F351119

General Info

Members Datasets Scaffolds Average Seq Length
238 164 238 109

Family's Representative Sequence

Representative Sequence 3300033179|Ga0307507_10462549|Ga0307507_104625492
Length 123
Sequence MGMAGRVGYNAGMSGTSDDVTLQGLVELLPPRIWYLTSNGQDMWCRRPYGFLFSTGQGAEAFAEAMGNGEQLFAIGLDAGALISDEVLGGLRDSAVTRLFIDPAVDPASGDVHGKILRLAPLT

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
72 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
75 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
76 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
80 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
86 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
87 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
89 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
90 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
96 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
97 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
104 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
109 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
110 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
121 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
122 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
123 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
124 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
125 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
126 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
127 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
128 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
129 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
130 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
131 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
144 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
145 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
146 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
147 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
148 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
149 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
150 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
151 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
152 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
153 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
154 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
155 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
156 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
157 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
158 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
159 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
160 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
161 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
162 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
163 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.18
Nodule 0
Rhizoplane 2.52
Rhizosphere 76.05
Stem 0
Stem Tuber 0
Unclassified 9.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100032468 3300005330 Bacteria 3261
2 Ga0068869_101094111 3300005334 Unclassified 697
3 Ga0068869_101180419 3300005334 Unclassified 672
4 Ga0070682_102047548 3300005337 Bacteria 504
5 Ga0070689_100079520 3300005340 Bacteria 2572
6 Ga0070689_100136901 3300005340 Unclassified 1967
7 Ga0070689_100312735 3300005340 Bacteria 1310
8 Ga0070687_100013073 3300005343 Bacteria 3687
9 Ga0070675_100989516 3300005354 Bacteria 772
10 Ga0070688_100393012 3300005365 Bacteria 1025
11 Ga0070688_100794166 3300005365 Unclassified 740
12 Ga0070700_100656620 3300005441 Bacteria 829
13 Ga0070694_100385766 3300005444 Unclassified 1094
14 Ga0070678_100042663 3300005456 Bacteria 3226
15 Ga0070681_11196028 3300005458 Archaea 682
16 Ga0070681_11867727 3300005458 Unclassified 528
17 Ga0070685_10663498 3300005466 Bacteria 757
18 Ga0070685_11123009 3300005466 Bacteria 595
19 Ga0070685_11415185 3300005466 Bacteria 534
20 Ga0070698_100001599 3300005471 Bacteria 25204
21 Ga0070698_101042210 3300005471 Bacteria 766
22 Ga0070698_102208332 3300005471 Unclassified 504
23 Ga0070679_100237783 3300005530 Bacteria 1780
24 Ga0070679_100624216 3300005530 Unclassified 1021
25 Ga0070684_100971961 3300005535 Bacteria 797
26 Ga0070697_100527718 3300005536 Bacteria 1034
27 Ga0070665_100004621 3300005548 Bacteria 14395
28 Ga0070704_100304535 3300005549 Unclassified 1329
29 Ga0068855_101293248 3300005563 Bacteria 755
30 Ga0068856_102041376 3300005614 Bacteria 583
31 Ga0070702_101578263 3300005615 Unclassified 542
32 Ga0068859_100921589 3300005617 Bacteria 958
33 Ga0068859_101191079 3300005617 Bacteria 839
34 Ga0068859_102510385 3300005617 Unclassified 567
35 Ga0068864_100319949 3300005618 Bacteria 1457
36 Ga0068864_100765625 3300005618 Bacteria 947
37 Ga0068866_10848870 3300005718 Unclassified 638
38 Ga0068861_100264379 3300005719 Bacteria 1474
39 Ga0068863_100282642 3300005841 Bacteria 1608
40 Ga0068863_100814733 3300005841 Bacteria 931
41 Ga0068860_100942698 3300005843 Bacteria 880
42 Ga0068860_102720634 3300005843 Bacteria 513
43 Ga0075362_10692247 3300006177 Bacteria 531
44 Ga0068871_101479832 3300006358 Unclassified 641
45 Ga0075430_100144704 3300006846 Bacteria 1980
46 Ga0075429_100024462 3300006880 Bacteria 5240
47 Ga0075429_100029766 3300006880 Bacteria 4744
48 Ga0075429_100250958 3300006880 Bacteria 1549
49 Ga0068865_100048136 3300006881 Bacteria 2933
50 Ga0097620_100921783 3300006931 Bacteria 958
51 Ga0097620_101190604 3300006931 Bacteria 839
52 Ga0097620_102510608 3300006931 Unclassified 567
53 Ga0075435_100221503 3300007076 Unclassified 1607
54 Ga0105245_10000061 3300009098 Bacteria 118794
55 Ga0105245_10357990 3300009098 Bacteria 1448
56 Ga0114129_13273009 3300009147 Bacteria 525
57 Ga0105243_11018921 3300009148 Bacteria 832
58 Ga0105242_12024725 3300009176 Bacteria 618
59 Ga0105248_11559800 3300009177 Bacteria 748
60 Ga0105237_12565956 3300009545 Unclassified 520
61 Ga0105238_11050175 3300009551 Unclassified 836
62 Ga0105249_10158038 3300009553 Bacteria 2188
63 Ga0157378_10132751 3300013297 Bacteria 2306
64 Ga0163163_10749229 3300014325 Bacteria 1040
65 Ga0163163_12069985 3300014325 Bacteria 629
66 Ga0157376_10013025 3300014969 Bacteria 6194
67 Ga0157376_11687673 3300014969 Unclassified 669
68 Ga0213876_10295218 3300021384 Bacteria 861
69 Ga0213876_10432228 3300021384 Bacteria 700
70 Ga0207643_10244915 3300025908 Bacteria 1103
71 Ga0207643_10372128 3300025908 Bacteria 900
72 Ga0207684_10115596 3300025910 Unclassified 2298
73 Ga0207707_11073724 3300025912 Unclassified 657
74 Ga0207660_11394599 3300025917 Unclassified 568
75 Ga0207662_10021504 3300025918 Bacteria 3688
76 Ga0207652_10190445 3300025921 Bacteria 1845
77 Ga0207652_10588417 3300025921 Bacteria 999
78 Ga0207652_10689568 3300025921 Unclassified 912
79 Ga0207687_10000080 3300025927 Bacteria 70391
80 Ga0207709_10531484 3300025935 Bacteria 922
81 Ga0207670_10029856 3300025936 Bacteria 3477
82 Ga0207670_10298105 3300025936 Unclassified 1261
83 Ga0207704_10316127 3300025938 Unclassified 1203
84 Ga0207689_10324614 3300025942 Unclassified 1278
85 Ga0207689_10916780 3300025942 Bacteria 739
86 Ga0207661_11376388 3300025944 Bacteria 648
87 Ga0207667_11127667 3300025949 Bacteria 767
88 Ga0207712_10306903 3300025961 Bacteria 1304
89 Ga0207708_10671315 3300026075 Bacteria 884
90 Ga0207708_10820936 3300026075 Bacteria 801
91 Ga0207708_10932867 3300026075 Bacteria 752
92 Ga0207708_11485432 3300026075 Unclassified 595
93 Ga0207702_10702842 3300026078 Bacteria 996
94 Ga0207641_10151280 3300026088 Bacteria 2102
95 Ga0207648_10768783 3300026089 Bacteria 895
96 Ga0207676_10662185 3300026095 Bacteria 1008
97 Ga0207676_12286329 3300026095 Bacteria 538
98 Ga0207675_100334109 3300026118 Bacteria 1482
99 Ga0207675_101409094 3300026118 Bacteria 718
100 Ga0207683_10116805 3300026121 Bacteria 2392
101 Ga0268266_10001054 3300028379 Bacteria 34564
102 Ga0268265_11124450 3300028380 Bacteria 781
103 Ga0268264_10396763 3300028381 Bacteria 1325
104 Ga0265319_1111652 3300028563 Bacteria 854
105 Ga0307517_10053193 3300028786 Bacteria 4037
106 Ga0265338_10017109 3300028800 Bacteria 7836
107 Ga0265332_10005949 3300031238 Bacteria 5580
108 Ga0265328_10399399 3300031239 Bacteria 539
109 Ga0265320_10462356 3300031240 Bacteria 560
110 Ga0265340_10377344 3300031247 Bacteria 626
111 Ga0307513_10034104 3300031456 Bacteria 5714
112 Ga0307513_10408570 3300031456 Bacteria 1090
113 Ga0307509_10000264 3300031507 Bacteria 86090
114 Ga0307509_10003161 3300031507 Bacteria 25509
115 Ga0307509_10079326 3300031507 Bacteria 3399
116 Ga0307509_10101431 3300031507 Bacteria 2913
117 Ga0307509_10182883 3300031507 Bacteria 1958
118 Ga0307509_10289915 3300031507 Bacteria 1392
119 Ga0307508_10252034 3300031616 Bacteria 1361
120 Ga0307508_10599379 3300031616 Bacteria 703
121 Ga0265314_10264732 3300031711 Bacteria 980
122 Ga0307516_10022202 3300031730 Bacteria 6522
123 Ga0307516_10043711 3300031730 Bacteria 4437
124 Ga0307406_10133873 3300031901 Bacteria 1744
125 Ga0307416_100095578 3300032002 Bacteria 2567
126 Ga0307507_10462549 3300033179 Bacteria 696
127 Ga0373949_0000092 3300035090 Bacteria 33651
128 Ga0373936_0000027 3300035113 Bacteria 119134
129 Ga0373941_0046680 3300035115 Bacteria 1361
130 Ga0373956_0061645 3300035119 Bacteria 1699
131 Ga0373961_0000029 3300035241 Bacteria 93421
132 Ga0395905_0099689 3300037471 Bacteria 2728
133 Ga0395905_0407814 3300037471 Bacteria 1254
134 Ga0395905_1256211 3300037471 Bacteria 644
135 Ga0395901_0276054 3300038443 Bacteria 1747
136 Ga0436365_0445825 3300039437 Bacteria 614
137 Ga0436365_0933007 3300039437 Bacteria 865
138 Ga0436365_1350304 3300039437 Bacteria 1204
139 Ga0436365_1572045 3300039437 Bacteria 1027
140 Ga0436363_1676295 3300039450 Bacteria 522
141 Ga0451789_0256152 3300041443 Unclassified 636
142 Ga0451789_0309372 3300041443 Bacteria 680
143 Ga0451807_1019676 3300041486 Bacteria 949
144 Ga0451853_4004591 3300041512 Bacteria 589
145 Ga0453684_0091604 3300044712 Bacteria 3752
146 Ga0451576_1706552 3300045051 Bacteria 652
147 Ga0495603_0792501 3300046455 Bacteria 541
148 Ga0495650_0032369 3300046471 Unclassified 2339
149 Ga0495594_0473218 3300046499 Unclassified 712
150 Ga0495658_0836184 3300046683 Bacteria 589
151 Ga0495686_0015764 3300047472 Bacteria 5147
152 Ga0496100_0939229 3300048903 Unclassified 680
153 Ga0496112_0193685 3300048915 Unclassified 1994
154 Ga0496115_0118047 3300048918 Bacteria 2182
155 Ga0501295_100193 3300049518 Unclassified 678
156 Ga0501298_064180 3300049521 Unclassified 783
157 Ga0501299_092508 3300049522 Bacteria 689
158 Ga0501033_0304837 3300049570 Bacteria 1121
159 Ga0501034_0216186 3300049571 Bacteria 1871
160 Ga0501034_0800316 3300049571 Unclassified 835
161 Ga0501043_0252090 3300049579 Unclassified 1359
162 Ga0501047_0022156 3300049581 Bacteria 6104
163 Ga0501047_0071834 3300049581 Bacteria 3331
164 Ga0501070_0025290 3300049586 Bacteria 4978
165 Ga0501070_0027925 3300049586 Bacteria 4734
166 Ga0501070_0195477 3300049586 Bacteria 1661
167 Ga0501070_0463647 3300049586 Unclassified 1020
168 Ga0501070_0473279 3300049586 Bacteria 1008
169 Ga0501071_0440531 3300049587 Bacteria 997
170 Ga0501072_0250653 3300049588 Bacteria 1410
171 Ga0501073_0228396 3300049589 Bacteria 1286
172 Ga0501073_0373653 3300049589 Bacteria 985
173 Ga0501074_0176418 3300049590 Bacteria 1525
174 Ga0501074_0424858 3300049590 Bacteria 942
175 Ga0501209_062858 3300049656 Bacteria 1040
176 Ga0501210_015885 3300049657 Bacteria 664
177 Ga0501216_117573 3300049660 Unclassified 603
178 Ga0501217_034231 3300049661 Bacteria 1266
179 Ga0501217_062136 3300049661 Bacteria 1000
180 Ga0501217_143249 3300049661 Unclassified 709
181 Ga0501217_245886 3300049661 Unclassified 575
182 Ga0501227_001432 3300049665 Bacteria 5327
183 Ga0501227_039703 3300049665 Bacteria 1159
184 Ga0501230_009533 3300049667 Bacteria 1496
185 Ga0501233_287303 3300049668 Unclassified 504
186 Ga0501235_030288 3300049669 Bacteria 1219
187 Ga0501236_008703 3300049670 Bacteria 1296
188 Ga0501221_040260 3300049704 Bacteria 1016
189 Ga0501225_0002098 3300049705 Bacteria 6198
190 Ga0501229_009695 3300049706 Bacteria 1211
191 Ga0501080_0232887 3300049742 Unclassified 1683
192 Ga0501080_0295972 3300049742 Bacteria 1469
193 Ga0501080_1645015 3300049742 Bacteria 543
194 Ga0501081_0333300 3300049743 Bacteria 1116
195 Ga0501083_0102873 3300049744 Unclassified 1883
196 Ga0501035_0969902 3300049822 Bacteria 670
197 Ga0501044_0102411 3300049823 Unclassified 2879
198 Ga0501044_0205381 3300049823 Unclassified 1927
199 Ga0501044_0684640 3300049823 Bacteria 912
200 Ga0501044_1308226 3300049823 Unclassified 591
201 nmdc:mga03683_621755_c1 3300050489 Bacteria 530
202 nmdc:mga09592_173851_c1 3300050508 Bacteria 1863
203 nmdc:mga09592_52370_c1 3300050508 Bacteria 3445
204 nmdc:mga0qj67_98890_c2 3300050509 Bacteria 1901
205 nmdc:mga06r32_1988946_c1 3300050510 Unclassified 515
206 nmdc:mga06r32_48888_c1 3300050510 Bacteria 4044
207 nmdc:mga0rr50_689873_c1 3300050513 Bacteria 872
208 nmdc:mga0rr50_987245_c1 3300050513 Bacteria 717
209 nmdc:mga08x19_563753_c1 3300050514 Bacteria 806
210 Ga0500578_0114754 3300053086 Bacteria 1696
211 Ga0500647_0449185 3300053091 Bacteria 510
212 Ga0500583_0013132 3300053092 Bacteria 3192
213 Ga0500566_0000594 3300053094 Bacteria 20260
214 Ga0500566_0207262 3300053094 Bacteria 985
215 Ga0500553_233583 3300053101 Bacteria 582
216 Ga0500554_092469 3300053102 Bacteria 1006
217 Ga0500554_221004 3300053102 Bacteria 630
218 Ga0500562_027717 3300053108 Bacteria 1487
219 Ga0500597_068459 3300053120 Bacteria 1532
220 Ga0500597_143940 3300053120 Unclassified 1026
221 Ga0500614_007239 3300053123 Bacteria 2337
222 Ga0500614_080166 3300053123 Bacteria 912
223 Ga0500617_252772 3300053124 Bacteria 595
224 Ga0500623_214977 3300053127 Bacteria 689
225 Ga0500658_0564200 3300053134 Unclassified 511
226 Ga0500564_107732 3300053138 Bacteria 1226
227 Ga0500568_0000289 3300053139 Bacteria 41443
228 Ga0500588_0163202 3300053146 Bacteria 812
229 Ga0500590_240163 3300053148 Bacteria 730
230 Ga0500603_001445 3300053150 Bacteria 5421
231 Ga0500603_103598 3300053150 Bacteria 848
232 Ga0500630_108699 3300053159 Bacteria 1250
233 Ga0500639_226106 3300053163 Bacteria 775
234 Ga0500636_0092345 3300053177 Bacteria 1732
235 Ga0500636_0307054 3300053177 Bacteria 778
236 Ga0500576_176892 3300053725 Bacteria 759
237 Ga0501082_0156200 3300060353 Bacteria 1982
238 Ga0501082_1524855 3300060353 Unclassified 584

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_0939229 Ga0496100_0939229_83_409 101
2 3300005334 Ga0068869_101180419 Ga0068869_1011804192 102
3 3300005471 Ga0070698_101042210 Ga0070698_1010422102 102
4 3300005471 Ga0070698_102208332 Ga0070698_1022083321 102
5 3300005549 Ga0070704_100304535 Ga0070704_1003045352 102
6 3300005615 Ga0070702_101578263 Ga0070702_1015782631 102
7 3300006358 Ga0068871_101479832 Ga0068871_1014798321 102
8 3300006881 Ga0068865_100048136 Ga0068865_1000481362 102
9 3300021384 Ga0213876_10432228 Ga0213876_104322282 102
10 3300025938 Ga0207704_10316127 Ga0207704_103161272 102
11 3300037471 Ga0395905_0407814 Ga0395905_0407814_792_1100 102
12 3300039437 Ga0436365_0445825 Ga0436365_0445825_16_324 102
13 3300005718 Ga0068866_10848870 Ga0068866_108488702 103
14 3300009545 Ga0105237_12565956 Ga0105237_125659562 103
15 3300009551 Ga0105238_11050175 Ga0105238_110501752 103
16 3300053127 Ga0500623_214977 Ga0500623_214977_115_429 104
17 3300005334 Ga0068869_101094111 Ga0068869_1010941111 107
18 3300005340 Ga0070689_100136901 Ga0070689_1001369012 107
19 3300005340 Ga0070689_100312735 Ga0070689_1003127352 107
20 3300005458 Ga0070681_11196028 Ga0070681_111960282 107
21 3300005530 Ga0070679_100237783 Ga0070679_1002377833 107
22 3300005617 Ga0068859_102510385 Ga0068859_1025103852 107
23 3300006880 Ga0075429_100029766 Ga0075429_1000297669 107
24 3300006880 Ga0075429_100250958 Ga0075429_1002509582 107
25 3300006931 Ga0097620_102510608 Ga0097620_1025106082 107
26 3300007076 Ga0075435_100221503 Ga0075435_1002215032 107
27 3300025936 Ga0207670_10298105 Ga0207670_102981052 107
28 3300025942 Ga0207689_10324614 Ga0207689_103246142 107
29 3300026075 Ga0207708_11485432 Ga0207708_114854321 107
30 3300026118 Ga0207675_101409094 Ga0207675_1014090941 107
31 3300031507 Ga0307509_10289915 Ga0307509_102899152 107
32 3300048915 Ga0496112_0193685 Ga0496112_0193685_1052_1375 107
33 3300049589 Ga0501073_0228396 Ga0501073_0228396_826_1149 107
34 3300050508 nmdc:mga09592_52370_c1 nmdc:mga09592_52370_c1_2991_3314 107
35 3300053177 Ga0500636_0307054 Ga0500636_0307054_172_495 107
36 3300005340 Ga0070689_100079520 Ga0070689_1000795202 108
37 3300005343 Ga0070687_100013073 Ga0070687_1000130732 108
38 3300005365 Ga0070688_100393012 Ga0070688_1003930122 108
39 3300005441 Ga0070700_100656620 Ga0070700_1006566202 108
40 3300005444 Ga0070694_100385766 Ga0070694_1003857662 108
41 3300005456 Ga0070678_100042663 Ga0070678_1000426635 108
42 3300005458 Ga0070681_11867727 Ga0070681_118677271 108
43 3300005466 Ga0070685_10663498 Ga0070685_106634981 108
44 3300005466 Ga0070685_11123009 Ga0070685_111230092 108
45 3300005471 Ga0070698_100001599 Ga0070698_10000159921 108
46 3300005530 Ga0070679_100624216 Ga0070679_1006242162 108
47 3300005536 Ga0070697_100527718 Ga0070697_1005277182 108
48 3300005548 Ga0070665_100004621 Ga0070665_10000462110 108
49 3300005563 Ga0068855_101293248 Ga0068855_1012932482 108
50 3300005617 Ga0068859_101191079 Ga0068859_1011910792 108
51 3300005618 Ga0068864_100319949 Ga0068864_1003199492 108
52 3300005618 Ga0068864_100765625 Ga0068864_1007656252 108
53 3300005843 Ga0068860_102720634 Ga0068860_1027206341 108
54 3300006846 Ga0075430_100144704 Ga0075430_1001447043 108
55 3300006880 Ga0075429_100024462 Ga0075429_1000244622 108
56 3300006931 Ga0097620_101190604 Ga0097620_1011906042 108
57 3300009098 Ga0105245_10000061 Ga0105245_1000006175 108
58 3300009098 Ga0105245_10357990 Ga0105245_103579902 108
59 3300009147 Ga0114129_13273009 Ga0114129_132730092 108
60 3300014325 Ga0163163_12069985 Ga0163163_120699852 108
61 3300014969 Ga0157376_10013025 Ga0157376_100130252 108
62 3300014969 Ga0157376_11687673 Ga0157376_116876731 108
63 3300021384 Ga0213876_10295218 Ga0213876_102952182 108
64 3300025908 Ga0207643_10244915 Ga0207643_102449152 108
65 3300025910 Ga0207684_10115596 Ga0207684_101155962 108
66 3300025912 Ga0207707_11073724 Ga0207707_110737241 108
67 3300025917 Ga0207660_11394599 Ga0207660_113945992 108
68 3300025918 Ga0207662_10021504 Ga0207662_100215042 108
69 3300025921 Ga0207652_10190445 Ga0207652_101904453 108
70 3300025921 Ga0207652_10689568 Ga0207652_106895682 108
71 3300025927 Ga0207687_10000080 Ga0207687_1000008023 108
72 3300025936 Ga0207670_10029856 Ga0207670_100298562 108
73 3300025942 Ga0207689_10916780 Ga0207689_109167802 108
74 3300025944 Ga0207661_11376388 Ga0207661_113763882 108
75 3300025949 Ga0207667_11127667 Ga0207667_111276672 108
76 3300026075 Ga0207708_10671315 Ga0207708_106713152 108
77 3300026075 Ga0207708_10820936 Ga0207708_108209362 108
78 3300026075 Ga0207708_10932867 Ga0207708_109328672 108
79 3300026078 Ga0207702_10702842 Ga0207702_107028422 108
80 3300026089 Ga0207648_10768783 Ga0207648_107687831 108
81 3300026095 Ga0207676_10662185 Ga0207676_106621852 108
82 3300028379 Ga0268266_10001054 Ga0268266_1000105413 108
83 3300028563 Ga0265319_1111652 Ga0265319_11116522 108
84 3300028800 Ga0265338_10017109 Ga0265338_100171093 108
85 3300031240 Ga0265320_10462356 Ga0265320_104623561 108
86 3300031247 Ga0265340_10377344 Ga0265340_103773442 108
87 3300031456 Ga0307513_10034104 Ga0307513_100341048 108
88 3300031507 Ga0307509_10003161 Ga0307509_1000316117 108
89 3300031711 Ga0265314_10264732 Ga0265314_102647322 108
90 3300031901 Ga0307406_10133873 Ga0307406_101338732 108
91 3300032002 Ga0307416_100095578 Ga0307416_1000955783 108
92 3300037471 Ga0395905_0099689 Ga0395905_0099689_459_785 108
93 3300037471 Ga0395905_1256211 Ga0395905_1256211_249_575 108
94 3300038443 Ga0395901_0276054 Ga0395901_0276054_953_1279 108
95 3300039437 Ga0436365_0933007 Ga0436365_0933007_339_665 108
96 3300039437 Ga0436365_1350304 Ga0436365_1350304_605_931 108
97 3300041443 Ga0451789_0256152 Ga0451789_0256152_123_479 108
98 3300041443 Ga0451789_0309372 Ga0451789_0309372_159_485 108
99 3300041512 Ga0451853_4004591 Ga0451853_4004591_110_436 108
100 3300044712 Ga0453684_0091604 Ga0453684_0091604_525_851 108
101 3300045051 Ga0451576_1706552 Ga0451576_1706552_309_635 108
102 3300046471 Ga0495650_0032369 Ga0495650_0032369_452_781 108
103 3300047472 Ga0495686_0015764 Ga0495686_0015764_645_971 108
104 3300048918 Ga0496115_0118047 Ga0496115_0118047_1640_1969 108
105 3300049518 Ga0501295_100193 Ga0501295_100193_236_562 108
106 3300049521 Ga0501298_064180 Ga0501298_064180_304_630 108
107 3300049522 Ga0501299_092508 Ga0501299_092508_114_440 108
108 3300049570 Ga0501033_0304837 Ga0501033_0304837_628_954 108
109 3300049571 Ga0501034_0216186 Ga0501034_0216186_1070_1396 108
110 3300049571 Ga0501034_0800316 Ga0501034_0800316_133_459 108
111 3300049579 Ga0501043_0252090 Ga0501043_0252090_756_1082 108
112 3300049581 Ga0501047_0022156 Ga0501047_0022156_2659_2985 108
113 3300049581 Ga0501047_0071834 Ga0501047_0071834_1445_1771 108
114 3300049586 Ga0501070_0025290 Ga0501070_0025290_3327_3653 108
115 3300049586 Ga0501070_0027925 Ga0501070_0027925_2175_2501 108
116 3300049586 Ga0501070_0195477 Ga0501070_0195477_389_715 108
117 3300049586 Ga0501070_0463647 Ga0501070_0463647_24_350 108
118 3300049586 Ga0501070_0473279 Ga0501070_0473279_135_461 108
119 3300049587 Ga0501071_0440531 Ga0501071_0440531_388_714 108
120 3300049588 Ga0501072_0250653 Ga0501072_0250653_379_705 108
121 3300049589 Ga0501073_0373653 Ga0501073_0373653_496_822 108
122 3300049590 Ga0501074_0176418 Ga0501074_0176418_213_539 108
123 3300049590 Ga0501074_0424858 Ga0501074_0424858_22_348 108
124 3300049656 Ga0501209_062858 Ga0501209_062858_553_879 108
125 3300049657 Ga0501210_015885 Ga0501210_015885_16_342 108
126 3300049660 Ga0501216_117573 Ga0501216_117573_180_506 108
127 3300049661 Ga0501217_034231 Ga0501217_034231_596_922 108
128 3300049661 Ga0501217_062136 Ga0501217_062136_323_649 108
129 3300049661 Ga0501217_143249 Ga0501217_143249_16_342 108
130 3300049665 Ga0501227_001432 Ga0501227_001432_3221_3547 108
131 3300049665 Ga0501227_039703 Ga0501227_039703_797_1123 108
132 3300049667 Ga0501230_009533 Ga0501230_009533_928_1254 108
133 3300049668 Ga0501233_287303 Ga0501233_287303_17_343 108
134 3300049669 Ga0501235_030288 Ga0501235_030288_288_614 108
135 3300049670 Ga0501236_008703 Ga0501236_008703_450_776 108
136 3300049704 Ga0501221_040260 Ga0501221_040260_356_682 108
137 3300049705 Ga0501225_0002098 Ga0501225_0002098_5440_5766 108
138 3300049706 Ga0501229_009695 Ga0501229_009695_414_740 108
139 3300049742 Ga0501080_0232887 Ga0501080_0232887_83_409 108
140 3300049742 Ga0501080_0295972 Ga0501080_0295972_1094_1420 108
141 3300049742 Ga0501080_1645015 Ga0501080_1645015_40_366 108
142 3300049743 Ga0501081_0333300 Ga0501081_0333300_206_532 108
143 3300049744 Ga0501083_0102873 Ga0501083_0102873_1431_1757 108
144 3300049822 Ga0501035_0969902 Ga0501035_0969902_115_441 108
145 3300049823 Ga0501044_0102411 Ga0501044_0102411_2285_2611 108
146 3300049823 Ga0501044_0205381 Ga0501044_0205381_182_508 108
147 3300049823 Ga0501044_0684640 Ga0501044_0684640_196_522 108
148 3300049823 Ga0501044_1308226 Ga0501044_1308226_131_457 108
149 3300050508 nmdc:mga09592_173851_c1 nmdc:mga09592_173851_c1_283_627 108
150 3300050509 nmdc:mga0qj67_98890_c2 nmdc:mga0qj67_98890_c2_909_1253 108
151 3300050510 nmdc:mga06r32_1988946_c1 nmdc:mga06r32_1988946_c1_29_361 108
152 3300050510 nmdc:mga06r32_48888_c1 nmdc:mga06r32_48888_c1_2340_2684 108
153 3300050513 nmdc:mga0rr50_987245_c1 nmdc:mga0rr50_987245_c1_291_617 108
154 3300053120 Ga0500597_143940 Ga0500597_143940_386_712 108
155 3300053139 Ga0500568_0000289 Ga0500568_0000289_12626_12952 108
156 3300060353 Ga0501082_0156200 Ga0501082_0156200_1577_1903 108
157 3300060353 Ga0501082_1524855 Ga0501082_1524855_123_449 108
158 3300005614 Ga0068856_102041376 Ga0068856_1020413761 109
159 3300028786 Ga0307517_10053193 Ga0307517_100531934 109
160 3300031507 Ga0307509_10079326 Ga0307509_100793265 109
161 3300031507 Ga0307509_10101431 Ga0307509_101014313 109
162 3300035115 Ga0373941_0046680 Ga0373941_0046680_151_480 109
163 3300039437 Ga0436365_1572045 Ga0436365_1572045_560_892 109
164 3300053108 Ga0500562_027717 Ga0500562_027717_903_1232 109
165 3300053124 Ga0500617_252772 Ga0500617_252772_236_565 109
166 3300005365 Ga0070688_100794166 Ga0070688_1007941661 110
167 3300005535 Ga0070684_100971961 Ga0070684_1009719611 110
168 3300009177 Ga0105248_11559800 Ga0105248_115598001 110
169 3300025921 Ga0207652_10588417 Ga0207652_105884172 110
170 3300031238 Ga0265332_10005949 Ga0265332_100059494 110
171 3300031239 Ga0265328_10399399 Ga0265328_103993992 110
172 3300031456 Ga0307513_10408570 Ga0307513_104085701 110
173 3300031507 Ga0307509_10182883 Ga0307509_101828832 110
174 3300035090 Ga0373949_0000092 Ga0373949_0000092_1652_1984 110
175 3300035119 Ga0373956_0061645 Ga0373956_0061645_923_1255 110
176 3300035241 Ga0373961_0000029 Ga0373961_0000029_70292_70624 110
177 3300039450 Ga0436363_1676295 Ga0436363_1676295_110_442 110
178 3300046455 Ga0495603_0792501 Ga0495603_0792501_97_429 110
179 3300046683 Ga0495658_0836184 Ga0495658_0836184_243_575 110
180 3300053094 Ga0500566_0207262 Ga0500566_0207262_424_756 110
181 3300053101 Ga0500553_233583 Ga0500553_233583_199_531 110
182 3300053102 Ga0500554_221004 Ga0500554_221004_268_600 110
183 3300053120 Ga0500597_068459 Ga0500597_068459_1123_1455 110
184 3300053123 Ga0500614_007239 Ga0500614_007239_931_1263 110
185 3300053146 Ga0500588_0163202 Ga0500588_0163202_143_475 110
186 3300053150 Ga0500603_103598 Ga0500603_103598_108_440 110
187 3300053177 Ga0500636_0092345 Ga0500636_0092345_1303_1635 110
188 3300005330 Ga0070690_100032468 Ga0070690_1000324685 111
189 3300005337 Ga0070682_102047548 Ga0070682_1020475481 111
190 3300005354 Ga0070675_100989516 Ga0070675_1009895162 111
191 3300005466 Ga0070685_11415185 Ga0070685_114151851 111
192 3300005617 Ga0068859_100921589 Ga0068859_1009215892 111
193 3300005719 Ga0068861_100264379 Ga0068861_1002643791 111
194 3300005841 Ga0068863_100282642 Ga0068863_1002826422 111
195 3300005841 Ga0068863_100814733 Ga0068863_1008147331 111
196 3300005843 Ga0068860_100942698 Ga0068860_1009426982 111
197 3300006177 Ga0075362_10692247 Ga0075362_106922471 111
198 3300006931 Ga0097620_100921783 Ga0097620_1009217832 111
199 3300009148 Ga0105243_11018921 Ga0105243_110189212 111
200 3300009176 Ga0105242_12024725 Ga0105242_120247251 111
201 3300009553 Ga0105249_10158038 Ga0105249_101580383 111
202 3300013297 Ga0157378_10132751 Ga0157378_101327512 111
203 3300014325 Ga0163163_10749229 Ga0163163_107492292 111
204 3300025908 Ga0207643_10372128 Ga0207643_103721281 111
205 3300025935 Ga0207709_10531484 Ga0207709_105314842 111
206 3300025961 Ga0207712_10306903 Ga0207712_103069032 111
207 3300026088 Ga0207641_10151280 Ga0207641_101512802 111
208 3300026095 Ga0207676_12286329 Ga0207676_122863291 111
209 3300026118 Ga0207675_100334109 Ga0207675_1003341092 111
210 3300026121 Ga0207683_10116805 Ga0207683_101168053 111
211 3300028380 Ga0268265_11124450 Ga0268265_111244501 111
212 3300028381 Ga0268264_10396763 Ga0268264_103967632 111
213 3300031507 Ga0307509_10000264 Ga0307509_1000026442 111
214 3300031616 Ga0307508_10252034 Ga0307508_102520341 111
215 3300031616 Ga0307508_10599379 Ga0307508_105993791 111
216 3300031730 Ga0307516_10022202 Ga0307516_100222028 111
217 3300031730 Ga0307516_10043711 Ga0307516_100437112 111
218 3300033179 Ga0307507_10462549 Ga0307507_104625492 111
219 3300035113 Ga0373936_0000027 Ga0373936_0000027_41795_42130 111
220 3300041486 Ga0451807_1019676 Ga0451807_1019676_510_845 111
221 3300046499 Ga0495594_0473218 Ga0495594_0473218_287_622 111
222 3300049661 Ga0501217_245886 Ga0501217_245886_95_448 111
223 3300050489 nmdc:mga03683_621755_c1 nmdc:mga03683_621755_c1_20_355 111
224 3300050513 nmdc:mga0rr50_689873_c1 nmdc:mga0rr50_689873_c1_396_737 111
225 3300050514 nmdc:mga08x19_563753_c1 nmdc:mga08x19_563753_c1_403_744 111
226 3300053086 Ga0500578_0114754 Ga0500578_0114754_1312_1647 111
227 3300053091 Ga0500647_0449185 Ga0500647_0449185_19_354 111
228 3300053092 Ga0500583_0013132 Ga0500583_0013132_985_1338 111
229 3300053094 Ga0500566_0000594 Ga0500566_0000594_14623_14958 111
230 3300053102 Ga0500554_092469 Ga0500554_092469_521_856 111
231 3300053123 Ga0500614_080166 Ga0500614_080166_278_613 111
232 3300053134 Ga0500658_0564200 Ga0500658_0564200_12_362 111
233 3300053138 Ga0500564_107732 Ga0500564_107732_553_888 111
234 3300053148 Ga0500590_240163 Ga0500590_240163_323_658 111
235 3300053150 Ga0500603_001445 Ga0500603_001445_4360_4695 111
236 3300053159 Ga0500630_108699 Ga0500630_108699_819_1154 111
237 3300053163 Ga0500639_226106 Ga0500639_226106_179_514 111
238 3300053725 Ga0500576_176892 Ga0500576_176892_13_348 111

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z0r-assembly7.cif.gz_B crystal structure of hypothetical protein ttha0547 0.6244 21 107
2egg-assembly1.cif.gz_A crystal structure of shikimate 5-dehydrogenase (aroe) from geobacillus kaustophilus 0.5656 74 89
2z0r-assembly7.cif.gz_B crystal structure of hypothetical protein ttha0547 0.5492 21 107
1npy-assembly1.cif.gz_A structure of shikimate 5-dehydrogenase-like protein hi0607 0.5382 73 89
2yqj-assembly2.cif.gz_B crystal structure of uridine-diphospho-n-acetylglucosamine pyrophosphorylase from candida albicans, in the reaction-completed form 0.5055 68 89
ID Description Score Start End Superfamily
af_I1JTI7_63_164_3.40.1350.100 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.601 13 70 3.40.1350.100
af_Q2FW81_3_393_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.5888 63 89 3.90.550.10
af_Q4E247_214_357_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.5881 72 107 3.10.580.10
af_A4I8C4_215_363_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.5798 72 107 3.10.580.10
af_K7MS17_22_100_3.40.1350.100 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.5766 13 67 3.40.1350.100
ID Description Score Start End GO Terms
AF-A0A7Y6UG35-F1-model_v4 PAS domain-containing protein 0.8634 4 111
AF-A0A7Y6UG35-F1-model_v4 PAS domain-containing protein 0.8558 4 111
AF-A0A1P8WJE3-F1-model_v4 DUF2750 domain-containing protein 0.7251 19 107
AF-A0A517ZV96-F1-model_v4 Uncharacterized protein 0.7242 20 107
AF-A0A367W6B6-F1-model_v4 DUF2750 domain-containing protein 0.7239 19 92

Feature Viewer

pLDDT pTM Quality
71.15 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map