F350856

General Info

Members Datasets Scaffolds Average Seq Length
238 159 476 199

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100529752|Ga0075428_1005297521
Length 199
Sequence MSSAMSKPSLDADTILKRAAPVTGQHAHEIQPFGHLVRMPIALSEHACKESVDNLNQLLADTMTLRDLYKKHHWQVAGPTFYQLHLLFDKHYDEQNEVVDAVAERIQLLGGVSVAMDVAETTLVPRAPKGREEVPVQVSRLLHAHEIVLKEARAMARRAAEAGDDGTNDLIVSAVIRRNELQVWFVAEHIVNVPIVEAS

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
85 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
140 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 2.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.68
Nodule 0
Rhizoplane 0.42
Rhizosphere 97.06
Stem 0
Stem Tuber 0
Unclassified 18.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100529752 3300006844 Unclassified 1260
2 SwRhRL2b_contig_1272632 2162886007 Unclassified 906
3 Ga0065704_10116284 3300005289 Unclassified 1856
4 Ga0065704_10351853 3300005289 Unclassified 809
5 Ga0065715_10025423 3300005293 Bacteria 1466
6 Ga0065715_10119031 3300005293 Bacteria 2293
7 Ga0065715_10227141 3300005293 Bacteria 1235
8 Ga0065715_10316128 3300005293 Archaea 1011
9 Ga0065707_10028377 3300005295 Bacteria 1360
10 Ga0065707_10421756 3300005295 Unclassified 830
11 Ga0070676_10079576 3300005328 Bacteria 1985
12 Ga0070690_100461871 3300005330 Bacteria 943
13 Ga0070670_100165072 3300005331 Bacteria 1920
14 Ga0070670_100457192 3300005331 Bacteria 1132
15 Ga0070670_100843894 3300005331 Bacteria 829
16 Ga0070670_101064076 3300005331 Bacteria 737
17 Ga0070677_10045902 3300005333 Bacteria 1745
18 Ga0068869_100294829 3300005334 Bacteria 1308
19 Ga0068869_100582578 3300005334 Bacteria 943
20 Ga0068869_100614608 3300005334 Unclassified 919
21 Ga0070666_10272426 3300005335 Bacteria 1202
22 Ga0070680_100012763 3300005336 Bacteria 6533
23 Ga0070680_100165649 3300005336 Bacteria 1858
24 Ga0070660_100556872 3300005339 Bacteria 957
25 Ga0070689_101064420 3300005340 Bacteria 722
26 Ga0070692_10204172 3300005345 Bacteria 1159
27 Ga0070675_100004236 3300005354 Bacteria 10910
28 Ga0070671_100275130 3300005355 Bacteria 1431
29 Ga0070674_100003979 3300005356 Bacteria 8371
30 Ga0070674_100026570 3300005356 Bacteria 3784
31 Ga0070673_100490962 3300005364 Bacteria 1109
32 Ga0070659_100360273 3300005366 Bacteria 1222
33 Ga0070703_10087591 3300005406 Archaea 1073
34 Ga0070714_100212238 3300005435 Bacteria 1775
35 Ga0070701_10151974 3300005438 Unclassified 1334
36 Ga0070705_100100882 3300005440 Bacteria 1822
37 Ga0070700_100096378 3300005441 Bacteria 1941
38 Ga0070700_100369588 3300005441 Bacteria 1069
39 Ga0070700_100570515 3300005441 Bacteria 882
40 Ga0070708_100504388 3300005445 Bacteria 1141
41 Ga0070662_100342621 3300005457 Bacteria 1223
42 Ga0068867_100039922 3300005459 Bacteria 3423
43 Ga0070685_10519590 3300005466 Bacteria 845
44 Ga0070706_100222973 3300005467 Bacteria 1760
45 Ga0070706_100464422 3300005467 Bacteria 1178
46 Ga0070707_100188087 3300005468 Bacteria 2013
47 Ga0070707_100446871 3300005468 Bacteria 1253
48 Ga0070698_100436524 3300005471 Unclassified 1244
49 Ga0070699_100074038 3300005518 Unclassified 2963
50 Ga0070699_100276751 3300005518 Bacteria 1503
51 Ga0070699_100383247 3300005518 Bacteria 1269
52 Ga0070699_100386866 3300005518 Bacteria 1263
53 Ga0070679_100310257 3300005530 Bacteria 1527
54 Ga0070697_100038514 3300005536 Bacteria 3863
55 Ga0070697_100221557 3300005536 Bacteria 1612
56 Ga0070697_100229028 3300005536 Bacteria 1585
57 Ga0070697_100264787 3300005536 Bacteria 1472
58 Ga0070697_101160649 3300005536 Bacteria 688
59 Ga0070672_100531459 3300005543 Bacteria 1019
60 Ga0070672_100625825 3300005543 Bacteria 939
61 Ga0070686_100310595 3300005544 Bacteria 1172
62 Ga0070695_100230923 3300005545 Archaea 1337
63 Ga0070696_100458242 3300005546 Unclassified 1007
64 Ga0070665_100833395 3300005548 Bacteria 935
65 Ga0070704_100280392 3300005549 Unclassified 1380
66 Ga0068855_100010089 3300005563 Bacteria 11385
67 Ga0070664_100131435 3300005564 Bacteria 2199
68 Ga0070664_100221872 3300005564 Bacteria 1691
69 Ga0068857_100114282 3300005577 Bacteria 2428
70 Ga0068854_100242762 3300005578 Bacteria 1435
71 Ga0068852_100012421 3300005616 Bacteria 6467
72 Ga0068859_100295271 3300005617 Bacteria 1714
73 Ga0068859_101014223 3300005617 Bacteria 912
74 Ga0068861_100415706 3300005719 Bacteria 1197
75 Ga0068870_10007673 3300005840 Bacteria 4826
76 Ga0068863_100147885 3300005841 Bacteria 2248
77 Ga0068863_100563029 3300005841 Bacteria 1126
78 Ga0068858_100618422 3300005842 Bacteria 1051
79 Ga0068858_100778458 3300005842 Bacteria 933
80 Ga0068862_101190393 3300005844 Bacteria 760
81 Ga0075432_10031127 3300006058 Bacteria 1847
82 Ga0070715_10183506 3300006163 Bacteria 1051
83 Ga0070716_100381492 3300006173 Bacteria 1007
84 Ga0075367_10004935 3300006178 Bacteria 6574
85 Ga0075367_10039631 3300006178 Bacteria 2747
86 Ga0075428_100033706 3300006844 Bacteria 5651
87 Ga0075430_100769771 3300006846 Unclassified 793
88 Ga0075430_101012588 3300006846 Unclassified 684
89 Ga0075431_100396406 3300006847 Bacteria 1382
90 Ga0075433_10035638 3300006852 Bacteria 4281
91 Ga0075433_10085632 3300006852 Bacteria 2782
92 Ga0075434_100000047 3300006871 Bacteria 57554
93 Ga0075434_100006845 3300006871 Bacteria 10495
94 Ga0075434_100108762 3300006871 Bacteria 2782
95 Ga0075434_100249664 3300006871 Unclassified 1793
96 Ga0075436_100000037 3300006914 Bacteria 83376
97 Ga0075436_100001843 3300006914 Bacteria 14538
98 Ga0097620_100295276 3300006931 Bacteria 1714
99 Ga0097620_101014197 3300006931 Bacteria 912
100 Ga0097620_101033626 3300006931 Unclassified 903
101 Ga0075435_100000027 3300007076 Bacteria 84051
102 Ga0075435_100012330 3300007076 Bacteria 6324
103 Ga0075435_100012405 3300007076 Bacteria 6309
104 Ga0075435_100021335 3300007076 Plasmid 4980
105 Ga0099794_10015137 3300007265 Bacteria 3398
106 Ga0099794_10034374 3300007265 Bacteria 2387
107 Ga0099795_10004736 3300007788 Bacteria 3543
108 Ga0099795_10098630 3300007788 Unclassified 1143
109 Ga0111539_10161091 3300009094 Bacteria 2624
110 Ga0111539_10515838 3300009094 Unclassified 1392
111 Ga0111539_10800732 3300009094 Bacteria 1097
112 Ga0105245_10504997 3300009098 Bacteria 1226
113 Ga0105245_11531250 3300009098 Bacteria 718
114 Ga0105247_10171696 3300009101 Bacteria 1442
115 Ga0114129_10212892 3300009147 Bacteria 2612
116 Ga0114129_10253994 3300009147 Bacteria 2359
117 Ga0114129_10442672 3300009147 Bacteria 1706
118 Ga0114129_10980493 3300009147 Unclassified 1066
119 Ga0105243_10961538 3300009148 Bacteria 854
120 Ga0105242_10541387 3300009176 Archaea 1114
121 Ga0105249_10185423 3300009553 Unclassified 2027
122 Ga0099796_10164301 3300010159 Unclassified 882
123 Ga0105239_10038693 3300010375 Bacteria 5226
124 Ga0105246_10141535 3300011119 Bacteria 1809
125 Ga0157370_10013643 3300013104 Bacteria 8358
126 Ga0157369_10017332 3300013105 Bacteria 8096
127 Ga0157378_11070552 3300013297 Bacteria 843
128 Ga0157372_10040591 3300013307 Bacteria 5140
129 Ga0163163_10024025 3300014325 Bacteria 5798
130 Ga0157380_10016177 3300014326 Bacteria 5496
131 Ga0157380_10033971 3300014326 Bacteria 3931
132 Ga0157380_10367296 3300014326 Bacteria 1353
133 Ga0157380_11279702 3300014326 Bacteria 780
134 Ga0157377_10023936 3300014745 Bacteria 3243
135 Ga0157379_10091775 3300014968 Bacteria 2724
136 Ga0206355_1049367 3300020076 Unclassified 886
137 Ga0206351_10796705 3300020077 Unclassified 802
138 Ga0206350_10326877 3300020080 Unclassified 784
139 Ga0154015_1510566 3300020610 Bacteria 955
140 Ga0224712_10100273 3300022467 Bacteria 1227
141 Ga0228598_1007592 3300024227 Unclassified 2205
142 Ga0207697_10062438 3300025315 Bacteria 1551
143 Ga0207653_10017365 3300025885 Unclassified 2265
144 Ga0207682_10023461 3300025893 Bacteria 2437
145 Ga0207642_10007361 3300025899 Bacteria 3713
146 Ga0207710_10029635 3300025900 Bacteria 2383
147 Ga0207685_10293332 3300025905 Unclassified 802
148 Ga0207645_10188880 3300025907 Unclassified 1353
149 Ga0207643_10023872 3300025908 Bacteria 3374
150 Ga0207684_10169125 3300025910 Bacteria 1884
151 Ga0207684_10187159 3300025910 Unclassified 1785
152 Ga0207660_10050384 3300025917 Bacteria 2956
153 Ga0207657_10386449 3300025919 Bacteria 1102
154 Ga0207646_10100886 3300025922 Bacteria 2587
155 Ga0207646_10155934 3300025922 Bacteria 2059
156 Ga0207681_10010540 3300025923 Bacteria 5663
157 Ga0207650_10535031 3300025925 Bacteria 981
158 Ga0207650_10667814 3300025925 Bacteria 877
159 Ga0207659_10002510 3300025926 Bacteria 10933
160 Ga0207709_10444629 3300025935 Unclassified 1001
161 Ga0207670_10242288 3300025936 Bacteria 1390
162 Ga0207669_10015056 3300025937 Bacteria 3891
163 Ga0207669_10296073 3300025937 Bacteria 1227
164 Ga0207704_10105769 3300025938 Bacteria 1888
165 Ga0207665_10083893 3300025939 Bacteria 2198
166 Ga0207691_10320535 3300025940 Bacteria 1329
167 Ga0207689_10061485 3300025942 Bacteria 3088
168 Ga0207689_10094476 3300025942 Bacteria 2456
169 Ga0207661_10228258 3300025944 Bacteria 1648
170 Ga0207679_10217345 3300025945 Bacteria 1606
171 Ga0207679_11303028 3300025945 Bacteria 667
172 Ga0207712_10208398 3300025961 Unclassified 1555
173 Ga0207668_10803400 3300025972 Bacteria 833
174 Ga0207658_10374464 3300025986 Bacteria 1246
175 Ga0207677_10747698 3300026023 Bacteria 871
176 Ga0207703_10416262 3300026035 Unclassified 1250
177 Ga0207708_10856717 3300026075 Unclassified 785
178 Ga0207641_10158481 3300026088 Bacteria 2056
179 Ga0207648_10042962 3300026089 Bacteria 3969
180 Ga0207648_10062882 3300026089 Bacteria 3236
181 Ga0207648_10848439 3300026089 Bacteria 852
182 Ga0207674_10075366 3300026116 Bacteria 3384
183 Ga0207675_100171122 3300026118 Bacteria 2076
184 Ga0207675_100177415 3300026118 Bacteria 2039
185 Ga0207675_100731847 3300026118 Bacteria 1000
186 Ga0207698_10315188 3300026142 Bacteria 1462
187 Ga0268266_10627961 3300028379 Unclassified 1033
188 Ga0268265_10027108 3300028380 Bacteria 4085
189 Ga0268265_10677649 3300028380 Unclassified 994
190 Ga0268264_10507221 3300028381 Bacteria 1177
191 Ga0265338_10352524 3300028800 Bacteria 1058
192 Ga0265340_10292700 3300031247 Unclassified 722
193 Ga0265316_10004874 3300031344 Bacteria 13219
194 Ga0307508_10165753 3300031616 Bacteria 1813
195 Ga0265314_10002015 3300031711 Bacteria 21569
196 Ga0265314_10080770 3300031711 Bacteria 2145
197 Ga0307510_10017941 3300033180 Bacteria 8339
198 Ga0373936_0183152 3300035113 Bacteria 919
199 Ga0373925_0003693 3300037068 Bacteria 11757
200 Ga0395898_0283939 3300037466 Bacteria 1579
201 Ga0395901_1323802 3300038443 Bacteria 681
202 Ga0466967_0222786 3300045976 Bacteria 1793
203 Ga0495644_0021958 3300046523 Bacteria 2433
204 Ga0495598_0151613 3300046537 Unclassified 809
205 Ga0495621_0124250 3300046539 Bacteria 1000
206 Ga0495621_0168693 3300046539 Bacteria 869
207 Ga0495622_0042207 3300046557 Bacteria 2121
208 Ga0495656_0150126 3300046615 Bacteria 1125
209 Ga0495625_0012881 3300046660 Bacteria 6758
210 Ga0495635_0476075 3300046663 Bacteria 824
211 Ga0495647_0021852 3300046681 Unclassified 2308
212 Ga0495649_0394277 3300046694 Bacteria 695
213 Ga0496106_0241780 3300048909 Bacteria 1442
214 nmdc:mga06z11_67542_c1 3300050494 Bacteria 1882
215 nmdc:mga05p37_137692_c1 3300050507 Unclassified 2992
216 nmdc:mga05p37_150331_c1 3300050507 Bacteria 2849
217 nmdc:mga05p37_268877_c1 3300050507 Unclassified 2038
218 nmdc:mga05p37_353782_c1 3300050507 Unclassified 1729
219 nmdc:mga09592_106798_c1 3300050508 Bacteria 2401
220 nmdc:mga0qj67_334916_c1 3300050509 Bacteria 1224
221 nmdc:mga06r32_154594_c1 3300050510 Bacteria 2274
222 nmdc:mga08y16_124309_c1 3300050511 Bacteria 2684
223 nmdc:mga08y16_272025_c1 3300050511 Unclassified 1748
224 nmdc:mga08y16_601414_c1 3300050511 Bacteria 1108
225 nmdc:mga0n895_1026602_c1 3300050512 Bacteria 805
226 nmdc:mga0n895_3_c1 3300050512 Bacteria 134167
227 nmdc:mga0n895_586968_c1 3300050512 Bacteria 1118
228 nmdc:mga0n895_58830_c1 3300050512 Bacteria 3791
229 nmdc:mga0rr50_2545_c1 3300050513 Bacteria 10329
230 nmdc:mga0rr50_303601_c1 3300050513 Bacteria 1336
231 nmdc:mga0rr50_324283_c1 3300050513 Bacteria 1292
232 nmdc:mga0rr50_35648_c1 3300050513 Bacteria 3575
233 nmdc:mga0rr50_39_c1 3300050513 Bacteria 84395
234 nmdc:mga0rr50_703159_c1 3300050513 Bacteria 863
235 nmdc:mga08x19_64_c2 3300050514 Bacteria 86912
236 nmdc:mga0a205_118497_c1 3300050515 Bacteria 2546
237 nmdc:mga0a205_130852_c1 3300050515 Unclassified 2410
238 Ga0500622_0025232 3300053156 Unclassified 3141
239 Ga0075428_100529752
240 SwRhRL2b_contig_1272632
241 Ga0065704_10116284
242 Ga0065704_10351853
243 Ga0065715_10025423
244 Ga0065715_10119031
245 Ga0065715_10227141
246 Ga0065715_10316128
247 Ga0065707_10028377
248 Ga0065707_10421756
249 Ga0070676_10079576
250 Ga0070690_100461871
251 Ga0070670_100165072
252 Ga0070670_100457192
253 Ga0070670_100843894
254 Ga0070670_101064076
255 Ga0070677_10045902
256 Ga0068869_100294829
257 Ga0068869_100582578
258 Ga0068869_100614608
259 Ga0070666_10272426
260 Ga0070680_100012763
261 Ga0070680_100165649
262 Ga0070660_100556872
263 Ga0070689_101064420
264 Ga0070692_10204172
265 Ga0070675_100004236
266 Ga0070671_100275130
267 Ga0070674_100003979
268 Ga0070674_100026570
269 Ga0070673_100490962
270 Ga0070659_100360273
271 Ga0070703_10087591
272 Ga0070714_100212238
273 Ga0070701_10151974
274 Ga0070705_100100882
275 Ga0070700_100096378
276 Ga0070700_100369588
277 Ga0070700_100570515
278 Ga0070708_100504388
279 Ga0070662_100342621
280 Ga0068867_100039922
281 Ga0070685_10519590
282 Ga0070706_100222973
283 Ga0070706_100464422
284 Ga0070707_100188087
285 Ga0070707_100446871
286 Ga0070698_100436524
287 Ga0070699_100074038
288 Ga0070699_100276751
289 Ga0070699_100383247
290 Ga0070699_100386866
291 Ga0070679_100310257
292 Ga0070697_100038514
293 Ga0070697_100221557
294 Ga0070697_100229028
295 Ga0070697_100264787
296 Ga0070697_101160649
297 Ga0070672_100531459
298 Ga0070672_100625825
299 Ga0070686_100310595
300 Ga0070695_100230923
301 Ga0070696_100458242
302 Ga0070665_100833395
303 Ga0070704_100280392
304 Ga0068855_100010089
305 Ga0070664_100131435
306 Ga0070664_100221872
307 Ga0068857_100114282
308 Ga0068854_100242762
309 Ga0068852_100012421
310 Ga0068859_100295271
311 Ga0068859_101014223
312 Ga0068861_100415706
313 Ga0068870_10007673
314 Ga0068863_100147885
315 Ga0068863_100563029
316 Ga0068858_100618422
317 Ga0068858_100778458
318 Ga0068862_101190393
319 Ga0075432_10031127
320 Ga0070715_10183506
321 Ga0070716_100381492
322 Ga0075367_10004935
323 Ga0075367_10039631
324 Ga0075428_100033706
325 Ga0075430_100769771
326 Ga0075430_101012588
327 Ga0075431_100396406
328 Ga0075433_10035638
329 Ga0075433_10085632
330 Ga0075434_100000047
331 Ga0075434_100006845
332 Ga0075434_100108762
333 Ga0075434_100249664
334 Ga0075436_100000037
335 Ga0075436_100001843
336 Ga0097620_100295276
337 Ga0097620_101014197
338 Ga0097620_101033626
339 Ga0075435_100000027
340 Ga0075435_100012330
341 Ga0075435_100012405
342 Ga0075435_100021335
343 Ga0099794_10015137
344 Ga0099794_10034374
345 Ga0099795_10004736
346 Ga0099795_10098630
347 Ga0111539_10161091
348 Ga0111539_10515838
349 Ga0111539_10800732
350 Ga0105245_10504997
351 Ga0105245_11531250
352 Ga0105247_10171696
353 Ga0114129_10212892
354 Ga0114129_10253994
355 Ga0114129_10442672
356 Ga0114129_10980493
357 Ga0105243_10961538
358 Ga0105242_10541387
359 Ga0105249_10185423
360 Ga0099796_10164301
361 Ga0105239_10038693
362 Ga0105246_10141535
363 Ga0157370_10013643
364 Ga0157369_10017332
365 Ga0157378_11070552
366 Ga0157372_10040591
367 Ga0163163_10024025
368 Ga0157380_10016177
369 Ga0157380_10033971
370 Ga0157380_10367296
371 Ga0157380_11279702
372 Ga0157377_10023936
373 Ga0157379_10091775
374 Ga0206355_1049367
375 Ga0206351_10796705
376 Ga0206350_10326877
377 Ga0154015_1510566
378 Ga0224712_10100273
379 Ga0228598_1007592
380 Ga0207697_10062438
381 Ga0207653_10017365
382 Ga0207682_10023461
383 Ga0207642_10007361
384 Ga0207710_10029635
385 Ga0207685_10293332
386 Ga0207645_10188880
387 Ga0207643_10023872
388 Ga0207684_10169125
389 Ga0207684_10187159
390 Ga0207660_10050384
391 Ga0207657_10386449
392 Ga0207646_10100886
393 Ga0207646_10155934
394 Ga0207681_10010540
395 Ga0207650_10535031
396 Ga0207650_10667814
397 Ga0207659_10002510
398 Ga0207709_10444629
399 Ga0207670_10242288
400 Ga0207669_10015056
401 Ga0207669_10296073
402 Ga0207704_10105769
403 Ga0207665_10083893
404 Ga0207691_10320535
405 Ga0207689_10061485
406 Ga0207689_10094476
407 Ga0207661_10228258
408 Ga0207679_10217345
409 Ga0207679_11303028
410 Ga0207712_10208398
411 Ga0207668_10803400
412 Ga0207658_10374464
413 Ga0207677_10747698
414 Ga0207703_10416262
415 Ga0207708_10856717
416 Ga0207641_10158481
417 Ga0207648_10042962
418 Ga0207648_10062882
419 Ga0207648_10848439
420 Ga0207674_10075366
421 Ga0207675_100171122
422 Ga0207675_100177415
423 Ga0207675_100731847
424 Ga0207698_10315188
425 Ga0268266_10627961
426 Ga0268265_10027108
427 Ga0268265_10677649
428 Ga0268264_10507221
429 Ga0265338_10352524
430 Ga0265340_10292700
431 Ga0265316_10004874
432 Ga0307508_10165753
433 Ga0265314_10002015
434 Ga0265314_10080770
435 Ga0307510_10017941
436 Ga0373936_0183152
437 Ga0373925_0003693
438 Ga0395898_0283939
439 Ga0395901_1323802
440 Ga0466967_0222786
441 Ga0495644_0021958
442 Ga0495598_0151613
443 Ga0495621_0124250
444 Ga0495621_0168693
445 Ga0495622_0042207
446 Ga0495656_0150126
447 Ga0495625_0012881
448 Ga0495635_0476075
449 Ga0495647_0021852
450 Ga0495649_0394277
451 Ga0496106_0241780
452 nmdc:mga06z11_67542_c1
453 nmdc:mga05p37_137692_c1
454 nmdc:mga05p37_150331_c1
455 nmdc:mga05p37_268877_c1
456 nmdc:mga05p37_353782_c1
457 nmdc:mga09592_106798_c1
458 nmdc:mga0qj67_334916_c1
459 nmdc:mga06r32_154594_c1
460 nmdc:mga08y16_124309_c1
461 nmdc:mga08y16_272025_c1
462 nmdc:mga08y16_601414_c1
463 nmdc:mga0n895_1026602_c1
464 nmdc:mga0n895_3_c1
465 nmdc:mga0n895_586968_c1
466 nmdc:mga0n895_58830_c1
467 nmdc:mga0rr50_2545_c1
468 nmdc:mga0rr50_303601_c1
469 nmdc:mga0rr50_324283_c1
470 nmdc:mga0rr50_35648_c1
471 nmdc:mga0rr50_39_c1
472 nmdc:mga0rr50_703159_c1
473 nmdc:mga08x19_64_c2
474 nmdc:mga0a205_118497_c1
475 nmdc:mga0a205_130852_c1
476 Ga0500622_0025232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

52

196

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lkp-assembly1.cif.gz_F-2 crystal structure of dps1 from the thermophilic non-heterocystous filamentous cyanobacterium thermoleptolyngbya sp. o-77 0.967 39 196
2vxx-assembly1.cif.gz_B x-ray structure of dpsa from thermosynechococcus elongatus 0.9608 27 196
6lkp-assembly1.cif.gz_F-2 crystal structure of dps1 from the thermophilic non-heterocystous filamentous cyanobacterium thermoleptolyngbya sp. o-77 0.9608 39 196
6sev-assembly1.cif.gz_C-2 structure of dps from listeria innocua soaked with 10 mm zinc for 120 minutes 0.9589 51 190
3ge4-assembly1.cif.gz_E crystal structure of ferritin:dna-binding protein dps from brucella melitensis 0.9564 35 192
ID Description Score Start End Superfamily
2c41C01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9657 46 190 1.20.1260.10
4cybA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.958 28 199 1.20.1260.10
1o9rA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9544 35 192 1.20.1260.10
4cybA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9525 28 199 1.20.1260.10
2d5kD00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9515 47 193 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A2T2T0M9-F1-model_v4 DNA starvation/stationary phase protection protein 0.9814 57 194 GO:0008199
GO:0016722
AF-A0A7V7ZDP5-F1-model_v4 DNA starvation/stationary phase protection protein 0.9811 25 192 GO:0008199
AF-A0A4U7EUU8-F1-model_v4 DNA starvation/stationary phase protection protein 0.9809 43 192 GO:0008199
AF-A0A1A7BWT8-F1-model_v4 Starvation-inducible DNA-binding protein 0.9777 24 191 GO:0003677
GO:0008199
AF-A0A2T2SX50-F1-model_v4 DNA starvation/stationary phase protection protein 0.9774 35 153 GO:0008199
GO:0016722

Map