F350954

General Info

Members Datasets Scaffolds Average Seq Length
238 172 476 129

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10512125|Ga0157372_105121253
Length 151
Sequence MQNRWSRSSIAGSRRTKGERSMVKIVLTSVLVDDQEKALRFYTEKLGFVKKTEVPLGEHKWLTVVAPDDPDGVELVLEPDAHPAVQPFKRALVADGIPFTSFGVSDVQAEYERLKSAGVQFTQPPVAMGPVTTAVLDDTCGNLIQLAQKNL

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
97 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
98 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
99 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
100 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
111 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
115 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
132 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
133 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
146 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
158 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
161 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
162 2511231024 Pseudomonas sp. GM84 Isolate Nodule
163 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
164 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
165 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
166 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
167 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
168 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
169 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
170 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
171 2920879853 Kocuria salina CV6 Isolate Unclassified
172 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.12
Metatranscriptomes 1.26
Isolates 4.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0.84
Rhizoplane 6.3
Rhizosphere 85.29
Stem 0
Stem Tuber 0.42
Unclassified 7.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10512125 3300013307 Bacteria 1399
2 JGI24739J22299_10000020 3300001989 Bacteria 47202
3 JGI24737J22298_10001600 3300001990 Bacteria 8052
4 JGI24737J22298_10029765 3300001990 Bacteria 1711
5 JGI24735J21928_10000643 3300002067 Bacteria 12311
6 JGI24735J21928_10082568 3300002067 Bacteria 921
7 JGI24738J21930_10000078 3300002075 Bacteria 21184
8 rootH1_10064721 3300003316 Bacteria 5660
9 rootH2_10118489 3300003320 Unclassified 2982
10 rootL2_10060454 3300003322 Bacteria 1515
11 rootL2_10143064 3300003322 Bacteria 1561
12 Ga0065704_10365237 3300005289 Unclassified 792
13 Ga0070683_100006845 3300005329 Bacteria 9578
14 Ga0070683_100507806 3300005329 Bacteria 1152
15 Ga0070666_10839390 3300005335 Bacteria 678
16 Ga0070680_100276898 3300005336 Bacteria 1421
17 Ga0070682_101720091 3300005337 Unclassified 545
18 Ga0070673_101165250 3300005364 Bacteria 721
19 Ga0070659_100861957 3300005366 Bacteria 790
20 Ga0070713_101500390 3300005436 Bacteria 654
21 Ga0070713_101829529 3300005436 Bacteria 589
22 Ga0070711_100734961 3300005439 Bacteria 833
23 Ga0070662_100293677 3300005457 Bacteria 1318
24 Ga0070681_10032941 3300005458 Bacteria 5202
25 Ga0070681_10457718 3300005458 Unclassified 1188
26 Ga0070681_10751527 3300005458 Unclassified 892
27 Ga0070698_100110285 3300005471 Bacteria 2717
28 Ga0070698_100211852 3300005471 Bacteria 1872
29 Ga0070679_100014125 3300005530 Bacteria 7659
30 Ga0070684_100334272 3300005535 Unclassified 1392
31 Ga0068853_100039083 3300005539 Bacteria 4046
32 Ga0068853_100444205 3300005539 Bacteria 1219
33 Ga0068853_101288580 3300005539 Unclassified 706
34 Ga0070695_100201775 3300005545 Bacteria 1422
35 Ga0070693_100464513 3300005547 Bacteria 891
36 Ga0070665_100026856 3300005548 Bacteria 5799
37 Ga0070665_100923401 3300005548 Bacteria 885
38 Ga0068855_100037070 3300005563 Bacteria 5801
39 Ga0070664_100135016 3300005564 Bacteria 2169
40 Ga0068857_100001089 3300005577 Bacteria 21064
41 Ga0068857_100505902 3300005577 Unclassified 1134
42 Ga0068856_100004403 3300005614 Bacteria 14034
43 Ga0068856_102114751 3300005614 Unclassified 572
44 Ga0068852_100000025 3300005616 Bacteria 115410
45 Ga0068852_100040872 3300005616 Bacteria 3916
46 Ga0068852_101576158 3300005616 Bacteria 679
47 Ga0068859_100011357 3300005617 Bacteria 8960
48 Ga0081538_10020036 3300005981 Bacteria 4942
49 Ga0081538_10168229 3300005981 Bacteria 961
50 Ga0081540_1015755 3300005983 Bacteria 4770
51 Ga0070717_10006825 3300006028 Bacteria 8425
52 Ga0075432_10028142 3300006058 Bacteria 1938
53 Ga0070712_100696742 3300006175 Bacteria 866
54 Ga0075370_10714518 3300006353 Bacteria 609
55 Ga0075428_100036295 3300006844 Bacteria 5430
56 Ga0075430_100257711 3300006846 Bacteria 1445
57 Ga0075431_100116464 3300006847 Bacteria 2758
58 Ga0075431_100448134 3300006847 Bacteria 1287
59 Ga0075433_11185133 3300006852 Bacteria 663
60 Ga0075434_100189203 3300006871 Bacteria 2079
61 Ga0075434_101099687 3300006871 Bacteria 808
62 Ga0075429_100465790 3300006880 Bacteria 1107
63 Ga0097620_100011357 3300006931 Bacteria 8960
64 Ga0075435_100141358 3300007076 Bacteria 2020
65 Ga0105251_10023877 3300009011 Bacteria 3148
66 Ga0105244_10065290 3300009036 Bacteria 1824
67 Ga0105250_10006319 3300009092 Bacteria 5188
68 Ga0105240_10004910 3300009093 Bacteria 20124
69 Ga0105240_10008607 3300009093 Bacteria 14583
70 Ga0111539_10127432 3300009094 Bacteria 2982
71 Ga0111539_10146300 3300009094 Bacteria 2766
72 Ga0105247_10013498 3300009101 Bacteria 4898
73 Ga0105247_11769943 3300009101 Bacteria 513
74 Ga0114129_11340980 3300009147 Bacteria 885
75 Ga0105241_10000029 3300009174 Bacteria 125929
76 Ga0105241_10807144 3300009174 Bacteria 865
77 Ga0105242_10991223 3300009176 Unclassified 847
78 Ga0105237_11028499 3300009545 Unclassified 831
79 Ga0105238_10465557 3300009551 Bacteria 1262
80 Ga0105239_10076037 3300010375 Unclassified 3693
81 Ga0105239_12075676 3300010375 Unclassified 660
82 Ga0157371_10074929 3300013102 Bacteria 2397
83 Ga0157371_10075709 3300013102 Bacteria 2383
84 Ga0157371_10125675 3300013102 Bacteria 1824
85 Ga0157370_10000012 3300013104 Bacteria 201181
86 Ga0157370_10011216 3300013104 Bacteria 9397
87 Ga0157369_10000096 3300013105 Bacteria 121542
88 Ga0157369_10084885 3300013105 Bacteria 3384
89 Ga0157374_10592871 3300013296 Unclassified 1118
90 Ga0157374_10629919 3300013296 Bacteria 1083
91 Ga0157374_12106019 3300013296 Bacteria 591
92 Ga0157378_10010754 3300013297 Bacteria 8000
93 Ga0163162_10334281 3300013306 Bacteria 1647
94 Ga0157372_10000066 3300013307 Bacteria 113120
95 Ga0157372_10001939 3300013307 Bacteria 22453
96 Ga0157372_10141054 3300013307 Bacteria 2776
97 Ga0157372_10481333 3300013307 Bacteria 1447
98 Ga0157372_12032929 3300013307 Bacteria 660
99 Ga0157375_10066842 3300013308 Bacteria 3590
100 Ga0163163_10923324 3300014325 Bacteria 936
101 Ga0157376_10181687 3300014969 Bacteria 1923
102 Ga0206353_10552491 3300020082 Bacteria 589
103 Ga0207713_1099743 3300025735 Bacteria 1005
104 Ga0207710_10045929 3300025900 Bacteria 1949
105 Ga0207647_10000089 3300025904 Bacteria 69909
106 Ga0207654_10000039 3300025911 Bacteria 105913
107 Ga0207707_10033434 3300025912 Bacteria 4500
108 Ga0207707_10978547 3300025912 Unclassified 695
109 Ga0207695_10000028 3300025913 Bacteria 551835
110 Ga0207695_10170786 3300025913 Bacteria 2100
111 Ga0207663_10119324 3300025916 Bacteria 1803
112 Ga0207660_10036951 3300025917 Bacteria 3399
113 Ga0207652_10101311 3300025921 Bacteria 2544
114 Ga0207694_10171007 3300025924 Bacteria 1759
115 Ga0207700_11832177 3300025928 Bacteria 533
116 Ga0207664_10347469 3300025929 Bacteria 1312
117 Ga0207706_10007539 3300025933 Bacteria 10069
118 Ga0207711_11873233 3300025941 Bacteria 543
119 Ga0207661_10166434 3300025944 Bacteria 1916
120 Ga0207661_10242392 3300025944 Bacteria 1600
121 Ga0207661_10463038 3300025944 Bacteria 1156
122 Ga0207667_10055338 3300025949 Bacteria 4171
123 Ga0207667_10218526 3300025949 Bacteria 1953
124 Ga0207668_11405072 3300025972 Bacteria 629
125 Ga0207639_10241704 3300026041 Unclassified 1570
126 Ga0207639_10526494 3300026041 Bacteria 1083
127 Ga0207702_10133961 3300026078 Bacteria 2233
128 Ga0207702_11567568 3300026078 Unclassified 652
129 Ga0207648_10728965 3300026089 Bacteria 920
130 Ga0207674_10000133 3300026116 Bacteria 87556
131 Ga0207674_10524973 3300026116 Unclassified 1144
132 Ga0207698_10000029 3300026142 Bacteria 116462
133 Ga0207698_10171117 3300026142 Bacteria 1913
134 Ga0207428_10156362 3300027907 Bacteria 1734
135 Ga0268266_10020303 3300028379 Bacteria 5664
136 Ga0268266_10834104 3300028379 Bacteria 891
137 Ga0268266_11200348 3300028379 Bacteria 734
138 Ga0265325_10435803 3300031241 Bacteria 572
139 Ga0265316_10270765 3300031344 Bacteria 1243
140 Ga0307408_100694381 3300031548 Bacteria 914
141 Ga0307508_10140104 3300031616 Bacteria 2022
142 Ga0316575_10000629 3300031665 Bacteria 10407
143 Ga0316576_10009611 3300031727 Bacteria 6251
144 Ga0316578_10032817 3300031728 Bacteria 2969
145 Ga0316577_10101348 3300031733 Bacteria 1614
146 Ga0307410_11065413 3300031852 Bacteria 699
147 Ga0307406_11006021 3300031901 Bacteria 715
148 Ga0307406_11097383 3300031901 Bacteria 687
149 Ga0307407_10502005 3300031903 Bacteria 889
150 Ga0307412_11126210 3300031911 Bacteria 700
151 Ga0307409_100009947 3300031995 Bacteria 5874
152 Ga0307409_100258962 3300031995 Bacteria 1595
153 Ga0307409_100614574 3300031995 Bacteria 1076
154 Ga0307409_102602611 3300031995 Bacteria 534
155 Ga0307416_100348850 3300032002 Bacteria 1497
156 Ga0307414_10586350 3300032004 Bacteria 998
157 Ga0307414_11716349 3300032004 Bacteria 586
158 Ga0307411_10023444 3300032005 Bacteria 3657
159 Ga0307411_10364343 3300032005 Bacteria 1183
160 Ga0307415_100397355 3300032126 Bacteria 1176
161 Ga0316583_10027154 3300032133 Bacteria 2043
162 Ga0316585_10043904 3300032137 Bacteria 1428
163 Ga0316574_0038134 3300035398 Bacteria 2949
164 Ga0316574_0983617 3300035398 Unclassified 508
165 Ga0373931_1207305 3300035691 Bacteria 518
166 Ga0316582_0058999 3300036647 Bacteria 2455
167 Ga0316584_0042954 3300036712 Bacteria 3370
168 Ga0395900_1141265 3300037418 Bacteria 696
169 Ga0395901_0785104 3300038443 Bacteria 943
170 Ga0395901_0957912 3300038443 Bacteria 834
171 Ga0439446_0171366 3300042156 Bacteria 722
172 Ga0466972_0201820 3300044658 Bacteria 931
173 Ga0466965_0205396 3300044683 Bacteria 1046
174 Ga0466965_0499561 3300044683 Bacteria 682
175 Ga0466965_0870684 3300044683 Bacteria 524
176 Ga0466961_0235545 3300044693 Bacteria 1126
177 Ga0466963_0088094 3300044694 Bacteria 2111
178 Ga0466963_0253985 3300044694 Bacteria 1234
179 Ga0466963_0426555 3300044694 Bacteria 935
180 Ga0466963_0717936 3300044694 Bacteria 705
181 Ga0466970_0073029 3300044765 Bacteria 1846
182 Ga0466957_0078572 3300044842 Bacteria 2052
183 Ga0466957_0991044 3300044842 Bacteria 603
184 Ga0466960_0083458 3300044901 Bacteria 1615
185 Ga0466960_0241004 3300044901 Bacteria 1001
186 Ga0466960_0434425 3300044901 Bacteria 761
187 Ga0466959_0313233 3300045049 Bacteria 1074
188 Ga0466967_0025958 3300045976 Bacteria 4842
189 Ga0466967_0143475 3300045976 Bacteria 2226
190 Ga0495638_0114485 3300046460 Bacteria 1599
191 Ga0495650_0000331 3300046471 Bacteria 84807
192 Ga0495582_0270707 3300046473 Bacteria 975
193 Ga0495644_0188705 3300046523 Bacteria 793
194 Ga0495598_0187396 3300046537 Bacteria 741
195 Ga0495656_0132111 3300046615 Bacteria 1189
196 Ga0496102_0000287 3300048905 Bacteria 64356
197 Ga0496103_0000192 3300048906 Bacteria 60768
198 Ga0496104_1009380 3300048907 Bacteria 736
199 Ga0496108_0237514 3300048911 Bacteria 1585
200 Ga0496108_0285753 3300048911 Bacteria 1436
201 Ga0496109_0075907 3300048912 Bacteria 3090
202 Ga0496109_0445860 3300048912 Bacteria 1223
203 Ga0496110_0723488 3300048913 Bacteria 898
204 Ga0496111_0019038 3300048914 Bacteria 4762
205 Ga0496112_0210642 3300048915 Bacteria 1901
206 Ga0496113_0554770 3300048916 Bacteria 921
207 Ga0496114_0009118 3300048917 Bacteria 7865
208 Ga0496115_0174389 3300048918 Bacteria 1778
209 Ga0496115_0241496 3300048918 Bacteria 1489
210 Ga0496115_0416205 3300048918 Bacteria 1089
211 Ga0496118_0019964 3300048921 Bacteria 5964
212 Ga0496119_0016102 3300048922 Bacteria 5711
213 Ga0496124_0220226 3300048927 Bacteria 1428
214 Ga0501298_083868 3300049521 Bacteria 705
215 Ga0501034_0012940 3300049571 Bacteria 8601
216 Ga0501070_0340963 3300049586 Bacteria 1217
217 nmdc:mga06r32_1280479_c1 3300050510 Bacteria 677
218 nmdc:mga08y16_226721_c1 3300050511 Bacteria 1933
219 nmdc:mga0n895_202138_c1 3300050512 Bacteria 1014
220 nmdc:mga0rr50_418761_c1 3300050513 Bacteria 1133
221 nmdc:mga08x19_705551_c1 3300050514 Bacteria 716
222 nmdc:mga0a205_1042969_c1 3300050515 Bacteria 665
223 Ga0500559_0002832 3300053136 Bacteria 8761
224 Ga0587085_009978 3300059506 Bacteria 1250
225 Ga0587062_038662 3300059639 Bacteria 765
226 Ga0466962_0125418 3300061719 Bacteria 1240
227 Ga0530510_1546686 3300061734 Bacteria 509
228 2511373520 2511231024 Bacteria 5835885
229 2643942749 2643221587 Bacteria 7586415
230 2644430208 2643221677 Bacteria 7584031
231 2731908183 2731639228 Bacteria 4187555
232 2832005048 2832004796 Bacteria 6538017
233 2866068306 2866065130 Bacteria 6518152
234 2867507120 2867507094 Bacteria 6506033
235 2899376878 2899370129 Bacteria 6781179
236 2915768455 2915768154 Bacteria 8424322
237 2920882613 2920879853 Bacteria 4216831
238 8002785590 8002784119 Bacteria 9788632
239 Ga0157372_10512125
240 JGI24739J22299_10000020
241 JGI24737J22298_10001600
242 JGI24737J22298_10029765
243 JGI24735J21928_10000643
244 JGI24735J21928_10082568
245 JGI24738J21930_10000078
246 rootH1_10064721
247 rootH2_10118489
248 rootL2_10060454
249 rootL2_10143064
250 Ga0065704_10365237
251 Ga0070683_100006845
252 Ga0070683_100507806
253 Ga0070666_10839390
254 Ga0070680_100276898
255 Ga0070682_101720091
256 Ga0070673_101165250
257 Ga0070659_100861957
258 Ga0070713_101500390
259 Ga0070713_101829529
260 Ga0070711_100734961
261 Ga0070662_100293677
262 Ga0070681_10032941
263 Ga0070681_10457718
264 Ga0070681_10751527
265 Ga0070698_100110285
266 Ga0070698_100211852
267 Ga0070679_100014125
268 Ga0070684_100334272
269 Ga0068853_100039083
270 Ga0068853_100444205
271 Ga0068853_101288580
272 Ga0070695_100201775
273 Ga0070693_100464513
274 Ga0070665_100026856
275 Ga0070665_100923401
276 Ga0068855_100037070
277 Ga0070664_100135016
278 Ga0068857_100001089
279 Ga0068857_100505902
280 Ga0068856_100004403
281 Ga0068856_102114751
282 Ga0068852_100000025
283 Ga0068852_100040872
284 Ga0068852_101576158
285 Ga0068859_100011357
286 Ga0081538_10020036
287 Ga0081538_10168229
288 Ga0081540_1015755
289 Ga0070717_10006825
290 Ga0075432_10028142
291 Ga0070712_100696742
292 Ga0075370_10714518
293 Ga0075428_100036295
294 Ga0075430_100257711
295 Ga0075431_100116464
296 Ga0075431_100448134
297 Ga0075433_11185133
298 Ga0075434_100189203
299 Ga0075434_101099687
300 Ga0075429_100465790
301 Ga0097620_100011357
302 Ga0075435_100141358
303 Ga0105251_10023877
304 Ga0105244_10065290
305 Ga0105250_10006319
306 Ga0105240_10004910
307 Ga0105240_10008607
308 Ga0111539_10127432
309 Ga0111539_10146300
310 Ga0105247_10013498
311 Ga0105247_11769943
312 Ga0114129_11340980
313 Ga0105241_10000029
314 Ga0105241_10807144
315 Ga0105242_10991223
316 Ga0105237_11028499
317 Ga0105238_10465557
318 Ga0105239_10076037
319 Ga0105239_12075676
320 Ga0157371_10074929
321 Ga0157371_10075709
322 Ga0157371_10125675
323 Ga0157370_10000012
324 Ga0157370_10011216
325 Ga0157369_10000096
326 Ga0157369_10084885
327 Ga0157374_10592871
328 Ga0157374_10629919
329 Ga0157374_12106019
330 Ga0157378_10010754
331 Ga0163162_10334281
332 Ga0157372_10000066
333 Ga0157372_10001939
334 Ga0157372_10141054
335 Ga0157372_10481333
336 Ga0157372_12032929
337 Ga0157375_10066842
338 Ga0163163_10923324
339 Ga0157376_10181687
340 Ga0206353_10552491
341 Ga0207713_1099743
342 Ga0207710_10045929
343 Ga0207647_10000089
344 Ga0207654_10000039
345 Ga0207707_10033434
346 Ga0207707_10978547
347 Ga0207695_10000028
348 Ga0207695_10170786
349 Ga0207663_10119324
350 Ga0207660_10036951
351 Ga0207652_10101311
352 Ga0207694_10171007
353 Ga0207700_11832177
354 Ga0207664_10347469
355 Ga0207706_10007539
356 Ga0207711_11873233
357 Ga0207661_10166434
358 Ga0207661_10242392
359 Ga0207661_10463038
360 Ga0207667_10055338
361 Ga0207667_10218526
362 Ga0207668_11405072
363 Ga0207639_10241704
364 Ga0207639_10526494
365 Ga0207702_10133961
366 Ga0207702_11567568
367 Ga0207648_10728965
368 Ga0207674_10000133
369 Ga0207674_10524973
370 Ga0207698_10000029
371 Ga0207698_10171117
372 Ga0207428_10156362
373 Ga0268266_10020303
374 Ga0268266_10834104
375 Ga0268266_11200348
376 Ga0265325_10435803
377 Ga0265316_10270765
378 Ga0307408_100694381
379 Ga0307508_10140104
380 Ga0316575_10000629
381 Ga0316576_10009611
382 Ga0316578_10032817
383 Ga0316577_10101348
384 Ga0307410_11065413
385 Ga0307406_11006021
386 Ga0307406_11097383
387 Ga0307407_10502005
388 Ga0307412_11126210
389 Ga0307409_100009947
390 Ga0307409_100258962
391 Ga0307409_100614574
392 Ga0307409_102602611
393 Ga0307416_100348850
394 Ga0307414_10586350
395 Ga0307414_11716349
396 Ga0307411_10023444
397 Ga0307411_10364343
398 Ga0307415_100397355
399 Ga0316583_10027154
400 Ga0316585_10043904
401 Ga0316574_0038134
402 Ga0316574_0983617
403 Ga0373931_1207305
404 Ga0316582_0058999
405 Ga0316584_0042954
406 Ga0395900_1141265
407 Ga0395901_0785104
408 Ga0395901_0957912
409 Ga0439446_0171366
410 Ga0466972_0201820
411 Ga0466965_0205396
412 Ga0466965_0499561
413 Ga0466965_0870684
414 Ga0466961_0235545
415 Ga0466963_0088094
416 Ga0466963_0253985
417 Ga0466963_0426555
418 Ga0466963_0717936
419 Ga0466970_0073029
420 Ga0466957_0078572
421 Ga0466957_0991044
422 Ga0466960_0083458
423 Ga0466960_0241004
424 Ga0466960_0434425
425 Ga0466959_0313233
426 Ga0466967_0025958
427 Ga0466967_0143475
428 Ga0495638_0114485
429 Ga0495650_0000331
430 Ga0495582_0270707
431 Ga0495644_0188705
432 Ga0495598_0187396
433 Ga0495656_0132111
434 Ga0496102_0000287
435 Ga0496103_0000192
436 Ga0496104_1009380
437 Ga0496108_0237514
438 Ga0496108_0285753
439 Ga0496109_0075907
440 Ga0496109_0445860
441 Ga0496110_0723488
442 Ga0496111_0019038
443 Ga0496112_0210642
444 Ga0496113_0554770
445 Ga0496114_0009118
446 Ga0496115_0174389
447 Ga0496115_0241496
448 Ga0496115_0416205
449 Ga0496118_0019964
450 Ga0496119_0016102
451 Ga0496124_0220226
452 Ga0501298_083868
453 Ga0501034_0012940
454 Ga0501070_0340963
455 nmdc:mga06r32_1280479_c1
456 nmdc:mga08y16_226721_c1
457 nmdc:mga0n895_202138_c1
458 nmdc:mga0rr50_418761_c1
459 nmdc:mga08x19_705551_c1
460 nmdc:mga0a205_1042969_c1
461 Ga0500559_0002832
462 Ga0587085_009978
463 Ga0587062_038662
464 Ga0466962_0125418
465 Ga0530510_1546686
466 2511373520
467 2643942749
468 2644430208
469 2731908183
470 2832005048
471 2866068306
472 2867507120
473 2899376878
474 2915768455
475 2920882613
476 8002785590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

146

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.9982 1 126
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.975 1 126
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8671 1 128
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8589 1 128
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.854 1 125
ID Description Score Start End Superfamily
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9995 2 126 3.10.180.10
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.968 2 126 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.925 79 124 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9077 78 128 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8344 78 128 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A3G8JJ94-F1-model_v4 VOC domain-containing protein 1.003 1 127
AF-A0A229SX46-F1-model_v4 Bleomycin resistance protein 1.003 1 128
AF-A0A3C0M9R5-F1-model_v4 Bleomycin resistance protein 1.003 1 90
AF-A0A7H8JNQ5-F1-model_v4 VOC family protein 1.002 1 128
AF-A0A2S4XHS2-F1-model_v4 Bleomycin resistance protein 1.002 1 128

Map