F350561

General Info

Members Datasets Scaffolds Average Seq Length
238 170 238 137

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10070717|rootH1_100707173
Length 166
Sequence VSPGAGVRRVPPRARARAAPDNTGMTDPVTDSPAAKQPTPFEMLGGLEGVRALVDRFYDLMDLEPEFAELRALHPTSLDGSRDKLAWFLTGWLGGPDLYIERFGHPRLRMRHFPYAIGIRERDQWLTCMGLAMAELGEAAGFTAFMQERLIQSFANTADHMRNRAG

Samples

Sample ID Description Type Environment
1 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
109 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
110 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
155 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
166 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
167 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
168 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.14
Nodule 0
Rhizoplane 5.88
Rhizosphere 82.35
Stem 0
Stem Tuber 0
Unclassified 4.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000364 3300002705 Bacteria 29276
2 JGI25154J39366_1000722 3300002738 Bacteria 14934
3 JGI25157J39369_1000018 3300002741 Bacteria 177410
4 rootH1_10070717 3300003316 Bacteria 2744
5 rootH2_10013669 3300003320 Bacteria 1740
6 Ga0055539_1000283 3300003752 Bacteria 28988
7 Ga0055539_1003944 3300003752 Bacteria 2013
8 Ga0055533_1000103 3300003756 Bacteria 107860
9 Ga0055525_1001205 3300003759 Bacteria 5755
10 Ga0055535_1012776 3300003761 Bacteria 1266
11 Ga0065704_10097629 3300005289 Bacteria 2385
12 Ga0065707_10085102 3300005295 Bacteria 6456
13 Ga0070683_100895802 3300005329 Bacteria 851
14 Ga0070680_100572529 3300005336 Unclassified 969
15 Ga0070682_101517380 3300005337 Bacteria 577
16 Ga0070660_100764528 3300005339 Bacteria 812
17 Ga0070661_100382397 3300005344 Bacteria 1110
18 Ga0070673_100306693 3300005364 Bacteria 1399
19 Ga0070688_100335966 3300005365 Bacteria 1102
20 Ga0070701_11179031 3300005438 Bacteria 542
21 Ga0070705_100573520 3300005440 Bacteria 869
22 Ga0070700_100855069 3300005441 Bacteria 737
23 Ga0070678_100674904 3300005456 Bacteria 929
24 Ga0068867_100447568 3300005459 Bacteria 1100
25 Ga0070707_101484179 3300005468 Unclassified 645
26 Ga0070698_100104803 3300005471 Bacteria 2798
27 Ga0070698_100194672 3300005471 Unclassified 1964
28 Ga0070698_100663305 3300005471 Bacteria 984
29 Ga0070699_100002867 3300005518 Bacteria 15369
30 Ga0070699_100046522 3300005518 Bacteria 3754
31 Ga0070699_100056083 3300005518 Bacteria 3411
32 Ga0070699_102207320 3300005518 Unclassified 502
33 Ga0070684_100644631 3300005535 Bacteria 986
34 Ga0070695_100534936 3300005545 Unclassified 911
35 Ga0068855_100003105 3300005563 Bacteria 20329
36 Ga0068855_100136598 3300005563 Bacteria 2797
37 Ga0068857_100003053 3300005577 Bacteria 13849
38 Ga0068857_100204072 3300005577 Bacteria 1802
39 Ga0068857_100213293 3300005577 Unclassified 1762
40 Ga0068857_100307301 3300005577 Bacteria 1463
41 Ga0068856_100005614 3300005614 Bacteria 12341
42 Ga0068852_100380489 3300005616 Bacteria 1385
43 Ga0068859_100040572 3300005617 Bacteria 4671
44 Ga0068861_100501688 3300005719 Unclassified 1097
45 Ga0068870_10276392 3300005840 Bacteria 1051
46 Ga0068863_101854573 3300005841 Bacteria 613
47 Ga0068862_100100701 3300005844 Bacteria 2527
48 Ga0068862_100604196 3300005844 Unclassified 1053
49 Ga0081539_10197829 3300005985 Unclassified 931
50 Ga0075427_10010427 3300006194 Bacteria 1391
51 Ga0075366_10009360 3300006195 Bacteria 5467
52 Ga0075370_10593614 3300006353 Bacteria 671
53 Ga0075428_100196175 3300006844 Bacteria 2183
54 Ga0075428_100471697 3300006844 Bacteria 1343
55 Ga0075430_100450168 3300006846 Bacteria 1063
56 Ga0075431_100059730 3300006847 Bacteria 3934
57 Ga0075431_101160976 3300006847 Bacteria 736
58 Ga0075429_100007205 3300006880 Bacteria 9651
59 Ga0075429_100195123 3300006880 Bacteria 1773
60 Ga0075429_100206238 3300006880 Unclassified 1722
61 Ga0075429_100465437 3300006880 Bacteria 1108
62 Ga0097620_100040571 3300006931 Bacteria 4671
63 Ga0105240_10046750 3300009093 Bacteria 5481
64 Ga0105240_10048445 3300009093 Bacteria 5370
65 Ga0105240_10129175 3300009093 Bacteria 3033
66 Ga0111539_10926854 3300009094 Unclassified 1013
67 Ga0105245_10287650 3300009098 Bacteria 1609
68 Ga0114129_10019826 3300009147 Bacteria 9569
69 Ga0114129_10307237 3300009147 Bacteria 2112
70 Ga0114129_10412248 3300009147 Bacteria 1779
71 Ga0114129_10453314 3300009147 Unclassified 1682
72 Ga0114129_13322220 3300009147 Unclassified 520
73 Ga0105243_10926497 3300009148 Unclassified 868
74 Ga0105243_11887352 3300009148 Bacteria 630
75 Ga0105237_10385229 3300009545 Bacteria 1407
76 Ga0105237_10686000 3300009545 Bacteria 1031
77 Ga0105249_10042010 3300009553 Bacteria 4157
78 Ga0105249_10654205 3300009553 Unclassified 1109
79 Ga0105249_10719734 3300009553 Bacteria 1059
80 Ga0105239_10039994 3300010375 Bacteria 5137
81 Ga0105246_10025844 3300011119 Bacteria 3829
82 Ga0105246_10299606 3300011119 Bacteria 1297
83 Ga0157369_10008425 3300013105 Bacteria 11825
84 Ga0157380_11722340 3300014326 Bacteria 685
85 Ga0157380_11801941 3300014326 Unclassified 671
86 Ga0157377_10327067 3300014745 Bacteria 1020
87 Ga0157376_10481051 3300014969 Bacteria 1217
88 Ga0182007_10034351 3300015262 Bacteria 1714
89 Ga0209674_100003 3300025226 Bacteria 2196646
90 Ga0209563_100141 3300025230 Bacteria 79513
91 Ga0207427_100546 3300025231 Bacteria 19253
92 Ga0209258_100895 3300025242 Bacteria 15468
93 Ga0209646_1000067 3300025246 Bacteria 241595
94 Ga0209026_1000033 3300025250 Bacteria 318512
95 Ga0209677_100133 3300025253 Bacteria 69526
96 Ga0209677_100196 3300025253 Bacteria 48682
97 Ga0209759_1000024 3300025256 Bacteria 318512
98 Ga0209759_1005120 3300025256 Bacteria 4674
99 Ga0207643_10583918 3300025908 Bacteria 718
100 Ga0207654_10068252 3300025911 Bacteria 2103
101 Ga0207695_10020265 3300025913 Bacteria 7621
102 Ga0207695_10079786 3300025913 Bacteria 3315
103 Ga0207671_10079710 3300025914 Bacteria 2454
104 Ga0207660_10670548 3300025917 Unclassified 846
105 Ga0207657_10400032 3300025919 Bacteria 1080
106 Ga0207649_10220896 3300025920 Bacteria 1349
107 Ga0207694_10006906 3300025924 Bacteria 8617
108 Ga0207687_11067270 3300025927 Bacteria 693
109 Ga0207709_10249634 3300025935 Bacteria 1295
110 Ga0207670_10392002 3300025936 Unclassified 1108
111 Ga0207661_10800921 3300025944 Bacteria 867
112 Ga0207667_10011171 3300025949 Bacteria 10453
113 Ga0207667_10056228 3300025949 Bacteria 4134
114 Ga0207712_10118513 3300025961 Unclassified 1998
115 Ga0207678_10706153 3300026067 Bacteria 888
116 Ga0207708_10130209 3300026075 Bacteria 1967
117 Ga0207702_10001078 3300026078 Bacteria 27950
118 Ga0207648_10372546 3300026089 Bacteria 1290
119 Ga0207674_10005131 3300026116 Bacteria 15626
120 Ga0207674_10202915 3300026116 Bacteria 1932
121 Ga0207674_10314246 3300026116 Bacteria 1516
122 Ga0207674_10338326 3300026116 Bacteria 1455
123 Ga0207674_10900024 3300026116 Bacteria 853
124 Ga0207675_100980840 3300026118 Unclassified 863
125 Ga0207698_10254341 3300026142 Bacteria 1610
126 Ga0209981_1006721 3300027378 Bacteria 1543
127 Ga0209999_1012828 3300027543 Bacteria 1519
128 Ga0209966_1000078 3300027695 Bacteria 42139
129 Ga0209966_1013618 3300027695 Bacteria 1508
130 Ga0268265_10179847 3300028380 Bacteria 1816
131 Ga0268265_10448605 3300028380 Bacteria 1204
132 Ga0268265_10658336 3300028380 Unclassified 1007
133 Ga0265338_10000557 3300028800 Bacteria 65338
134 Ga0265340_10033340 3300031247 Bacteria 2564
135 Ga0307408_100503109 3300031548 Bacteria 1061
136 Ga0307508_10644825 3300031616 Bacteria 664
137 Ga0307405_10192836 3300031731 Bacteria 1473
138 Ga0307405_10488096 3300031731 Bacteria 985
139 Ga0307405_10592466 3300031731 Unclassified 903
140 Ga0307413_10060754 3300031824 Bacteria 2328
141 Ga0307413_12137216 3300031824 Bacteria 507
142 Ga0307410_10044290 3300031852 Bacteria 2955
143 Ga0307410_10170803 3300031852 Unclassified 1638
144 Ga0307406_10205694 3300031901 Bacteria 1453
145 Ga0307406_10721216 3300031901 Bacteria 834
146 Ga0307407_10127624 3300031903 Bacteria 1622
147 Ga0307412_10166255 3300031911 Bacteria 1645
148 Ga0307412_10249321 3300031911 Bacteria 1378
149 Ga0307409_100539613 3300031995 Bacteria 1143
150 Ga0307416_100282621 3300032002 Unclassified 1637
151 Ga0307416_100303590 3300032002 Bacteria 1588
152 Ga0307416_100978831 3300032002 Bacteria 948
153 Ga0307411_10160670 3300032005 Bacteria 1682
154 Ga0307415_100063747 3300032126 Bacteria 2562
155 Ga0307415_102169584 3300032126 Bacteria 543
156 Ga0373959_0192530 3300034820 Bacteria 535
157 Ga0373934_0004083 3300035086 Bacteria 5382
158 Ga0316574_0076907 3300035398 Bacteria 2115
159 Ga0373927_0780368 3300035695 Bacteria 631
160 Ga0373925_0021087 3300037068 Bacteria 4747
161 Ga0395898_0006478 3300037466 Bacteria 12503
162 Ga0436364_0777906 3300037853 Bacteria 10645
163 Ga0395901_0013605 3300038443 Bacteria 8273
164 Ga0451577_0377574 3300042876 Unclassified 1286
165 Ga0451577_0753871 3300042876 Unclassified 880
166 Ga0453683_0067082 3300044673 Bacteria 2243
167 Ga0453683_0522356 3300044673 Bacteria 771
168 Ga0466963_0263091 3300044694 Bacteria 1211
169 Ga0466964_0000907 3300044706 Bacteria 9725
170 Ga0453684_0040357 3300044712 Bacteria 6339
171 Ga0453684_0418277 3300044712 Unclassified 1498
172 Ga0453684_0631874 3300044712 Bacteria 1170
173 Ga0453684_1108864 3300044712 Bacteria 835
174 Ga0466957_0992545 3300044842 Bacteria 603
175 Ga0451576_0006320 3300045051 Bacteria 14561
176 Ga0451576_0110752 3300045051 Bacteria 2857
177 Ga0451576_0141197 3300045051 Bacteria 2511
178 Ga0466967_0427559 3300045976 Bacteria 1292
179 Ga0495585_0395304 3300046492 Bacteria 666
180 Ga0495583_0000159 3300046506 Bacteria 113627
181 Ga0495606_0003437 3300046507 Bacteria 16806
182 Ga0495634_0502255 3300046642 Bacteria 711
183 Ga0495625_0011185 3300046660 Bacteria 7341
184 Ga0495671_0284178 3300046692 Bacteria 797
185 Ga0495649_0001310 3300046694 Bacteria 19011
186 Ga0495589_0006046 3300046794 Bacteria 6393
187 Ga0495683_0094232 3300047323 Bacteria 1447
188 Ga0496100_0104144 3300048903 Bacteria 1960
189 Ga0496101_0074051 3300048904 Bacteria 2503
190 Ga0496102_0186319 3300048905 Bacteria 1956
191 Ga0496104_0022516 3300048907 Bacteria 5788
192 Ga0496105_0077444 3300048908 Bacteria 2746
193 Ga0496106_0121711 3300048909 Bacteria 2040
194 Ga0496107_0062060 3300048910 Bacteria 2707
195 Ga0496108_0016323 3300048911 Bacteria 6057
196 Ga0496109_0086409 3300048912 Bacteria 2896
197 Ga0496110_0034099 3300048913 Bacteria 4407
198 Ga0496111_0006373 3300048914 Bacteria 7659
199 Ga0496112_0024542 3300048915 Bacteria 5775
200 Ga0496113_0289883 3300048916 Bacteria 1309
201 Ga0496114_0977480 3300048917 Bacteria 729
202 Ga0501291_135243 3300049514 Bacteria 546
203 Ga0501039_0363041 3300049575 Bacteria 1138
204 Ga0501040_0586503 3300049576 Unclassified 805
205 Ga0501048_1067209 3300049582 Bacteria 581
206 Ga0501071_0298049 3300049587 Bacteria 1222
207 Ga0501075_0303370 3300049591 Bacteria 1217
208 Ga0501076_0215406 3300049592 Bacteria 1570
209 Ga0501076_1610337 3300049592 Unclassified 533
210 Ga0501233_032231 3300049668 Bacteria 1191
211 Ga0501248_052555 3300049678 Bacteria 527
212 Ga0501079_0196735 3300049741 Bacteria 1574
213 Ga0501079_0353133 3300049741 Unclassified 1152
214 Ga0501081_0236240 3300049743 Bacteria 1332
215 Ga0501278_028523 3300049774 Bacteria 555
216 nmdc:mga0k408_54085_c1 3300050493 Bacteria 2327
217 nmdc:mga05p37_2044_c1 3300050507 Bacteria 17024
218 nmdc:mga05p37_459285_c1 3300050507 Bacteria 1472
219 nmdc:mga05p37_47017_c1 3300050507 Bacteria 5307
220 nmdc:mga05p37_481533_c1 3300050507 Bacteria 1429
221 nmdc:mga05p37_495776_c1 3300050507 Bacteria 1403
222 nmdc:mga09592_1271705_c1 3300050508 Unclassified 606
223 nmdc:mga09592_161553_c1 3300050508 Bacteria 1935
224 nmdc:mga09592_213458_c1 3300050508 Unclassified 1672
225 nmdc:mga09592_401_c1 3300050508 Bacteria 31784
226 nmdc:mga09592_53877_c1 3300050508 Bacteria 3398
227 nmdc:mga0qj67_234505_c1 3300050509 Bacteria 1489
228 nmdc:mga06r32_397031_c1 3300050510 Bacteria 1361
229 nmdc:mga06r32_80439_c1 3300050510 Bacteria 3171
230 nmdc:mga0a205_355428_c1 3300050515 Unclassified 1332
231 Ga0500651_0293809 3300053093 Bacteria 934
232 Ga0500589_077173 3300053147 Bacteria 1494
233 Ga0500636_0008626 3300053177 Bacteria 5905
234 Ga0590071_013502 3300059421 Bacteria 1912
235 Ga0501082_0235133 3300060353 Bacteria 1595
236 Ga0501082_1034692 3300060353 Bacteria 718
237 Ga0530510_0077882 3300061734 Bacteria 2409
238 Ga0530510_0226867 3300061734 Unclassified 1389

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032002 Ga0307416_100303590 Ga0307416_1003035902 127
2 3300027695 Ga0209966_1013618 Ga0209966_10136182 129
3 3300042876 Ga0451577_0753871 Ga0451577_0753871_167_598 129
4 3300044712 Ga0453684_0040357 Ga0453684_0040357_305_736 129
5 3300045051 Ga0451576_0006320 Ga0451576_0006320_9062_9493 129
6 3300049576 Ga0501040_0586503 Ga0501040_0586503_295_684 129
7 3300049741 Ga0501079_0196735 Ga0501079_0196735_42_431 129
8 3300049774 Ga0501278_028523 Ga0501278_028523_39_431 129
9 3300005289 Ga0065704_10097629 Ga0065704_100976292 130
10 3300005295 Ga0065707_10085102 Ga0065707_100851023 130
11 3300005336 Ga0070680_100572529 Ga0070680_1005725291 130
12 3300005364 Ga0070673_100306693 Ga0070673_1003066932 130
13 3300005438 Ga0070701_11179031 Ga0070701_111790312 130
14 3300005440 Ga0070705_100573520 Ga0070705_1005735202 130
15 3300005441 Ga0070700_100855069 Ga0070700_1008550691 130
16 3300005468 Ga0070707_101484179 Ga0070707_1014841792 130
17 3300005471 Ga0070698_100104803 Ga0070698_1001048034 130
18 3300005471 Ga0070698_100194672 Ga0070698_1001946723 130
19 3300005471 Ga0070698_100663305 Ga0070698_1006633052 130
20 3300005518 Ga0070699_100002867 Ga0070699_1000028679 130
21 3300005518 Ga0070699_100046522 Ga0070699_1000465223 130
22 3300005518 Ga0070699_100056083 Ga0070699_1000560833 130
23 3300005518 Ga0070699_102207320 Ga0070699_1022073201 130
24 3300005545 Ga0070695_100534936 Ga0070695_1005349362 130
25 3300005577 Ga0068857_100213293 Ga0068857_1002132932 130
26 3300005617 Ga0068859_100040572 Ga0068859_1000405725 130
27 3300005719 Ga0068861_100501688 Ga0068861_1005016882 130
28 3300005840 Ga0068870_10276392 Ga0068870_102763922 130
29 3300005841 Ga0068863_101854573 Ga0068863_1018545732 130
30 3300005844 Ga0068862_100100701 Ga0068862_1001007012 130
31 3300005844 Ga0068862_100604196 Ga0068862_1006041962 130
32 3300005985 Ga0081539_10197829 Ga0081539_101978292 130
33 3300006194 Ga0075427_10010427 Ga0075427_100104272 130
34 3300006844 Ga0075428_100196175 Ga0075428_1001961752 130
35 3300006844 Ga0075428_100471697 Ga0075428_1004716972 130
36 3300006846 Ga0075430_100450168 Ga0075430_1004501682 130
37 3300006847 Ga0075431_100059730 Ga0075431_1000597303 130
38 3300006847 Ga0075431_101160976 Ga0075431_1011609762 130
39 3300006880 Ga0075429_100007205 Ga0075429_1000072056 130
40 3300006880 Ga0075429_100195123 Ga0075429_1001951232 130
41 3300006880 Ga0075429_100206238 Ga0075429_1002062383 130
42 3300006880 Ga0075429_100465437 Ga0075429_1004654372 130
43 3300006931 Ga0097620_100040571 Ga0097620_1000405715 130
44 3300009094 Ga0111539_10926854 Ga0111539_109268542 130
45 3300009147 Ga0114129_10019826 Ga0114129_100198263 130
46 3300009147 Ga0114129_10307237 Ga0114129_103072372 130
47 3300009147 Ga0114129_10412248 Ga0114129_104122483 130
48 3300009147 Ga0114129_10453314 Ga0114129_104533143 130
49 3300009147 Ga0114129_13322220 Ga0114129_133222201 130
50 3300009148 Ga0105243_10926497 Ga0105243_109264972 130
51 3300009553 Ga0105249_10042010 Ga0105249_100420103 130
52 3300009553 Ga0105249_10654205 Ga0105249_106542052 130
53 3300009553 Ga0105249_10719734 Ga0105249_107197342 130
54 3300011119 Ga0105246_10025844 Ga0105246_100258443 130
55 3300011119 Ga0105246_10299606 Ga0105246_102996062 130
56 3300014326 Ga0157380_11722340 Ga0157380_117223402 130
57 3300014326 Ga0157380_11801941 Ga0157380_118019412 130
58 3300014745 Ga0157377_10327067 Ga0157377_103270672 130
59 3300025908 Ga0207643_10583918 Ga0207643_105839182 130
60 3300025917 Ga0207660_10670548 Ga0207660_106705482 130
61 3300025935 Ga0207709_10249634 Ga0207709_102496342 130
62 3300025936 Ga0207670_10392002 Ga0207670_103920022 130
63 3300025961 Ga0207712_10118513 Ga0207712_101185133 130
64 3300026075 Ga0207708_10130209 Ga0207708_101302094 130
65 3300026116 Ga0207674_10202915 Ga0207674_102029152 130
66 3300026116 Ga0207674_10900024 Ga0207674_109000242 130
67 3300026118 Ga0207675_100980840 Ga0207675_1009808402 130
68 3300028380 Ga0268265_10179847 Ga0268265_101798471 130
69 3300028380 Ga0268265_10448605 Ga0268265_104486052 130
70 3300028380 Ga0268265_10658336 Ga0268265_106583362 130
71 3300031548 Ga0307408_100503109 Ga0307408_1005031092 130
72 3300031731 Ga0307405_10192836 Ga0307405_101928362 130
73 3300031731 Ga0307405_10488096 Ga0307405_104880961 130
74 3300031731 Ga0307405_10592466 Ga0307405_105924661 130
75 3300031824 Ga0307413_10060754 Ga0307413_100607543 130
76 3300031824 Ga0307413_12137216 Ga0307413_121372161 130
77 3300031852 Ga0307410_10044290 Ga0307410_100442902 130
78 3300031852 Ga0307410_10170803 Ga0307410_101708033 130
79 3300031901 Ga0307406_10205694 Ga0307406_102056943 130
80 3300031901 Ga0307406_10721216 Ga0307406_107212162 130
81 3300031903 Ga0307407_10127624 Ga0307407_101276243 130
82 3300031911 Ga0307412_10166255 Ga0307412_101662552 130
83 3300031911 Ga0307412_10249321 Ga0307412_102493212 130
84 3300031995 Ga0307409_100539613 Ga0307409_1005396133 130
85 3300032002 Ga0307416_100282621 Ga0307416_1002826212 130
86 3300032002 Ga0307416_100978831 Ga0307416_1009788311 130
87 3300032005 Ga0307411_10160670 Ga0307411_101606702 130
88 3300032126 Ga0307415_100063747 Ga0307415_1000637472 130
89 3300032126 Ga0307415_102169584 Ga0307415_1021695841 130
90 3300042876 Ga0451577_0377574 Ga0451577_0377574_81_485 130
91 3300044673 Ga0453683_0067082 Ga0453683_0067082_103_498 130
92 3300044673 Ga0453683_0522356 Ga0453683_0522356_217_612 130
93 3300044712 Ga0453684_0418277 Ga0453684_0418277_522_926 130
94 3300044712 Ga0453684_0631874 Ga0453684_0631874_577_1008 130
95 3300044712 Ga0453684_1108864 Ga0453684_1108864_28_432 130
96 3300044842 Ga0466957_0992545 Ga0466957_0992545_114_509 130
97 3300045051 Ga0451576_0110752 Ga0451576_0110752_674_1105 130
98 3300045051 Ga0451576_0141197 Ga0451576_0141197_290_685 130
99 3300046642 Ga0495634_0502255 Ga0495634_0502255_131_544 130
100 3300049514 Ga0501291_135243 Ga0501291_135243_76_471 130
101 3300049592 Ga0501076_1610337 Ga0501076_1610337_115_510 130
102 3300049668 Ga0501233_032231 Ga0501233_032231_728_1132 130
103 3300049678 Ga0501248_052555 Ga0501248_052555_106_501 130
104 3300049741 Ga0501079_0353133 Ga0501079_0353133_351_764 130
105 3300050507 nmdc:mga05p37_2044_c1 nmdc:mga05p37_2044_c1_15386_15781 130
106 3300050507 nmdc:mga05p37_459285_c1 nmdc:mga05p37_459285_c1_182_577 130
107 3300050507 nmdc:mga05p37_47017_c1 nmdc:mga05p37_47017_c1_4716_5108 130
108 3300050507 nmdc:mga05p37_481533_c1 nmdc:mga05p37_481533_c1_489_962 130
109 3300050507 nmdc:mga05p37_495776_c1 nmdc:mga05p37_495776_c1_759_1154 130
110 3300050508 nmdc:mga09592_1271705_c1 nmdc:mga09592_1271705_c1_78_473 130
111 3300050508 nmdc:mga09592_161553_c1 nmdc:mga09592_161553_c1_199_591 130
112 3300050508 nmdc:mga09592_213458_c1 nmdc:mga09592_213458_c1_421_816 130
113 3300050508 nmdc:mga09592_401_c1 nmdc:mga09592_401_c1_27940_28335 130
114 3300050508 nmdc:mga09592_53877_c1 nmdc:mga09592_53877_c1_2111_2503 130
115 3300050509 nmdc:mga0qj67_234505_c1 nmdc:mga0qj67_234505_c1_454_849 130
116 3300050510 nmdc:mga06r32_397031_c1 nmdc:mga06r32_397031_c1_716_1174 130
117 3300050510 nmdc:mga06r32_80439_c1 nmdc:mga06r32_80439_c1_2084_2476 130
118 3300050515 nmdc:mga0a205_355428_c1 nmdc:mga0a205_355428_c1_469_864 130
119 3300059421 Ga0590071_013502 Ga0590071_013502_459_851 130
120 3300060353 Ga0501082_1034692 Ga0501082_1034692_36_431 130
121 3300061734 Ga0530510_0226867 Ga0530510_0226867_226_639 130
122 3300048903 Ga0496100_0104144 Ga0496100_0104144_1212_1622 132
123 3300048904 Ga0496101_0074051 Ga0496101_0074051_763_1173 132
124 3300048905 Ga0496102_0186319 Ga0496102_0186319_91_501 132
125 3300048907 Ga0496104_0022516 Ga0496104_0022516_4076_4750 132
126 3300048908 Ga0496105_0077444 Ga0496105_0077444_378_1052 132
127 3300048909 Ga0496106_0121711 Ga0496106_0121711_287_697 132
128 3300048910 Ga0496107_0062060 Ga0496107_0062060_931_1341 132
129 3300048911 Ga0496108_0016323 Ga0496108_0016323_5309_5719 132
130 3300048912 Ga0496109_0086409 Ga0496109_0086409_815_1489 132
131 3300048913 Ga0496110_0034099 Ga0496110_0034099_2738_3148 132
132 3300048914 Ga0496111_0006373 Ga0496111_0006373_1814_2224 132
133 3300048915 Ga0496112_0024542 Ga0496112_0024542_4863_5273 132
134 3300048916 Ga0496113_0289883 Ga0496113_0289883_127_537 132
135 3300048917 Ga0496114_0977480 Ga0496114_0977480_179_589 132
136 3300037068 Ga0373925_0021087 Ga0373925_0021087_336_740 133
137 3300049575 Ga0501039_0363041 Ga0501039_0363041_256_660 134
138 3300049582 Ga0501048_1067209 Ga0501048_1067209_162_566 134
139 3300049587 Ga0501071_0298049 Ga0501071_0298049_167_571 134
140 3300049591 Ga0501075_0303370 Ga0501075_0303370_462_866 134
141 3300049592 Ga0501076_0215406 Ga0501076_0215406_781_1185 134
142 3300049743 Ga0501081_0236240 Ga0501081_0236240_901_1305 134
143 3300060353 Ga0501082_0235133 Ga0501082_0235133_787_1191 134
144 3300061734 Ga0530510_0077882 Ga0530510_0077882_1504_1908 134
145 3300006353 Ga0075370_10593614 Ga0075370_105936142 135
146 3300027378 Ga0209981_1006721 Ga0209981_10067213 135
147 3300027543 Ga0209999_1012828 Ga0209999_10128282 135
148 3300027695 Ga0209966_1000078 Ga0209966_100007815 135
149 3300028800 Ga0265338_10000557 Ga0265338_1000055762 135
150 3300031247 Ga0265340_10033340 Ga0265340_100333403 135
151 3300035398 Ga0316574_0076907 Ga0316574_0076907_254_667 136
152 3300005459 Ga0068867_100447568 Ga0068867_1004475682 139
153 3300026089 Ga0207648_10372546 Ga0207648_103725462 139
154 3300035695 Ga0373927_0780368 Ga0373927_0780368_176_595 139
155 3300046492 Ga0495585_0395304 Ga0495585_0395304_177_596 139
156 3300046506 Ga0495583_0000159 Ga0495583_0000159_29028_29447 139
157 3300046507 Ga0495606_0003437 Ga0495606_0003437_2332_2751 139
158 3300046660 Ga0495625_0011185 Ga0495625_0011185_6023_6442 139
159 3300046692 Ga0495671_0284178 Ga0495671_0284178_121_540 139
160 3300046694 Ga0495649_0001310 Ga0495649_0001310_4019_4438 139
161 3300046794 Ga0495589_0006046 Ga0495589_0006046_3754_4173 139
162 3300047323 Ga0495683_0094232 Ga0495683_0094232_494_913 139
163 3300053093 Ga0500651_0293809 Ga0500651_0293809_439_858 139
164 3300053147 Ga0500589_077173 Ga0500589_077173_439_858 139
165 3300053177 Ga0500636_0008626 Ga0500636_0008626_3385_3804 139
166 3300037853 Ga0436364_0777906 Ga0436364_0777906_247_693 140
167 3300026142 Ga0207698_10254341 Ga0207698_102543412 141
168 3300003316 rootH1_10070717 rootH1_100707173 142
169 3300003320 rootH2_10013669 rootH2_100136692 142
170 3300003752 Ga0055539_1000283 Ga0055539_100028315 142
171 3300003756 Ga0055533_1000103 Ga0055533_100010388 142
172 3300003759 Ga0055525_1001205 Ga0055525_10012056 142
173 3300003761 Ga0055535_1012776 Ga0055535_10127761 142
174 3300005339 Ga0070660_100764528 Ga0070660_1007645282 142
175 3300005456 Ga0070678_100674904 Ga0070678_1006749042 142
176 3300005563 Ga0068855_100003105 Ga0068855_10000310511 142
177 3300005577 Ga0068857_100204072 Ga0068857_1002040723 142
178 3300006195 Ga0075366_10009360 Ga0075366_100093603 142
179 3300009093 Ga0105240_10129175 Ga0105240_101291754 142
180 3300009098 Ga0105245_10287650 Ga0105245_102876503 142
181 3300009545 Ga0105237_10686000 Ga0105237_106860002 142
182 3300015262 Ga0182007_10034351 Ga0182007_100343512 142
183 3300025226 Ga0209674_100003 Ga0209674_100003217 142
184 3300025230 Ga0209563_100141 Ga0209563_10014157 142
185 3300025242 Ga0209258_100895 Ga0209258_10089515 142
186 3300025253 Ga0209677_100133 Ga0209677_10013346 142
187 3300025927 Ga0207687_11067270 Ga0207687_110672702 142
188 3300025949 Ga0207667_10011171 Ga0207667_100111718 142
189 3300026116 Ga0207674_10314246 Ga0207674_103142461 142
190 3300031616 Ga0307508_10644825 Ga0307508_106448251 142
191 3300034820 Ga0373959_0192530 Ga0373959_0192530_46_474 142
192 3300037466 Ga0395898_0006478 Ga0395898_0006478_11964_12392 142
193 3300038443 Ga0395901_0013605 Ga0395901_0013605_3890_4318 142
194 3300044694 Ga0466963_0263091 Ga0466963_0263091_26_454 142
195 3300050493 nmdc:mga0k408_54085_c1 nmdc:mga0k408_54085_c1_784_1212 142
196 3300005337 Ga0070682_101517380 Ga0070682_1015173801 144
197 3300009093 Ga0105240_10046750 Ga0105240_100467504 144
198 3300009148 Ga0105243_11887352 Ga0105243_118873521 144
199 3300014969 Ga0157376_10481051 Ga0157376_104810512 144
200 3300025231 Ga0207427_100546 Ga0207427_10054620 144
201 3300025256 Ga0209759_1005120 Ga0209759_10051203 144
202 3300025913 Ga0207695_10079786 Ga0207695_100797862 144
203 3300035086 Ga0373934_0004083 Ga0373934_0004083_2236_2670 144
204 3300002705 JGI25156J39149_1000364 JGI25156J39149_100036413 145
205 3300002738 JGI25154J39366_1000722 JGI25154J39366_100072219 145
206 3300002741 JGI25157J39369_1000018 JGI25157J39369_1000018146 145
207 3300003752 Ga0055539_1003944 Ga0055539_10039442 145
208 3300005329 Ga0070683_100895802 Ga0070683_1008958022 145
209 3300005344 Ga0070661_100382397 Ga0070661_1003823972 145
210 3300005365 Ga0070688_100335966 Ga0070688_1003359662 145
211 3300005535 Ga0070684_100644631 Ga0070684_1006446312 145
212 3300005563 Ga0068855_100136598 Ga0068855_1001365982 145
213 3300005577 Ga0068857_100003053 Ga0068857_1000030539 145
214 3300005577 Ga0068857_100307301 Ga0068857_1003073012 145
215 3300005614 Ga0068856_100005614 Ga0068856_1000056148 145
216 3300005616 Ga0068852_100380489 Ga0068852_1003804892 145
217 3300009093 Ga0105240_10048445 Ga0105240_100484456 145
218 3300009545 Ga0105237_10385229 Ga0105237_103852292 145
219 3300010375 Ga0105239_10039994 Ga0105239_100399946 145
220 3300013105 Ga0157369_10008425 Ga0157369_100084258 145
221 3300025246 Ga0209646_1000067 Ga0209646_100006780 145
222 3300025250 Ga0209026_1000033 Ga0209026_1000033150 145
223 3300025253 Ga0209677_100196 Ga0209677_10019630 145
224 3300025256 Ga0209759_1000024 Ga0209759_1000024150 145
225 3300025911 Ga0207654_10068252 Ga0207654_100682522 145
226 3300025913 Ga0207695_10020265 Ga0207695_100202655 145
227 3300025914 Ga0207671_10079710 Ga0207671_100797103 145
228 3300025919 Ga0207657_10400032 Ga0207657_104000321 145
229 3300025920 Ga0207649_10220896 Ga0207649_102208961 145
230 3300025924 Ga0207694_10006906 Ga0207694_100069063 145
231 3300025944 Ga0207661_10800921 Ga0207661_108009211 145
232 3300025949 Ga0207667_10056228 Ga0207667_100562282 145
233 3300026067 Ga0207678_10706153 Ga0207678_107061532 145
234 3300026078 Ga0207702_10001078 Ga0207702_1000107819 145
235 3300026116 Ga0207674_10005131 Ga0207674_100051319 145
236 3300026116 Ga0207674_10338326 Ga0207674_103383262 145
237 3300044706 Ga0466964_0000907 Ga0466964_0000907_5303_5752 145
238 3300045976 Ga0466967_0427559 Ga0466967_0427559_435_887 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01152

Bac_globin

Bacterial-like globin

39

163

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uur-assembly2.cif.gz_B cold-adapted truncated hemoglobin from the antarctic marine bacterium pseudoalteromonas haloplanktis tac125 0.8366 17 143
2xyk-assembly1.cif.gz_A group ii 2-on-2 hemoglobin from the plant pathogen agrobacterium tumefaciens 0.8297 13 142
2bkm-assembly2.cif.gz_B crystal structure of the truncated hemoglobin from geobacillus stearothermophilus 0.8266 14 142
4uur-assembly2.cif.gz_B cold-adapted truncated hemoglobin from the antarctic marine bacterium pseudoalteromonas haloplanktis tac125 0.8247 17 143
1ux8-assembly1.cif.gz_A x-ray structure of truncated oxygen-avid haemoglobin from bacillus subtilis 0.8214 17 142
ID Description Score Start End Superfamily
4uurB00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8366 17 143 1.10.490.10
2xykA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8297 13 142 1.10.490.10
4uurB00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8247 17 143 1.10.490.10
2bkmA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.823 14 142 1.10.490.10
1ux8A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8154 17 143 1.10.490.10
ID Description Score Start End GO Terms
AF-A0A519HF18-F1-model_v4 deleted 0.8742 14 78
AF-A0A1T2ECM2-F1-model_v4 Globin 0.8737 15 143 GO:0005344
GO:0019825
GO:0020037
AF-A0A139KJW0-F1-model_v4 Protozoan/cyanobacterial globin family protein 0.8737 18 141 GO:0005344
GO:0019825
GO:0020037
AF-A0A1Q6CIM7-F1-model_v4 Hemoglobin-like oxygen-binding protein 0.8733 17 143 GO:0005344
GO:0019825
GO:0020037
AF-A0A1Y5F9N0-F1-model_v4 Globin 0.8725 14 142 GO:0005344
GO:0019825
GO:0020037

Feature Viewer

pLDDT pTM Quality
83.39 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map