F350774

General Info

Members Datasets Scaffolds Average Seq Length
238 191 476 254

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100013904|Ga0070696_1000139043
Length 286
Sequence MQRSLLHFDILSAGRDCQLSHTRFRIVESHLFSLNGKVALVTGATRGIGRSIAQELGRAGAKLSLCSRKAEACEQARSELAAEGIEVIAQPCNVSRKEELQALVDATRARWGGIDIVVCNAASNPHFGPLTDIPDDAFDKILTSNVKSVLWLAGMTLEEMAQRAKTTGKAGSFIVVGSIGGLIANTVIGAYGISKAADHHLVRNLAAEWGPRNVRVNAIAPGLVKTEFARALWEDPQRAAERIAATPLRRLGEPRDIGGIAVFLASDAAAFITGQCIVADGGVTIL

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
66 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
106 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
107 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
188 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
189 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
190 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
191 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 0
Isolates 2.1

Biome Distribution

Category Percentage (%)
Aerial Root 0.84
Bulb 0
Endosphere 3.36
Nodule 0
Rhizoplane 2.94
Rhizosphere 89.08
Stem 0
Stem Tuber 0
Unclassified 0.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100013904 3300005546 Bacteria 5404
2 JGI25406J46586_10013884 3300003203 Bacteria 3440
3 Ga0065707_10089461 3300005295 Bacteria 4361
4 Ga0070690_100117818 3300005330 Bacteria 1779
5 Ga0070670_100018954 3300005331 Bacteria 5900
6 Ga0070670_100332060 3300005331 Bacteria 1333
7 Ga0070680_100094248 3300005336 Bacteria 2481
8 Ga0070689_100043925 3300005340 Bacteria 3437
9 Ga0070692_10210703 3300005345 Bacteria 1143
10 Ga0070668_100020595 3300005347 Bacteria 4978
11 Ga0070668_100117384 3300005347 Bacteria 2123
12 Ga0070669_100690082 3300005353 Bacteria 861
13 Ga0070671_100011439 3300005355 Bacteria 7134
14 Ga0070673_100007957 3300005364 Bacteria 7026
15 Ga0070673_100134815 3300005364 Bacteria 2077
16 Ga0070713_100033172 3300005436 Bacteria 4133
17 Ga0070711_100050936 3300005439 Bacteria 2841
18 Ga0070711_100277815 3300005439 Bacteria 1324
19 Ga0070694_100139054 3300005444 Bacteria 1762
20 Ga0070681_10507179 3300005458 Bacteria 1120
21 Ga0070707_100281323 3300005468 Bacteria 1617
22 Ga0070707_100675415 3300005468 Bacteria 995
23 Ga0070698_100012866 3300005471 Bacteria 8862
24 Ga0070699_100036125 3300005518 Bacteria 4274
25 Ga0070699_100062170 3300005518 Bacteria 3236
26 Ga0070699_100405621 3300005518 Bacteria 1233
27 Ga0070697_100004743 3300005536 Bacteria 10420
28 Ga0070697_100028365 3300005536 Bacteria 4481
29 Ga0070686_100300007 3300005544 Bacteria 1191
30 Ga0070695_100005288 3300005545 Bacteria 7599
31 Ga0070696_100141555 3300005546 Bacteria 1758
32 Ga0070704_100198513 3300005549 Bacteria 1618
33 Ga0070664_100382035 3300005564 Bacteria 1286
34 Ga0070664_100405466 3300005564 Bacteria 1247
35 Ga0068854_100006853 3300005578 Bacteria 7263
36 Ga0068856_100204346 3300005614 Bacteria 1990
37 Ga0068852_100166967 3300005616 Bacteria 2060
38 Ga0068859_100527164 3300005617 Bacteria 1276
39 Ga0068864_100345854 3300005618 Bacteria 1402
40 Ga0068861_100234175 3300005719 Bacteria 1559
41 Ga0068858_100034828 3300005842 Bacteria 4670
42 Ga0068858_100447043 3300005842 Bacteria 1245
43 Ga0068860_100029196 3300005843 Bacteria 5304
44 Ga0068860_100223473 3300005843 Bacteria 1829
45 Ga0068862_100048512 3300005844 Bacteria 3625
46 Ga0068862_100142038 3300005844 Bacteria 2132
47 Ga0068862_100169485 3300005844 Bacteria 1954
48 Ga0081455_10077486 3300005937 Bacteria 2734
49 Ga0075363_100304634 3300006048 Bacteria 925
50 Ga0070715_10014531 3300006163 Bacteria 2918
51 Ga0070716_100232217 3300006173 Bacteria 1246
52 Ga0070712_100074773 3300006175 Bacteria 2435
53 Ga0075362_10076396 3300006177 Bacteria 1538
54 Ga0097621_100012510 3300006237 Bacteria 6295
55 Ga0075428_100023778 3300006844 Bacteria 6781
56 Ga0075428_100100248 3300006844 Bacteria 3158
57 Ga0075430_100247282 3300006846 Bacteria 1478
58 Ga0075431_100010594 3300006847 Bacteria 9272
59 Ga0075433_10005183 3300006852 Bacteria 10210
60 Ga0075434_100002726 3300006871 Bacteria 15603
61 Ga0075429_100206738 3300006880 Bacteria 1720
62 Ga0075429_100664100 3300006880 Bacteria 913
63 Ga0075436_100000392 3300006914 Bacteria 28103
64 Ga0075436_100002751 3300006914 Bacteria 12085
65 Ga0075436_100011820 3300006914 Bacteria 5990
66 Ga0097620_100527083 3300006931 Bacteria 1276
67 Ga0075435_100000756 3300007076 Bacteria 20084
68 Ga0075435_100027056 3300007076 Bacteria 4483
69 Ga0099794_10057051 3300007265 Bacteria 1891
70 Ga0105240_10069611 3300009093 Bacteria 4354
71 Ga0105240_10705765 3300009093 Unclassified 1101
72 Ga0111539_10080191 3300009094 Bacteria 3840
73 Ga0105243_10000400 3300009148 Bacteria 45768
74 Ga0105243_10658214 3300009148 Bacteria 1016
75 Ga0105241_10287615 3300009174 Bacteria 1406
76 Ga0105242_10730538 3300009176 Bacteria 972
77 Ga0105248_10269727 3300009177 Bacteria 1916
78 Ga0105237_10099490 3300009545 Bacteria 2900
79 Ga0105238_10211608 3300009551 Bacteria 1915
80 Ga0105249_10011693 3300009553 Bacteria 7719
81 Ga0099796_10003794 3300010159 Bacteria 3562
82 Ga0105239_10175917 3300010375 Bacteria 2394
83 Ga0157373_10272225 3300013100 Bacteria 1199
84 Ga0163163_10192183 3300014325 Bacteria 2090
85 Ga0157376_10161632 3300014969 Bacteria 2031
86 Ga0183362_10002 3300015683 Bacteria 1432711
87 Ga0228598_1000191 3300024227 Bacteria 11135
88 Ga0207685_10028738 3300025905 Bacteria 1961
89 Ga0207695_10518991 3300025913 Unclassified 1073
90 Ga0207671_10534423 3300025914 Bacteria 935
91 Ga0207693_10073390 3300025915 Bacteria 2678
92 Ga0207660_10163185 3300025917 Bacteria 1721
93 Ga0207662_10180990 3300025918 Bacteria 1356
94 Ga0207646_10160102 3300025922 Bacteria 2031
95 Ga0207650_10004800 3300025925 Bacteria 9234
96 Ga0207650_10050719 3300025925 Bacteria 3070
97 Ga0207644_10018304 3300025931 Bacteria 4737
98 Ga0207644_10237844 3300025931 Bacteria 1449
99 Ga0207709_10000038 3300025935 Bacteria 266638
100 Ga0207665_10235687 3300025939 Bacteria 1347
101 Ga0207691_10087793 3300025940 Bacteria 2789
102 Ga0207711_10284779 3300025941 Bacteria 1522
103 Ga0207689_10326191 3300025942 Bacteria 1274
104 Ga0207679_10222562 3300025945 Bacteria 1588
105 Ga0207679_10559313 3300025945 Bacteria 1027
106 Ga0207651_10004958 3300025960 Bacteria 6787
107 Ga0207668_10176140 3300025972 Bacteria 1682
108 Ga0207640_10087420 3300025981 Bacteria 2148
109 Ga0207658_10232784 3300025986 Bacteria 1556
110 Ga0207658_10463555 3300025986 Bacteria 1123
111 Ga0207703_10679024 3300026035 Bacteria 979
112 Ga0207641_10003344 3300026088 Bacteria 14259
113 Ga0207676_10095992 3300026095 Bacteria 2446
114 Ga0207676_10286024 3300026095 Bacteria 1499
115 Ga0207676_10335507 3300026095 Bacteria 1393
116 Ga0207675_100200173 3300026118 Bacteria 1918
117 Ga0207675_100735468 3300026118 Bacteria 997
118 Ga0207428_10270777 3300027907 Bacteria 1262
119 Ga0268266_10107900 3300028379 Bacteria 2463
120 Ga0268265_10047872 3300028380 Bacteria 3206
121 Ga0268265_10095387 3300028380 Bacteria 2388
122 Ga0268265_10391455 3300028380 Bacteria 1282
123 Ga0268264_10141963 3300028381 Bacteria 2143
124 Ga0307509_10056063 3300031507 Bacteria 4184
125 Ga0307516_10010723 3300031730 Bacteria 10041
126 Ga0307410_10104945 3300031852 Bacteria 2033
127 Ga0307410_10273861 3300031852 Bacteria 1321
128 Ga0307412_10040987 3300031911 Bacteria 2998
129 Ga0307409_100042492 3300031995 Bacteria 3405
130 Ga0307416_100260567 3300032002 Bacteria 1694
131 Ga0307416_100389372 3300032002 Bacteria 1427
132 Ga0307414_10430554 3300032004 Bacteria 1152
133 Ga0307411_10361704 3300032005 Bacteria 1187
134 Ga0307411_10445944 3300032005 Bacteria 1081
135 Ga0373944_0068200 3300035089 Bacteria 1154
136 Ga0373923_0087446 3300035111 Bacteria 1359
137 Ga0373936_0083814 3300035113 Bacteria 1330
138 Ga0373953_0050948 3300035117 Bacteria 1673
139 Ga0373956_0081757 3300035119 Bacteria 1483
140 Ga0373957_0019192 3300035120 Bacteria 2403
141 Ga0373957_0059176 3300035120 Bacteria 1481
142 Ga0373924_0118048 3300035410 Bacteria 1150
143 Ga0373931_0174193 3300035691 Bacteria 1270
144 Ga0373933_0003453 3300035724 Bacteria 8794
145 Ga0373937_0017046 3300036401 Bacteria 6461
146 Ga0373937_0175156 3300036401 Bacteria 2013
147 Ga0373925_0308519 3300037068 Bacteria 1279
148 Ga0395901_0004691 3300038443 Bacteria 13785
149 Ga0451802_1882904 3300041460 Bacteria 1488
150 Ga0451853_3379393 3300041512 Bacteria 903
151 Ga0451577_0384483 3300042876 Bacteria 1274
152 Ga0466967_0018819 3300045976 Bacteria 5534
153 Ga0495592_0072855 3300046454 Bacteria 2498
154 Ga0495603_0224510 3300046455 Bacteria 1083
155 Ga0495651_0112587 3300046462 Bacteria 2010
156 Ga0495580_0220713 3300046472 Bacteria 1303
157 Ga0495582_0204214 3300046473 Bacteria 1129
158 Ga0495584_0162653 3300046491 Bacteria 1134
159 Ga0495630_0434485 3300046517 Bacteria 1006
160 Ga0495643_0063117 3300046522 Bacteria 1960
161 Ga0495652_0153394 3300046529 Bacteria 1796
162 Ga0495645_0428270 3300046543 Bacteria 838
163 Ga0495656_0003834 3300046615 Bacteria 5111
164 Ga0495635_0276172 3300046663 Bacteria 1129
165 Ga0495659_0025090 3300046664 Bacteria 2038
166 Ga0495599_0026338 3300046678 Bacteria 3643
167 Ga0495623_0121270 3300046679 Bacteria 1574
168 Ga0495613_0215757 3300046689 Bacteria 1348
169 Ga0495600_0155909 3300046809 Bacteria 1477
170 Ga0495604_0053702 3300047317 Bacteria 3112
171 Ga0495636_0168477 3300047318 Bacteria 990
172 Ga0495680_0057455 3300047322 Bacteria 3009
173 Ga0495680_0130575 3300047322 Bacteria 1846
174 Ga0495686_0000055 3300047472 Bacteria 255566
175 Ga0496100_0038665 3300048903 Bacteria 3025
176 Ga0496101_0057961 3300048904 Bacteria 2803
177 Ga0496102_0104329 3300048905 Bacteria 2637
178 Ga0496106_0176094 3300048909 Bacteria 1697
179 Ga0496112_0004394 3300048915 Bacteria 11927
180 Ga0496113_0258555 3300048916 Bacteria 1391
181 Ga0496124_0182572 3300048927 Bacteria 1613
182 Ga0496125_0062866 3300048928 Bacteria 2965
183 Ga0496125_0127688 3300048928 Bacteria 1798
184 Ga0501032_0001597 3300049569 Bacteria 18067
185 Ga0501033_0001163 3300049570 Bacteria 23809
186 Ga0501033_0001545 3300049570 Bacteria 20328
187 Ga0501034_0043947 3300049571 Bacteria 4519
188 Ga0501034_0081609 3300049571 Bacteria 3236
189 Ga0501036_0000136 3300049572 Bacteria 47600
190 Ga0501036_0003242 3300049572 Bacteria 12968
191 Ga0501037_0001626 3300049573 Bacteria 16328
192 Ga0501038_0000515 3300049574 Bacteria 33962
193 Ga0501038_0000957 3300049574 Bacteria 25820
194 Ga0501039_0004254 3300049575 Bacteria 10776
195 Ga0501040_0130969 3300049576 Bacteria 1764
196 Ga0501043_0009654 3300049579 Bacteria 7564
197 Ga0501046_0001441 3300049580 Bacteria 22888
198 Ga0501046_0063709 3300049580 Bacteria 2878
199 Ga0501047_0001382 3300049581 Bacteria 23829
200 Ga0501047_0015907 3300049581 Bacteria 7171
201 Ga0501048_0189563 3300049582 Bacteria 1457
202 Ga0501070_0183891 3300049586 Bacteria 1719
203 Ga0501071_0127973 3300049587 Bacteria 1886
204 Ga0501072_0001398 3300049588 Bacteria 18159
205 Ga0501074_0024833 3300049590 Bacteria 4353
206 Ga0501075_0019777 3300049591 Bacteria 4887
207 Ga0501075_0025863 3300049591 Bacteria 4314
208 Ga0501079_0000105 3300049741 Bacteria 43031
209 Ga0501080_0183377 3300049742 Bacteria 1925
210 Ga0501080_0430832 3300049742 Bacteria 1184
211 Ga0501081_0004063 3300049743 Bacteria 9373
212 Ga0501035_0002229 3300049822 Bacteria 19222
213 Ga0501044_0003356 3300049823 Bacteria 18054
214 Ga0501045_0070785 3300049824 Bacteria 2566
215 nmdc:mga0yw44_163708_c1 3300050492 Bacteria 1457
216 nmdc:mga0k408_85293_c1 3300050493 Bacteria 1854
217 nmdc:mga05p37_709048_c1 3300050507 Bacteria 1116
218 nmdc:mga09592_231881_c1 3300050508 Bacteria 1600
219 nmdc:mga06r32_314916_c1 3300050510 Bacteria 1550
220 nmdc:mga08y16_47725_c2 3300050511 Bacteria 1858
221 nmdc:mga0n895_4044_c1 3300050512 Bacteria 11932
222 nmdc:mga0rr50_6060_c1 3300050513 Bacteria 7306
223 nmdc:mga08x19_29071_c1 3300050514 Bacteria 3466
224 nmdc:mga08x19_564_c1 3300050514 Bacteria 24248
225 nmdc:mga08x19_87645_c1 3300050514 Bacteria 2051
226 nmdc:mga0a205_12783_c1 3300050515 Bacteria 7785
227 nmdc:mga0sz30_77579_c1 3300050516 Bacteria 1435
228 Ga0495619_0075138 3300053085 Bacteria 2267
229 Ga0500647_0042519 3300053091 Bacteria 2182
230 Ga0500616_0005067 3300053153 Bacteria 9095
231 Ga0500627_0000029 3300053158 Bacteria 94759
232 Ga0501084_0004454 3300054114 Bacteria 11436
233 Ga0501082_0009082 3300060353 Bacteria 8575
234 2644087105 2643221614 Bacteria 4260023
235 2644342059 2643221661 Bacteria 4267604
236 2644368346 2643221666 Bacteria 4265935
237 2990268733 2990265787 Bacteria 3943888
238 2993694560 2993693658 Bacteria 4040749
239 Ga0070696_100013904
240 JGI25406J46586_10013884
241 Ga0065707_10089461
242 Ga0070690_100117818
243 Ga0070670_100018954
244 Ga0070670_100332060
245 Ga0070680_100094248
246 Ga0070689_100043925
247 Ga0070692_10210703
248 Ga0070668_100020595
249 Ga0070668_100117384
250 Ga0070669_100690082
251 Ga0070671_100011439
252 Ga0070673_100007957
253 Ga0070673_100134815
254 Ga0070713_100033172
255 Ga0070711_100050936
256 Ga0070711_100277815
257 Ga0070694_100139054
258 Ga0070681_10507179
259 Ga0070707_100281323
260 Ga0070707_100675415
261 Ga0070698_100012866
262 Ga0070699_100036125
263 Ga0070699_100062170
264 Ga0070699_100405621
265 Ga0070697_100004743
266 Ga0070697_100028365
267 Ga0070686_100300007
268 Ga0070695_100005288
269 Ga0070696_100141555
270 Ga0070704_100198513
271 Ga0070664_100382035
272 Ga0070664_100405466
273 Ga0068854_100006853
274 Ga0068856_100204346
275 Ga0068852_100166967
276 Ga0068859_100527164
277 Ga0068864_100345854
278 Ga0068861_100234175
279 Ga0068858_100034828
280 Ga0068858_100447043
281 Ga0068860_100029196
282 Ga0068860_100223473
283 Ga0068862_100048512
284 Ga0068862_100142038
285 Ga0068862_100169485
286 Ga0081455_10077486
287 Ga0075363_100304634
288 Ga0070715_10014531
289 Ga0070716_100232217
290 Ga0070712_100074773
291 Ga0075362_10076396
292 Ga0097621_100012510
293 Ga0075428_100023778
294 Ga0075428_100100248
295 Ga0075430_100247282
296 Ga0075431_100010594
297 Ga0075433_10005183
298 Ga0075434_100002726
299 Ga0075429_100206738
300 Ga0075429_100664100
301 Ga0075436_100000392
302 Ga0075436_100002751
303 Ga0075436_100011820
304 Ga0097620_100527083
305 Ga0075435_100000756
306 Ga0075435_100027056
307 Ga0099794_10057051
308 Ga0105240_10069611
309 Ga0105240_10705765
310 Ga0111539_10080191
311 Ga0105243_10000400
312 Ga0105243_10658214
313 Ga0105241_10287615
314 Ga0105242_10730538
315 Ga0105248_10269727
316 Ga0105237_10099490
317 Ga0105238_10211608
318 Ga0105249_10011693
319 Ga0099796_10003794
320 Ga0105239_10175917
321 Ga0157373_10272225
322 Ga0163163_10192183
323 Ga0157376_10161632
324 Ga0183362_10002
325 Ga0228598_1000191
326 Ga0207685_10028738
327 Ga0207695_10518991
328 Ga0207671_10534423
329 Ga0207693_10073390
330 Ga0207660_10163185
331 Ga0207662_10180990
332 Ga0207646_10160102
333 Ga0207650_10004800
334 Ga0207650_10050719
335 Ga0207644_10018304
336 Ga0207644_10237844
337 Ga0207709_10000038
338 Ga0207665_10235687
339 Ga0207691_10087793
340 Ga0207711_10284779
341 Ga0207689_10326191
342 Ga0207679_10222562
343 Ga0207679_10559313
344 Ga0207651_10004958
345 Ga0207668_10176140
346 Ga0207640_10087420
347 Ga0207658_10232784
348 Ga0207658_10463555
349 Ga0207703_10679024
350 Ga0207641_10003344
351 Ga0207676_10095992
352 Ga0207676_10286024
353 Ga0207676_10335507
354 Ga0207675_100200173
355 Ga0207675_100735468
356 Ga0207428_10270777
357 Ga0268266_10107900
358 Ga0268265_10047872
359 Ga0268265_10095387
360 Ga0268265_10391455
361 Ga0268264_10141963
362 Ga0307509_10056063
363 Ga0307516_10010723
364 Ga0307410_10104945
365 Ga0307410_10273861
366 Ga0307412_10040987
367 Ga0307409_100042492
368 Ga0307416_100260567
369 Ga0307416_100389372
370 Ga0307414_10430554
371 Ga0307411_10361704
372 Ga0307411_10445944
373 Ga0373944_0068200
374 Ga0373923_0087446
375 Ga0373936_0083814
376 Ga0373953_0050948
377 Ga0373956_0081757
378 Ga0373957_0019192
379 Ga0373957_0059176
380 Ga0373924_0118048
381 Ga0373931_0174193
382 Ga0373933_0003453
383 Ga0373937_0017046
384 Ga0373937_0175156
385 Ga0373925_0308519
386 Ga0395901_0004691
387 Ga0451802_1882904
388 Ga0451853_3379393
389 Ga0451577_0384483
390 Ga0466967_0018819
391 Ga0495592_0072855
392 Ga0495603_0224510
393 Ga0495651_0112587
394 Ga0495580_0220713
395 Ga0495582_0204214
396 Ga0495584_0162653
397 Ga0495630_0434485
398 Ga0495643_0063117
399 Ga0495652_0153394
400 Ga0495645_0428270
401 Ga0495656_0003834
402 Ga0495635_0276172
403 Ga0495659_0025090
404 Ga0495599_0026338
405 Ga0495623_0121270
406 Ga0495613_0215757
407 Ga0495600_0155909
408 Ga0495604_0053702
409 Ga0495636_0168477
410 Ga0495680_0057455
411 Ga0495680_0130575
412 Ga0495686_0000055
413 Ga0496100_0038665
414 Ga0496101_0057961
415 Ga0496102_0104329
416 Ga0496106_0176094
417 Ga0496112_0004394
418 Ga0496113_0258555
419 Ga0496124_0182572
420 Ga0496125_0062866
421 Ga0496125_0127688
422 Ga0501032_0001597
423 Ga0501033_0001163
424 Ga0501033_0001545
425 Ga0501034_0043947
426 Ga0501034_0081609
427 Ga0501036_0000136
428 Ga0501036_0003242
429 Ga0501037_0001626
430 Ga0501038_0000515
431 Ga0501038_0000957
432 Ga0501039_0004254
433 Ga0501040_0130969
434 Ga0501043_0009654
435 Ga0501046_0001441
436 Ga0501046_0063709
437 Ga0501047_0001382
438 Ga0501047_0015907
439 Ga0501048_0189563
440 Ga0501070_0183891
441 Ga0501071_0127973
442 Ga0501072_0001398
443 Ga0501074_0024833
444 Ga0501075_0019777
445 Ga0501075_0025863
446 Ga0501079_0000105
447 Ga0501080_0183377
448 Ga0501080_0430832
449 Ga0501081_0004063
450 Ga0501035_0002229
451 Ga0501044_0003356
452 Ga0501045_0070785
453 nmdc:mga0yw44_163708_c1
454 nmdc:mga0k408_85293_c1
455 nmdc:mga05p37_709048_c1
456 nmdc:mga09592_231881_c1
457 nmdc:mga06r32_314916_c1
458 nmdc:mga08y16_47725_c2
459 nmdc:mga0n895_4044_c1
460 nmdc:mga0rr50_6060_c1
461 nmdc:mga08x19_29071_c1
462 nmdc:mga08x19_564_c1
463 nmdc:mga08x19_87645_c1
464 nmdc:mga0a205_12783_c1
465 nmdc:mga0sz30_77579_c1
466 Ga0495619_0075138
467 Ga0500647_0042519
468 Ga0500616_0005067
469 Ga0500627_0000029
470 Ga0501084_0004454
471 Ga0501082_0009082
472 2644087105
473 2644342059
474 2644368346
475 2990268733
476 2993694560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

37

237

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

43

284

0.95

PF08659

KR

KR domain

37

225

0.85

PF23441

32

286

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9756 7 251
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.974 8 254
4i08-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with nadph 0.9737 6 252
4cql-assembly1.cif.gz_F crystal structure of heterotetrameric human ketoacyl reductase complexed with nad 0.9732 10 254
3enn-assembly1.cif.gz_B 2.1a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis (p43212) 0.9722 3 252
ID Description Score Start End Superfamily
3ennB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9722 3 252 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.971 5 254 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9668 9 252 3.40.50.720
4iboB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9662 5 252 3.40.50.720
3awdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9662 6 254 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A246F5J6-F1-model_v4 Short-chain dehydrogenase 0.9938 3 258 GO:0016491
AF-A0A2E3XH32-F1-model_v4 Short-chain dehydrogenase 0.9934 3 255 GO:0016491
AF-A0A2D6C0W9-F1-model_v4 IMP dehydrogenase/GMP reductase domain-containing protein 0.9909 8 254 GO:0016491
AF-A0A7V8KM65-F1-model_v4 deleted 0.9907 4 254
AF-A0A437LZG7-F1-model_v4 SDR family oxidoreductase 0.9905 1 255 GO:0016491

Map