269 3300006846 Unclassified 777
51 Ga0075431_100040838 3300006847 Bacteria 4782
52 Ga0075431_100052626 3300006847 Unclassified 4199
53 Ga0075431_100140421 3300006847 Bacteria 2490
54 Ga0075431_100173444 3300006847 Bacteria 2215
55 Ga0075431_100390498 3300006847 Unclassified 1394
56 Ga0075431_100893491 3300006847 Bacteria 858
57 Ga0075433_10049307 3300006852 Bacteria 3663
58 Ga0075434_100318367 3300006871 Bacteria 1576
59 Ga0075434_100555491 3300006871 Bacteria 1168
60 Ga0075429_100042398 3300006880 Bacteria 3960
61 Ga0075429_100089318 3300006880 Unclassified 2686
62 Ga0097620_100063030 3300006931 Unclassified 3737
63 Ga0105245_10383686 3300009098 Unclassified 1400
64 Ga0114129_10006987 3300009147 Archaea 16068
65 Ga0114129_10012378 3300009147 Bacteria 12144
66 Ga0114129_10019153 3300009147 Bacteria 9749
67 Ga0114129_10068481 3300009147 Bacteria 4949
68 Ga0114129_10091494 3300009147 Bacteria 4215
69 Ga0114129_10108756 3300009147 Bacteria 3827
70 Ga0105243_10251832 3300009148 Unclassified 1577
71 Ga0105243_10406426 3300009148 Unclassified 1266
72 Ga0105249_10097077 3300009553 Unclassified 2766
73 Ga0105246_10013931 3300011119 Bacteria 5048
74 Ga0105246_10031701 3300011119 Unclassified 3499
75 Ga0207684_10071131 3300025910 Unclassified 2956
76 Ga0207646_10002581 3300025922 Bacteria 21383
77 Ga0207646_10162648 3300025922 Bacteria 2014
78 Ga0207646_10379602 3300025922 Bacteria 1277
79 Ga0207712_10229520 3300025961 Bacteria 1489
80 Ga0207708_10164439 3300026075 Unclassified 1754
81 Ga0207674_10103266 3300026116 Bacteria 2830
82 Ga0268265_10832752 3300028380 Bacteria 901
83 Ga0268265_10862811 3300028380 Bacteria 886
84 Ga0265323_10010619 3300028653 Bacteria 3729
85 Ga0265323_10064362 3300028653 Bacteria 1268
86 Ga0316575_10127249 3300031665 Bacteria 1044
87 Ga0316579_10024660 3300031691 Bacteria 2709
88 Ga0316579_10033913 3300031691 Bacteria 2346
89 Ga0316579_10041869 3300031691 Bacteria 2126
90 Ga0316579_10060533 3300031691 Bacteria 1781
91 Ga0316579_10071949 3300031691 Bacteria 1639
92 Ga0316579_10103589 3300031691 Unclassified 1364
93 Ga0316576_10064690 3300031727 Unclassified 2687
94 Ga0316576_10110014 3300031727 Unclassified 2065
95 Ga0316576_10124032 3300031727 Bacteria 1941
96 Ga0316576_10152294 3300031727 Bacteria 1743
97 Ga0316576_10345127 3300031727 Bacteria 1108
98 Ga0316578_10011645 3300031728 Bacteria 4611
99 Ga0316578_10017010 3300031728 Unclassified 3949
100 Ga0316578_10119202 3300031728 Unclassified 1586
101 Ga0316578_10137184 3300031728 Bacteria 1473
102 Ga0316578_10155942 3300031728 Unclassified 1376
103 Ga0316577_10001974 3300031733 Bacteria 9972
104 Ga0316577_10002682 3300031733 Bacteria 8851
105 Ga0316577_10004515 3300031733 Bacteria 7193
106 Ga0316577_10008941 3300031733 Bacteria 5379
107 Ga0316577_10012169 3300031733 Bacteria 4683
108 Ga0316577_10027599 3300031733 Bacteria 3166
109 Ga0316577_10069887 3300031733 Unclassified 1961
110 Ga0316577_10249703 3300031733 Bacteria 1004
111 Ga0316577_10545080 3300031733 Unclassified 660
112 Ga0307416_100903639 3300032002 Unclassified 983
113 Ga0307416_101356321 3300032002 Bacteria 817
114 Ga0316585_10055655 3300032137 Unclassified 1273
115 Ga0373961_0012791 3300035241 Bacteria 2107
116 Ga0316574_0008519 3300035398 Bacteria 5698
117 Ga0316574_0122529 3300035398 Bacteria 1670
118 Ga0316574_0170437 3300035398 Unclassified 1402
119 Ga0316582_0005685 3300036647 Bacteria 6457
120 Ga0316582_0009062 3300036647 Bacteria 5382
121 Ga0316582_0010191 3300036647 Bacteria 5137
122 Ga0316582_0016562 3300036647 Bacteria 4241
123 Ga0316582_0099822 3300036647 Bacteria 1921
124 Ga0316582_0112827 3300036647 Bacteria 1811
125 Ga0316582_0193783 3300036647 Unclassified 1385
126 Ga0316582_0809809 3300036647 Unclassified 642
127 Ga0316584_0001061 3300036712 Bacteria 16031
128 Ga0316584_0002907 3300036712 Bacteria 11003
129 Ga0316584_0005270 3300036712 Bacteria 8656
130 Ga0316584_0006786 3300036712 Bacteria 7768
131 Ga0316584_0037963 3300036712 Bacteria 3582
132 Ga0316584_0038836 3300036712 Bacteria 3542
133 Ga0316584_0048105 3300036712 Unclassified 3187
134 Ga0316584_0124003 3300036712 Bacteria 1930
135 Ga0316584_0163638 3300036712 Unclassified 1652
136 Ga0316584_0357484 3300036712 Unclassified 1047
137 Ga0316584_0644710 3300036712 Unclassified 731
138 Ga0316581_0010494 3300037588 Bacteria 2570
139 Ga0316581_0023513 3300037588 Bacteria 1823
140 Ga0316581_0043378 3300037588 Bacteria 1373
141 Ga0316581_0054954 3300037588 Unclassified 1220
142 Ga0316581_0122530 3300037588 Bacteria 801
143 Ga0400490_12789 3300038726 Bacteria 16595
144 Ga0400490_25697 3300038726 Bacteria 3845
145 Ga0400491_05868 3300038727 Bacteria 6505
146 Ga0400483_128634 3300039062 Bacteria 14569
147 Ga0400483_223598 3300039062 Bacteria 5308
148 Ga0400489_39921 3300039093 Bacteria 2093
149 Ga0439457_066398 3300042014 Bacteria 820
150 Ga0451577_0189208 3300042876 Unclassified 1856
151 Ga0451577_0395851 3300042876 Bacteria 1254
152 Ga0451577_1021667 3300042876 Unclassified 742
153 Ga0453683_0043070 3300044673 Bacteria 2833
154 Ga0453683_0191313 3300044673 Unclassified 1298
155 Ga0453683_0241654 3300044673 Bacteria 1150
156 Ga0453684_0025118 3300044712 Bacteria 8666
157 Ga0453684_0152476 3300044712 Unclassified 2744
158 Ga0453684_0166439 3300044712 Bacteria 2602
159 Ga0453684_0317508 3300044712 Bacteria 1765
160 Ga0453684_0460200 3300044712 Unclassified 1415
161 Ga0453684_0762975 3300044712 Unclassified 1046
162 Ga0453684_1029999 3300044712 Bacteria 874
163 Ga0451576_0000454 3300045051 Bacteria 93047
164 Ga0451576_0040285 3300045051 Unclassified 4946
165 Ga0451576_0050636 3300045051 Bacteria 4355
166 Ga0451576_0053610 3300045051 Bacteria 4223
167 Ga0451576_0133878 3300045051 Bacteria 2584
168 Ga0451576_0188642 3300045051 Bacteria 2153
169 Ga0495628_0630998 3300046516 Bacteria 763
170 Ga0495658_0237510 3300046683 Bacteria 1144
171 Ga0501031_0000670 3300049568 Bacteria 20379
172 Ga0501031_0016707 3300049568 Bacteria 4767
173 Ga0501036_0054898 3300049572 Bacteria 3375
174 Ga0501036_0098670 3300049572 Bacteria 2470
175 Ga0501037_0005504 3300049573 Bacteria 9235
176 Ga0501038_0073460 3300049574 Bacteria 2896
177 Ga0501039_0009931 3300049575 Bacteria 7258
178 Ga0501040_0861804 3300049576 Bacteria 656
179 Ga0501041_0014717 3300049577 Bacteria 4645
180 Ga0501041_0058497 3300049577 Bacteria 2358
181 Ga0501041_0105530 3300049577 Unclassified 1746
182 Ga0501042_0009728 3300049578 Bacteria 6421
183 Ga0501042_0378377 3300049578 Unclassified 1025
184 Ga0501043_0472099 3300049579 Unclassified 940
185 Ga0501046_0095859 3300049580 Bacteria 2279
186 Ga0501046_0847628 3300049580 Unclassified 639
187 Ga0501048_0021321 3300049582 Bacteria 4743
188 Ga0501048_0071152 3300049582 Bacteria 2456
189 Ga0501048_0613706 3300049582 Unclassified 781
190 Ga0501048_1077323 3300049582 Bacteria 578
191 Ga0501071_0187320 3300049587 Bacteria 1551
192 Ga0501073_0348148 3300049589 Unclassified 1023
193 Ga0501074_0178234 3300049590 Unclassified 1516
194 Ga0501074_0398876 3300049590 Bacteria 976
195 Ga0501075_0883194 3300049591 Bacteria 680
196 Ga0501076_0022621 3300049592 Unclassified 4832
197 Ga0501076_0065714 3300049592 Bacteria 2893
198 Ga0501076_0079748 3300049592 Bacteria 2627
199 Ga0501076_0241845 3300049592 Bacteria 1477
200 Ga0501079_0522415 3300049741 Bacteria 933
201 Ga0501080_0122535 3300049742 Bacteria 2409
202 Ga0501080_0153070 3300049742 Bacteria 2131
203 Ga0501080_1039485 3300049742 Unclassified 709
204 Ga0501081_0033036 3300049743 Bacteria 3513
205 Ga0501081_0126395 3300049743 Unclassified 1824
206 Ga0501081_0423684 3300049743 Bacteria 987
207 Ga0501035_0013519 3300049822 Bacteria 7534
208 Ga0501045_0209064 3300049824 Bacteria 1454
209 Ga0501045_0212287 3300049824 Bacteria 1442
210 nmdc:mga05p37_112181_c1 3300050507 Bacteria 3353
211 nmdc:mga05p37_1431074_c1 3300050507 Bacteria 694
212 nmdc:mga05p37_16261_c1 3300050507 Bacteria 8958
213 nmdc:mga05p37_366640_c1 3300050507 Bacteria 1692
214 nmdc:mga05p37_96611_c1 3300050507 Bacteria 3640
215 nmdc:mga09592_143470_c1 3300050508 Unclassified 2059
216 nmdc:mga09592_33052_c1 3300050508 Bacteria 4315
217 nmdc:mga09592_343447_c1 3300050508 Bacteria 1292
218 nmdc:mga09592_65418_c1 3300050508 Bacteria 3080
219 nmdc:mga09592_862233_c1 3300050508 Unclassified 763
220 nmdc:mga06r32_245251_c1 3300050510 Bacteria 1779
221 nmdc:mga06r32_349379_c1 3300050510 Unclassified 1463
222 nmdc:mga06r32_3507_c1 3300050510 Bacteria 14004
223 nmdc:mga06r32_459500_c1 3300050510 Bacteria 1252
224 nmdc:mga06r32_69030_c1 3300050510 Unclassified 3415
225 nmdc:mga06r32_774205_c1 3300050510 Bacteria 921
226 nmdc:mga0n895_1276039_c1 3300050512 Unclassified 706
227 nmdc:mga0n895_492361_c1 3300050512 Bacteria 1236
228 nmdc:mga0a205_58005_c1 3300050515 Bacteria 3739
229 Ga0495601_0009896 3300053077 Bacteria 5647
230 Ga0495619_0017331 3300053085 Bacteria 4561
231 Ga0501084_0166009 3300054114 Bacteria 1863
232 Ga0501084_0534706 3300054114 Unclassified 991
233 Ga0501082_0211073 3300060353 Bacteria 1689
234 Ga0501082_0214581 3300060353 Bacteria 1674
235 Ga0501082_0408128 3300060353 Unclassified 1186
236 Ga0501082_0426720 3300060353 Unclassified 1158
237 Ga0530510_0000907 3300061734 Bacteria 19554
238 Ga0530510_0045889 3300061734 Bacteria 3157
239 Ga0316582_0010133
240 SwRhRL3b_contig_2659082
241 SwRhRL2b_contig_929780
242 Ga0065704_10000294
243 Ga0065704_10081416
244 Ga0065707_10000503
245 Ga0065707_10082633
246 Ga0065707_10087080
247 Ga0070680_100026336
248 Ga0070680_100974611
249 Ga0070689_100037398
250 Ga0070687_100204815
251 Ga0070692_10001653
252 Ga0070692_10293933
253 Ga0070700_100395225
254 Ga0070694_100000261
255 Ga0070694_100019950
256 Ga0070694_100086438
257 Ga0070694_100102111
258 Ga0070694_100912593
259 Ga0070706_100067281
260 Ga0070706_100127230
261 Ga0070707_100065406
262 Ga0070707_100195474
263 Ga0070698_100020523
264 Ga0070698_100087899
265 Ga0070698_100372182
266 Ga0070699_100016565
267 Ga0070697_100000369
268 Ga0070697_100065048
269 Ga0070697_100204973
270 Ga0070697_100229986
271 Ga0070697_100290465
272 Ga0070697_100371154
273 Ga0070697_101008298
274 Ga0070695_100036054
275 Ga0070695_100089632
276 Ga0070695_100294317
277 Ga0070704_100015439
278 Ga0070704_100168534
279 Ga0070704_100643043
280 Ga0068857_100084074
281 Ga0068859_100063032
282 Ga0068870_10058924
283 Ga0068862_100331768
284 Ga0081539_10021805
285 Ga0075428_100019539
286 Ga0075428_101426511
287 Ga0075430_100368967
288 Ga0075430_100800269
289 Ga0075431_100040838
290 Ga0075431_100052626
291 Ga0075431_100140421
292 Ga0075431_100173444
293 Ga0075431_100390498
294 Ga0075431_100893491
295 Ga0075433_10049307
296 Ga0075434_100318367
297 Ga0075434_100555491
298 Ga0075429_100042398
299 Ga0075429_100089318
300 Ga0097620_100063030
301 Ga0105245_10383686
302 Ga0114129_10006987
303 Ga0114129_10012378
304 Ga0114129_10019153
305 Ga0114129_10068481
306 Ga0114129_10091494
307 Ga0114129_10108756
308 Ga0105243_10251832
309 Ga0105243_10406426
310 Ga0105249_10097077
311 Ga0105246_10013931
312 Ga0105246_10031701
313 Ga0207684_10071131
314 Ga0207646_10002581
315 Ga0207646_10162648
316 Ga0207646_10379602
317 Ga0207712_10229520
318 Ga0207708_10164439
319 Ga0207674_10103266
320 Ga0268265_10832752
321 Ga0268265_10862811
322 Ga0265323_10010619
323 Ga0265323_10064362
324 Ga0316575_10127249
325 Ga0316579_10024660
326 Ga0316579_10033913
327 Ga0316579_10041869
328 Ga0316579_10060533
329 Ga0316579_10071949
330 Ga0316579_10103589
331 Ga0316576_10064690
332 Ga0316576_10110014
333 Ga0316576_10124032
334 Ga0316576_10152294
335 Ga0316576_10345127
336 Ga0316578_10011645
337 Ga0316578_10017010
338 Ga0316578_10119202
339 Ga0316578_10137184
340 Ga0316578_10155942
341 Ga0316577_10001974
342 Ga0316577_10002682
343 Ga0316577_10004515
344 Ga0316577_10008941
345 Ga0316577_10012169
346 Ga0316577_10027599
347 Ga0316577_10069887
348 Ga0316577_10249703
349 Ga0316577_10545080
350 Ga0307416_100903639
351 Ga0307416_101356321
352 Ga0316585_10055655
353 Ga0373961_0012791
354 Ga0316574_0008519
355 Ga0316574_0122529
356 Ga0316574_0170437
357 Ga0316582_0005685
358 Ga0316582_0009062
359 Ga0316582_0010191
360 Ga0316582_0016562
361 Ga0316582_0099822
362 Ga0316582_0112827
363 Ga0316582_0193783
364 Ga0316582_0809809
365 Ga0316584_0001061
366 Ga0316584_0002907
367 Ga0316584_0005270
368 Ga0316584_0006786
369 Ga0316584_0037963
370 Ga0316584_0038836
371 Ga0316584_0048105
372 Ga0316584_0124003
373 Ga0316584_0163638
374 Ga0316584_0357484
375 Ga0316584_0644710
376 Ga0316581_0010494
377 Ga0316581_0023513
378 Ga0316581_0043378
379 Ga0316581_0054954
380 Ga0316581_0122530
381 Ga0400490_12789
382 Ga0400490_25697
383 Ga0400491_05868
384 Ga0400483_128634
385 Ga0400483_223598
386 Ga0400489_39921
387 Ga0439457_066398
388 Ga0451577_0189208
389 Ga0451577_0395851
390 Ga0451577_1021667
391 Ga0453683_0043070
392 Ga0453683_0191313
393 Ga0453683_0241654
394 Ga0453684_0025118
395 Ga0453684_0152476
396 Ga0453684_0166439
397 Ga0453684_0317508
398 Ga0453684_0460200
399 Ga0453684_0762975
400 Ga0453684_1029999
401 Ga0451576_0000454
402 Ga0451576_0040285
403 Ga0451576_0050636
404 Ga0451576_0053610
405 Ga0451576_0133878
406 Ga0451576_0188642
407 Ga0495628_0630998
408 Ga0495658_0237510
409 Ga0501031_0000670
410 Ga0501031_0016707
411 Ga0501036_0054898
412 Ga0501036_0098670
413 Ga0501037_0005504
414 Ga0501038_0073460
415 Ga0501039_0009931
416 Ga0501040_0861804
417 Ga0501041_0014717
418 Ga0501041_0058497
419 Ga0501041_0105530
420 Ga0501042_0009728
421 Ga0501042_0378377
422 Ga0501043_0472099
423 Ga0501046_0095859
424 Ga0501046_0847628
425 Ga0501048_0021321
426 Ga0501048_0071152
427 Ga0501048_0613706
428 Ga0501048_1077323
429 Ga0501071_0187320
430 Ga0501073_0348148
431 Ga0501074_0178234
432 Ga0501074_0398876
433 Ga0501075_0883194
434 Ga0501076_0022621
435 Ga0501076_0065714
436 Ga0501076_0079748
437 Ga0501076_0241845
438 Ga0501079_0522415
439 Ga0501080_0122535
440 Ga0501080_0153070
441 Ga0501080_1039485
442 Ga0501081_0033036
443 Ga0501081_0126395
444 Ga0501081_0423684
445 Ga0501035_0013519
446 Ga0501045_0209064
447 Ga0501045_0212287
448 nmdc:mga05p37_112181_c1
449 nmdc:mga05p37_1431074_c1
450 nmdc:mga05p37_16261_c1
451 nmdc:mga05p37_366640_c1
452 nmdc:mga05p37_96611_c1
453 nmdc:mga09592_143470_c1
454 nmdc:mga09592_33052_c1
455 nmdc:mga09592_343447_c1
456 nmdc:mga09592_65418_c1
457 nmdc:mga09592_862233_c1
458 nmdc:mga06r32_245251_c1
459 nmdc:mga06r32_349379_c1
460 nmdc:mga06r32_3507_c1
461 nmdc:mga06r32_459500_c1
462 nmdc:mga06r32_69030_c1
463 nmdc:mga06r32_774205_c1
464 nmdc:mga0n895_1276039_c1
465 nmdc:mga0n895_492361_c1
466 nmdc:mga0a205_58005_c1
467 Ga0495601_0009896
468 Ga0495619_0017331
469 Ga0501084_0166009
470 Ga0501084_0534706
471 Ga0501082_0211073
472 Ga0501082_0214581
473 Ga0501082_0408128
474 Ga0501082_0426720
475 Ga0530510_0000907
476 Ga0530510_0045889

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02834

LigT_PEase

LigT like Phosphoesterase

36

122

0.98

PF02834

LigT_PEase

LigT like Phosphoesterase

123

210

0.9

PF13563

2_5_RNA_ligase2

2'-5' RNA ligase superfamily

38

199

0.85

PF10469

AKAP7_NLS

AKAP7 2'5' RNA ligase-like domain

32

195

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h7f-assembly1.cif.gz_A crystal structure of mn-derivative drcpdase 0.9051 2 192
1vgj-assembly1.cif.gz_A crystal structure of 2'-5' rna ligase from pyrococcus horikoshii 0.8999 5 192
1vgj-assembly1.cif.gz_A crystal structure of 2'-5' rna ligase from pyrococcus horikoshii 0.8907 5 192
1iuh-assembly1.cif.gz_A crystal structure of tt0787 of thermus thermophilus hb8 0.8732 5 192
5h7f-assembly1.cif.gz_A crystal structure of mn-derivative drcpdase 0.8676 2 192
ID Description Score Start End Superfamily
5h7fA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.9051 2 192 3.90.1140.10
af_Q58963_1_173_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.903 5 187 3.90.1140.10
af_Q58963_1_173_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8884 5 187 3.90.1140.10
1vgjA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8859 5 192 3.90.1140.10
1vgjA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8813 5 192 3.90.1140.10
ID Description Score Start End GO Terms
AF-A0A7C4UK59-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9887 1 193 GO:0004113
GO:0008664
AF-A0A1F8Q0Z1-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9882 1 192 GO:0004113
GO:0008664
GO:0016874
AF-A0A7C4UK59-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9836 1 193 GO:0004113
GO:0008664
AF-E8N387-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9782 1 192 GO:0004113
GO:0008664
GO:0016874
AF-A0A1F8Q0Z1-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9781 1 192 GO:0004113
GO:0008664
GO:0016874

Map