F350561
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 238 | 170 | 238 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300003316|rootH1_10070717|rootH1_100707173 |
| Length | 166 |
| Sequence | VSPGAGVRRVPPRARARAAPDNTGMTDPVTDSPAAKQPTPFEMLGGLEGVRALVDRFYDLMDLEPEFAELRALHPTSLDGSRDKLAWFLTGWLGGPDLYIERFGHPRLRMRHFPYAIGIRERDQWLTCMGLAMAELGEAAGFTAFMQERLIQSFANTADHMRNRAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 2 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 3 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 39 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 40 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 41 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 44 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 45 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 67 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 69 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 96 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 97 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 98 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 99 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 100 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 101 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 102 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 103 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 104 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 105 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 106 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 107 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 108 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 109 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 110 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 111 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 112 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 114 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 115 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 116 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 117 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 118 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 119 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 120 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 121 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 122 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 123 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 124 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 136 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 137 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 138 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 139 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 140 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 143 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 144 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 145 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 146 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 147 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 148 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 155 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 156 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 159 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 160 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 166 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 167 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 168 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 169 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.14 |
| Nodule | 0 |
| Rhizoplane | 5.88 |
| Rhizosphere | 82.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000364 | 3300002705 | Bacteria | 29276 |
| 2 | JGI25154J39366_1000722 | 3300002738 | Bacteria | 14934 |
| 3 | JGI25157J39369_1000018 | 3300002741 | Bacteria | 177410 |
| 4 | rootH1_10070717 | 3300003316 | Bacteria | 2744 |
| 5 | rootH2_10013669 | 3300003320 | Bacteria | 1740 |
| 6 | Ga0055539_1000283 | 3300003752 | Bacteria | 28988 |
| 7 | Ga0055539_1003944 | 3300003752 | Bacteria | 2013 |
| 8 | Ga0055533_1000103 | 3300003756 | Bacteria | 107860 |
| 9 | Ga0055525_1001205 | 3300003759 | Bacteria | 5755 |
| 10 | Ga0055535_1012776 | 3300003761 | Bacteria | 1266 |
| 11 | Ga0065704_10097629 | 3300005289 | Bacteria | 2385 |
| 12 | Ga0065707_10085102 | 3300005295 | Bacteria | 6456 |
| 13 | Ga0070683_100895802 | 3300005329 | Bacteria | 851 |
| 14 | Ga0070680_100572529 | 3300005336 | Unclassified | 969 |
| 15 | Ga0070682_101517380 | 3300005337 | Bacteria | 577 |
| 16 | Ga0070660_100764528 | 3300005339 | Bacteria | 812 |
| 17 | Ga0070661_100382397 | 3300005344 | Bacteria | 1110 |
| 18 | Ga0070673_100306693 | 3300005364 | Bacteria | 1399 |
| 19 | Ga0070688_100335966 | 3300005365 | Bacteria | 1102 |
| 20 | Ga0070701_11179031 | 3300005438 | Bacteria | 542 |
| 21 | Ga0070705_100573520 | 3300005440 | Bacteria | 869 |
| 22 | Ga0070700_100855069 | 3300005441 | Bacteria | 737 |
| 23 | Ga0070678_100674904 | 3300005456 | Bacteria | 929 |
| 24 | Ga0068867_100447568 | 3300005459 | Bacteria | 1100 |
| 25 | Ga0070707_101484179 | 3300005468 | Unclassified | 645 |
| 26 | Ga0070698_100104803 | 3300005471 | Bacteria | 2798 |
| 27 | Ga0070698_100194672 | 3300005471 | Unclassified | 1964 |
| 28 | Ga0070698_100663305 | 3300005471 | Bacteria | 984 |
| 29 | Ga0070699_100002867 | 3300005518 | Bacteria | 15369 |
| 30 | Ga0070699_100046522 | 3300005518 | Bacteria | 3754 |
| 31 | Ga0070699_100056083 | 3300005518 | Bacteria | 3411 |
| 32 | Ga0070699_102207320 | 3300005518 | Unclassified | 502 |
| 33 | Ga0070684_100644631 | 3300005535 | Bacteria | 986 |
| 34 | Ga0070695_100534936 | 3300005545 | Unclassified | 911 |
| 35 | Ga0068855_100003105 | 3300005563 | Bacteria | 20329 |
| 36 | Ga0068855_100136598 | 3300005563 | Bacteria | 2797 |
| 37 | Ga0068857_100003053 | 3300005577 | Bacteria | 13849 |
| 38 | Ga0068857_100204072 | 3300005577 | Bacteria | 1802 |
| 39 | Ga0068857_100213293 | 3300005577 | Unclassified | 1762 |
| 40 | Ga0068857_100307301 | 3300005577 | Bacteria | 1463 |
| 41 | Ga0068856_100005614 | 3300005614 | Bacteria | 12341 |
| 42 | Ga0068852_100380489 | 3300005616 | Bacteria | 1385 |
| 43 | Ga0068859_100040572 | 3300005617 | Bacteria | 4671 |
| 44 | Ga0068861_100501688 | 3300005719 | Unclassified | 1097 |
| 45 | Ga0068870_10276392 | 3300005840 | Bacteria | 1051 |
| 46 | Ga0068863_101854573 | 3300005841 | Bacteria | 613 |
| 47 | Ga0068862_100100701 | 3300005844 | Bacteria | 2527 |
| 48 | Ga0068862_100604196 | 3300005844 | Unclassified | 1053 |
| 49 | Ga0081539_10197829 | 3300005985 | Unclassified | 931 |
| 50 | Ga0075427_10010427 | 3300006194 | Bacteria | 1391 |
| 51 | Ga0075366_10009360 | 3300006195 | Bacteria | 5467 |
| 52 | Ga0075370_10593614 | 3300006353 | Bacteria | 671 |
| 53 | Ga0075428_100196175 | 3300006844 | Bacteria | 2183 |
| 54 | Ga0075428_100471697 | 3300006844 | Bacteria | 1343 |
| 55 | Ga0075430_100450168 | 3300006846 | Bacteria | 1063 |
| 56 | Ga0075431_100059730 | 3300006847 | Bacteria | 3934 |
| 57 | Ga0075431_101160976 | 3300006847 | Bacteria | 736 |
| 58 | Ga0075429_100007205 | 3300006880 | Bacteria | 9651 |
| 59 | Ga0075429_100195123 | 3300006880 | Bacteria | 1773 |
| 60 | Ga0075429_100206238 | 3300006880 | Unclassified | 1722 |
| 61 | Ga0075429_100465437 | 3300006880 | Bacteria | 1108 |
| 62 | Ga0097620_100040571 | 3300006931 | Bacteria | 4671 |
| 63 | Ga0105240_10046750 | 3300009093 | Bacteria | 5481 |
| 64 | Ga0105240_10048445 | 3300009093 | Bacteria | 5370 |
| 65 | Ga0105240_10129175 | 3300009093 | Bacteria | 3033 |
| 66 | Ga0111539_10926854 | 3300009094 | Unclassified | 1013 |
| 67 | Ga0105245_10287650 | 3300009098 | Bacteria | 1609 |
| 68 | Ga0114129_10019826 | 3300009147 | Bacteria | 9569 |
| 69 | Ga0114129_10307237 | 3300009147 | Bacteria | 2112 |
| 70 | Ga0114129_10412248 | 3300009147 | Bacteria | 1779 |
| 71 | Ga0114129_10453314 | 3300009147 | Unclassified | 1682 |
| 72 | Ga0114129_13322220 | 3300009147 | Unclassified | 520 |
| 73 | Ga0105243_10926497 | 3300009148 | Unclassified | 868 |
| 74 | Ga0105243_11887352 | 3300009148 | Bacteria | 630 |
| 75 | Ga0105237_10385229 | 3300009545 | Bacteria | 1407 |
| 76 | Ga0105237_10686000 | 3300009545 | Bacteria | 1031 |
| 77 | Ga0105249_10042010 | 3300009553 | Bacteria | 4157 |
| 78 | Ga0105249_10654205 | 3300009553 | Unclassified | 1109 |
| 79 | Ga0105249_10719734 | 3300009553 | Bacteria | 1059 |
| 80 | Ga0105239_10039994 | 3300010375 | Bacteria | 5137 |
| 81 | Ga0105246_10025844 | 3300011119 | Bacteria | 3829 |
| 82 | Ga0105246_10299606 | 3300011119 | Bacteria | 1297 |
| 83 | Ga0157369_10008425 | 3300013105 | Bacteria | 11825 |
| 84 | Ga0157380_11722340 | 3300014326 | Bacteria | 685 |
| 85 | Ga0157380_11801941 | 3300014326 | Unclassified | 671 |
| 86 | Ga0157377_10327067 | 3300014745 | Bacteria | 1020 |
| 87 | Ga0157376_10481051 | 3300014969 | Bacteria | 1217 |
| 88 | Ga0182007_10034351 | 3300015262 | Bacteria | 1714 |
| 89 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 90 | Ga0209563_100141 | 3300025230 | Bacteria | 79513 |
| 91 | Ga0207427_100546 | 3300025231 | Bacteria | 19253 |
| 92 | Ga0209258_100895 | 3300025242 | Bacteria | 15468 |
| 93 | Ga0209646_1000067 | 3300025246 | Bacteria | 241595 |
| 94 | Ga0209026_1000033 | 3300025250 | Bacteria | 318512 |
| 95 | Ga0209677_100133 | 3300025253 | Bacteria | 69526 |
| 96 | Ga0209677_100196 | 3300025253 | Bacteria | 48682 |
| 97 | Ga0209759_1000024 | 3300025256 | Bacteria | 318512 |
| 98 | Ga0209759_1005120 | 3300025256 | Bacteria | 4674 |
| 99 | Ga0207643_10583918 | 3300025908 | Bacteria | 718 |
| 100 | Ga0207654_10068252 | 3300025911 | Bacteria | 2103 |
| 101 | Ga0207695_10020265 | 3300025913 | Bacteria | 7621 |
| 102 | Ga0207695_10079786 | 3300025913 | Bacteria | 3315 |
| 103 | Ga0207671_10079710 | 3300025914 | Bacteria | 2454 |
| 104 | Ga0207660_10670548 | 3300025917 | Unclassified | 846 |
| 105 | Ga0207657_10400032 | 3300025919 | Bacteria | 1080 |
| 106 | Ga0207649_10220896 | 3300025920 | Bacteria | 1349 |
| 107 | Ga0207694_10006906 | 3300025924 | Bacteria | 8617 |
| 108 | Ga0207687_11067270 | 3300025927 | Bacteria | 693 |
| 109 | Ga0207709_10249634 | 3300025935 | Bacteria | 1295 |
| 110 | Ga0207670_10392002 | 3300025936 | Unclassified | 1108 |
| 111 | Ga0207661_10800921 | 3300025944 | Bacteria | 867 |
| 112 | Ga0207667_10011171 | 3300025949 | Bacteria | 10453 |
| 113 | Ga0207667_10056228 | 3300025949 | Bacteria | 4134 |
| 114 | Ga0207712_10118513 | 3300025961 | Unclassified | 1998 |
| 115 | Ga0207678_10706153 | 3300026067 | Bacteria | 888 |
| 116 | Ga0207708_10130209 | 3300026075 | Bacteria | 1967 |
| 117 | Ga0207702_10001078 | 3300026078 | Bacteria | 27950 |
| 118 | Ga0207648_10372546 | 3300026089 | Bacteria | 1290 |
| 119 | Ga0207674_10005131 | 3300026116 | Bacteria | 15626 |
| 120 | Ga0207674_10202915 | 3300026116 | Bacteria | 1932 |
| 121 | Ga0207674_10314246 | 3300026116 | Bacteria | 1516 |
| 122 | Ga0207674_10338326 | 3300026116 | Bacteria | 1455 |
| 123 | Ga0207674_10900024 | 3300026116 | Bacteria | 853 |
| 124 | Ga0207675_100980840 | 3300026118 | Unclassified | 863 |
| 125 | Ga0207698_10254341 | 3300026142 | Bacteria | 1610 |
| 126 | Ga0209981_1006721 | 3300027378 | Bacteria | 1543 |
| 127 | Ga0209999_1012828 | 3300027543 | Bacteria | 1519 |
| 128 | Ga0209966_1000078 | 3300027695 | Bacteria | 42139 |
| 129 | Ga0209966_1013618 | 3300027695 | Bacteria | 1508 |
| 130 | Ga0268265_10179847 | 3300028380 | Bacteria | 1816 |
| 131 | Ga0268265_10448605 | 3300028380 | Bacteria | 1204 |
| 132 | Ga0268265_10658336 | 3300028380 | Unclassified | 1007 |
| 133 | Ga0265338_10000557 | 3300028800 | Bacteria | 65338 |
| 134 | Ga0265340_10033340 | 3300031247 | Bacteria | 2564 |
| 135 | Ga0307408_100503109 | 3300031548 | Bacteria | 1061 |
| 136 | Ga0307508_10644825 | 3300031616 | Bacteria | 664 |
| 137 | Ga0307405_10192836 | 3300031731 | Bacteria | 1473 |
| 138 | Ga0307405_10488096 | 3300031731 | Bacteria | 985 |
| 139 | Ga0307405_10592466 | 3300031731 | Unclassified | 903 |
| 140 | Ga0307413_10060754 | 3300031824 | Bacteria | 2328 |
| 141 | Ga0307413_12137216 | 3300031824 | Bacteria | 507 |
| 142 | Ga0307410_10044290 | 3300031852 | Bacteria | 2955 |
| 143 | Ga0307410_10170803 | 3300031852 | Unclassified | 1638 |
| 144 | Ga0307406_10205694 | 3300031901 | Bacteria | 1453 |
| 145 | Ga0307406_10721216 | 3300031901 | Bacteria | 834 |
| 146 | Ga0307407_10127624 | 3300031903 | Bacteria | 1622 |
| 147 | Ga0307412_10166255 | 3300031911 | Bacteria | 1645 |
| 148 | Ga0307412_10249321 | 3300031911 | Bacteria | 1378 |
| 149 | Ga0307409_100539613 | 3300031995 | Bacteria | 1143 |
| 150 | Ga0307416_100282621 | 3300032002 | Unclassified | 1637 |
| 151 | Ga0307416_100303590 | 3300032002 | Bacteria | 1588 |
| 152 | Ga0307416_100978831 | 3300032002 | Bacteria | 948 |
| 153 | Ga0307411_10160670 | 3300032005 | Bacteria | 1682 |
| 154 | Ga0307415_100063747 | 3300032126 | Bacteria | 2562 |
| 155 | Ga0307415_102169584 | 3300032126 | Bacteria | 543 |
| 156 | Ga0373959_0192530 | 3300034820 | Bacteria | 535 |
| 157 | Ga0373934_0004083 | 3300035086 | Bacteria | 5382 |
| 158 | Ga0316574_0076907 | 3300035398 | Bacteria | 2115 |
| 159 | Ga0373927_0780368 | 3300035695 | Bacteria | 631 |
| 160 | Ga0373925_0021087 | 3300037068 | Bacteria | 4747 |
| 161 | Ga0395898_0006478 | 3300037466 | Bacteria | 12503 |
| 162 | Ga0436364_0777906 | 3300037853 | Bacteria | 10645 |
| 163 | Ga0395901_0013605 | 3300038443 | Bacteria | 8273 |
| 164 | Ga0451577_0377574 | 3300042876 | Unclassified | 1286 |
| 165 | Ga0451577_0753871 | 3300042876 | Unclassified | 880 |
| 166 | Ga0453683_0067082 | 3300044673 | Bacteria | 2243 |
| 167 | Ga0453683_0522356 | 3300044673 | Bacteria | 771 |
| 168 | Ga0466963_0263091 | 3300044694 | Bacteria | 1211 |
| 169 | Ga0466964_0000907 | 3300044706 | Bacteria | 9725 |
| 170 | Ga0453684_0040357 | 3300044712 | Bacteria | 6339 |
| 171 | Ga0453684_0418277 | 3300044712 | Unclassified | 1498 |
| 172 | Ga0453684_0631874 | 3300044712 | Bacteria | 1170 |
| 173 | Ga0453684_1108864 | 3300044712 | Bacteria | 835 |
| 174 | Ga0466957_0992545 | 3300044842 | Bacteria | 603 |
| 175 | Ga0451576_0006320 | 3300045051 | Bacteria | 14561 |
| 176 | Ga0451576_0110752 | 3300045051 | Bacteria | 2857 |
| 177 | Ga0451576_0141197 | 3300045051 | Bacteria | 2511 |
| 178 | Ga0466967_0427559 | 3300045976 | Bacteria | 1292 |
| 179 | Ga0495585_0395304 | 3300046492 | Bacteria | 666 |
| 180 | Ga0495583_0000159 | 3300046506 | Bacteria | 113627 |
| 181 | Ga0495606_0003437 | 3300046507 | Bacteria | 16806 |
| 182 | Ga0495634_0502255 | 3300046642 | Bacteria | 711 |
| 183 | Ga0495625_0011185 | 3300046660 | Bacteria | 7341 |
| 184 | Ga0495671_0284178 | 3300046692 | Bacteria | 797 |
| 185 | Ga0495649_0001310 | 3300046694 | Bacteria | 19011 |
| 186 | Ga0495589_0006046 | 3300046794 | Bacteria | 6393 |
| 187 | Ga0495683_0094232 | 3300047323 | Bacteria | 1447 |
| 188 | Ga0496100_0104144 | 3300048903 | Bacteria | 1960 |
| 189 | Ga0496101_0074051 | 3300048904 | Bacteria | 2503 |
| 190 | Ga0496102_0186319 | 3300048905 | Bacteria | 1956 |
| 191 | Ga0496104_0022516 | 3300048907 | Bacteria | 5788 |
| 192 | Ga0496105_0077444 | 3300048908 | Bacteria | 2746 |
| 193 | Ga0496106_0121711 | 3300048909 | Bacteria | 2040 |
| 194 | Ga0496107_0062060 | 3300048910 | Bacteria | 2707 |
| 195 | Ga0496108_0016323 | 3300048911 | Bacteria | 6057 |
| 196 | Ga0496109_0086409 | 3300048912 | Bacteria | 2896 |
| 197 | Ga0496110_0034099 | 3300048913 | Bacteria | 4407 |
| 198 | Ga0496111_0006373 | 3300048914 | Bacteria | 7659 |
| 199 | Ga0496112_0024542 | 3300048915 | Bacteria | 5775 |
| 200 | Ga0496113_0289883 | 3300048916 | Bacteria | 1309 |
| 201 | Ga0496114_0977480 | 3300048917 | Bacteria | 729 |
| 202 | Ga0501291_135243 | 3300049514 | Bacteria | 546 |
| 203 | Ga0501039_0363041 | 3300049575 | Bacteria | 1138 |
| 204 | Ga0501040_0586503 | 3300049576 | Unclassified | 805 |
| 205 | Ga0501048_1067209 | 3300049582 | Bacteria | 581 |
| 206 | Ga0501071_0298049 | 3300049587 | Bacteria | 1222 |
| 207 | Ga0501075_0303370 | 3300049591 | Bacteria | 1217 |
| 208 | Ga0501076_0215406 | 3300049592 | Bacteria | 1570 |
| 209 | Ga0501076_1610337 | 3300049592 | Unclassified | 533 |
| 210 | Ga0501233_032231 | 3300049668 | Bacteria | 1191 |
| 211 | Ga0501248_052555 | 3300049678 | Bacteria | 527 |
| 212 | Ga0501079_0196735 | 3300049741 | Bacteria | 1574 |
| 213 | Ga0501079_0353133 | 3300049741 | Unclassified | 1152 |
| 214 | Ga0501081_0236240 | 3300049743 | Bacteria | 1332 |
| 215 | Ga0501278_028523 | 3300049774 | Bacteria | 555 |
| 216 | nmdc:mga0k408_54085_c1 | 3300050493 | Bacteria | 2327 |
| 217 | nmdc:mga05p37_2044_c1 | 3300050507 | Bacteria | 17024 |
| 218 | nmdc:mga05p37_459285_c1 | 3300050507 | Bacteria | 1472 |
| 219 | nmdc:mga05p37_47017_c1 | 3300050507 | Bacteria | 5307 |
| 220 | nmdc:mga05p37_481533_c1 | 3300050507 | Bacteria | 1429 |
| 221 | nmdc:mga05p37_495776_c1 | 3300050507 | Bacteria | 1403 |
| 222 | nmdc:mga09592_1271705_c1 | 3300050508 | Unclassified | 606 |
| 223 | nmdc:mga09592_161553_c1 | 3300050508 | Bacteria | 1935 |
| 224 | nmdc:mga09592_213458_c1 | 3300050508 | Unclassified | 1672 |
| 225 | nmdc:mga09592_401_c1 | 3300050508 | Bacteria | 31784 |
| 226 | nmdc:mga09592_53877_c1 | 3300050508 | Bacteria | 3398 |
| 227 | nmdc:mga0qj67_234505_c1 | 3300050509 | Bacteria | 1489 |
| 228 | nmdc:mga06r32_397031_c1 | 3300050510 | Bacteria | 1361 |
| 229 | nmdc:mga06r32_80439_c1 | 3300050510 | Bacteria | 3171 |
| 230 | nmdc:mga0a205_355428_c1 | 3300050515 | Unclassified | 1332 |
| 231 | Ga0500651_0293809 | 3300053093 | Bacteria | 934 |
| 232 | Ga0500589_077173 | 3300053147 | Bacteria | 1494 |
| 233 | Ga0500636_0008626 | 3300053177 | Bacteria | 5905 |
| 234 | Ga0590071_013502 | 3300059421 | Bacteria | 1912 |
| 235 | Ga0501082_0235133 | 3300060353 | Bacteria | 1595 |
| 236 | Ga0501082_1034692 | 3300060353 | Bacteria | 718 |
| 237 | Ga0530510_0077882 | 3300061734 | Bacteria | 2409 |
| 238 | Ga0530510_0226867 | 3300061734 | Unclassified | 1389 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300032002 | Ga0307416_100303590 | Ga0307416_1003035902 | 127 |
| 2 | 3300027695 | Ga0209966_1013618 | Ga0209966_10136182 | 129 |
| 3 | 3300042876 | Ga0451577_0753871 | Ga0451577_0753871_167_598 | 129 |
| 4 | 3300044712 | Ga0453684_0040357 | Ga0453684_0040357_305_736 | 129 |
| 5 | 3300045051 | Ga0451576_0006320 | Ga0451576_0006320_9062_9493 | 129 |
| 6 | 3300049576 | Ga0501040_0586503 | Ga0501040_0586503_295_684 | 129 |
| 7 | 3300049741 | Ga0501079_0196735 | Ga0501079_0196735_42_431 | 129 |
| 8 | 3300049774 | Ga0501278_028523 | Ga0501278_028523_39_431 | 129 |
| 9 | 3300005289 | Ga0065704_10097629 | Ga0065704_100976292 | 130 |
| 10 | 3300005295 | Ga0065707_10085102 | Ga0065707_100851023 | 130 |
| 11 | 3300005336 | Ga0070680_100572529 | Ga0070680_1005725291 | 130 |
| 12 | 3300005364 | Ga0070673_100306693 | Ga0070673_1003066932 | 130 |
| 13 | 3300005438 | Ga0070701_11179031 | Ga0070701_111790312 | 130 |
| 14 | 3300005440 | Ga0070705_100573520 | Ga0070705_1005735202 | 130 |
| 15 | 3300005441 | Ga0070700_100855069 | Ga0070700_1008550691 | 130 |
| 16 | 3300005468 | Ga0070707_101484179 | Ga0070707_1014841792 | 130 |
| 17 | 3300005471 | Ga0070698_100104803 | Ga0070698_1001048034 | 130 |
| 18 | 3300005471 | Ga0070698_100194672 | Ga0070698_1001946723 | 130 |
| 19 | 3300005471 | Ga0070698_100663305 | Ga0070698_1006633052 | 130 |
| 20 | 3300005518 | Ga0070699_100002867 | Ga0070699_1000028679 | 130 |
| 21 | 3300005518 | Ga0070699_100046522 | Ga0070699_1000465223 | 130 |
| 22 | 3300005518 | Ga0070699_100056083 | Ga0070699_1000560833 | 130 |
| 23 | 3300005518 | Ga0070699_102207320 | Ga0070699_1022073201 | 130 |
| 24 | 3300005545 | Ga0070695_100534936 | Ga0070695_1005349362 | 130 |
| 25 | 3300005577 | Ga0068857_100213293 | Ga0068857_1002132932 | 130 |
| 26 | 3300005617 | Ga0068859_100040572 | Ga0068859_1000405725 | 130 |
| 27 | 3300005719 | Ga0068861_100501688 | Ga0068861_1005016882 | 130 |
| 28 | 3300005840 | Ga0068870_10276392 | Ga0068870_102763922 | 130 |
| 29 | 3300005841 | Ga0068863_101854573 | Ga0068863_1018545732 | 130 |
| 30 | 3300005844 | Ga0068862_100100701 | Ga0068862_1001007012 | 130 |
| 31 | 3300005844 | Ga0068862_100604196 | Ga0068862_1006041962 | 130 |
| 32 | 3300005985 | Ga0081539_10197829 | Ga0081539_101978292 | 130 |
| 33 | 3300006194 | Ga0075427_10010427 | Ga0075427_100104272 | 130 |
| 34 | 3300006844 | Ga0075428_100196175 | Ga0075428_1001961752 | 130 |
| 35 | 3300006844 | Ga0075428_100471697 | Ga0075428_1004716972 | 130 |
| 36 | 3300006846 | Ga0075430_100450168 | Ga0075430_1004501682 | 130 |
| 37 | 3300006847 | Ga0075431_100059730 | Ga0075431_1000597303 | 130 |
| 38 | 3300006847 | Ga0075431_101160976 | Ga0075431_1011609762 | 130 |
| 39 | 3300006880 | Ga0075429_100007205 | Ga0075429_1000072056 | 130 |
| 40 | 3300006880 | Ga0075429_100195123 | Ga0075429_1001951232 | 130 |
| 41 | 3300006880 | Ga0075429_100206238 | Ga0075429_1002062383 | 130 |
| 42 | 3300006880 | Ga0075429_100465437 | Ga0075429_1004654372 | 130 |
| 43 | 3300006931 | Ga0097620_100040571 | Ga0097620_1000405715 | 130 |
| 44 | 3300009094 | Ga0111539_10926854 | Ga0111539_109268542 | 130 |
| 45 | 3300009147 | Ga0114129_10019826 | Ga0114129_100198263 | 130 |
| 46 | 3300009147 | Ga0114129_10307237 | Ga0114129_103072372 | 130 |
| 47 | 3300009147 | Ga0114129_10412248 | Ga0114129_104122483 | 130 |
| 48 | 3300009147 | Ga0114129_10453314 | Ga0114129_104533143 | 130 |
| 49 | 3300009147 | Ga0114129_13322220 | Ga0114129_133222201 | 130 |
| 50 | 3300009148 | Ga0105243_10926497 | Ga0105243_109264972 | 130 |
| 51 | 3300009553 | Ga0105249_10042010 | Ga0105249_100420103 | 130 |
| 52 | 3300009553 | Ga0105249_10654205 | Ga0105249_106542052 | 130 |
| 53 | 3300009553 | Ga0105249_10719734 | Ga0105249_107197342 | 130 |
| 54 | 3300011119 | Ga0105246_10025844 | Ga0105246_100258443 | 130 |
| 55 | 3300011119 | Ga0105246_10299606 | Ga0105246_102996062 | 130 |
| 56 | 3300014326 | Ga0157380_11722340 | Ga0157380_117223402 | 130 |
| 57 | 3300014326 | Ga0157380_11801941 | Ga0157380_118019412 | 130 |
| 58 | 3300014745 | Ga0157377_10327067 | Ga0157377_103270672 | 130 |
| 59 | 3300025908 | Ga0207643_10583918 | Ga0207643_105839182 | 130 |
| 60 | 3300025917 | Ga0207660_10670548 | Ga0207660_106705482 | 130 |
| 61 | 3300025935 | Ga0207709_10249634 | Ga0207709_102496342 | 130 |
| 62 | 3300025936 | Ga0207670_10392002 | Ga0207670_103920022 | 130 |
| 63 | 3300025961 | Ga0207712_10118513 | Ga0207712_101185133 | 130 |
| 64 | 3300026075 | Ga0207708_10130209 | Ga0207708_101302094 | 130 |
| 65 | 3300026116 | Ga0207674_10202915 | Ga0207674_102029152 | 130 |
| 66 | 3300026116 | Ga0207674_10900024 | Ga0207674_109000242 | 130 |
| 67 | 3300026118 | Ga0207675_100980840 | Ga0207675_1009808402 | 130 |
| 68 | 3300028380 | Ga0268265_10179847 | Ga0268265_101798471 | 130 |
| 69 | 3300028380 | Ga0268265_10448605 | Ga0268265_104486052 | 130 |
| 70 | 3300028380 | Ga0268265_10658336 | Ga0268265_106583362 | 130 |
| 71 | 3300031548 | Ga0307408_100503109 | Ga0307408_1005031092 | 130 |
| 72 | 3300031731 | Ga0307405_10192836 | Ga0307405_101928362 | 130 |
| 73 | 3300031731 | Ga0307405_10488096 | Ga0307405_104880961 | 130 |
| 74 | 3300031731 | Ga0307405_10592466 | Ga0307405_105924661 | 130 |
| 75 | 3300031824 | Ga0307413_10060754 | Ga0307413_100607543 | 130 |
| 76 | 3300031824 | Ga0307413_12137216 | Ga0307413_121372161 | 130 |
| 77 | 3300031852 | Ga0307410_10044290 | Ga0307410_100442902 | 130 |
| 78 | 3300031852 | Ga0307410_10170803 | Ga0307410_101708033 | 130 |
| 79 | 3300031901 | Ga0307406_10205694 | Ga0307406_102056943 | 130 |
| 80 | 3300031901 | Ga0307406_10721216 | Ga0307406_107212162 | 130 |
| 81 | 3300031903 | Ga0307407_10127624 | Ga0307407_101276243 | 130 |
| 82 | 3300031911 | Ga0307412_10166255 | Ga0307412_101662552 | 130 |
| 83 | 3300031911 | Ga0307412_10249321 | Ga0307412_102493212 | 130 |
| 84 | 3300031995 | Ga0307409_100539613 | Ga0307409_1005396133 | 130 |
| 85 | 3300032002 | Ga0307416_100282621 | Ga0307416_1002826212 | 130 |
| 86 | 3300032002 | Ga0307416_100978831 | Ga0307416_1009788311 | 130 |
| 87 | 3300032005 | Ga0307411_10160670 | Ga0307411_101606702 | 130 |
| 88 | 3300032126 | Ga0307415_100063747 | Ga0307415_1000637472 | 130 |
| 89 | 3300032126 | Ga0307415_102169584 | Ga0307415_1021695841 | 130 |
| 90 | 3300042876 | Ga0451577_0377574 | Ga0451577_0377574_81_485 | 130 |
| 91 | 3300044673 | Ga0453683_0067082 | Ga0453683_0067082_103_498 | 130 |
| 92 | 3300044673 | Ga0453683_0522356 | Ga0453683_0522356_217_612 | 130 |
| 93 | 3300044712 | Ga0453684_0418277 | Ga0453684_0418277_522_926 | 130 |
| 94 | 3300044712 | Ga0453684_0631874 | Ga0453684_0631874_577_1008 | 130 |
| 95 | 3300044712 | Ga0453684_1108864 | Ga0453684_1108864_28_432 | 130 |
| 96 | 3300044842 | Ga0466957_0992545 | Ga0466957_0992545_114_509 | 130 |
| 97 | 3300045051 | Ga0451576_0110752 | Ga0451576_0110752_674_1105 | 130 |
| 98 | 3300045051 | Ga0451576_0141197 | Ga0451576_0141197_290_685 | 130 |
| 99 | 3300046642 | Ga0495634_0502255 | Ga0495634_0502255_131_544 | 130 |
| 100 | 3300049514 | Ga0501291_135243 | Ga0501291_135243_76_471 | 130 |
| 101 | 3300049592 | Ga0501076_1610337 | Ga0501076_1610337_115_510 | 130 |
| 102 | 3300049668 | Ga0501233_032231 | Ga0501233_032231_728_1132 | 130 |
| 103 | 3300049678 | Ga0501248_052555 | Ga0501248_052555_106_501 | 130 |
| 104 | 3300049741 | Ga0501079_0353133 | Ga0501079_0353133_351_764 | 130 |
| 105 | 3300050507 | nmdc:mga05p37_2044_c1 | nmdc:mga05p37_2044_c1_15386_15781 | 130 |
| 106 | 3300050507 | nmdc:mga05p37_459285_c1 | nmdc:mga05p37_459285_c1_182_577 | 130 |
| 107 | 3300050507 | nmdc:mga05p37_47017_c1 | nmdc:mga05p37_47017_c1_4716_5108 | 130 |
| 108 | 3300050507 | nmdc:mga05p37_481533_c1 | nmdc:mga05p37_481533_c1_489_962 | 130 |
| 109 | 3300050507 | nmdc:mga05p37_495776_c1 | nmdc:mga05p37_495776_c1_759_1154 | 130 |
| 110 | 3300050508 | nmdc:mga09592_1271705_c1 | nmdc:mga09592_1271705_c1_78_473 | 130 |
| 111 | 3300050508 | nmdc:mga09592_161553_c1 | nmdc:mga09592_161553_c1_199_591 | 130 |
| 112 | 3300050508 | nmdc:mga09592_213458_c1 | nmdc:mga09592_213458_c1_421_816 | 130 |
| 113 | 3300050508 | nmdc:mga09592_401_c1 | nmdc:mga09592_401_c1_27940_28335 | 130 |
| 114 | 3300050508 | nmdc:mga09592_53877_c1 | nmdc:mga09592_53877_c1_2111_2503 | 130 |
| 115 | 3300050509 | nmdc:mga0qj67_234505_c1 | nmdc:mga0qj67_234505_c1_454_849 | 130 |
| 116 | 3300050510 | nmdc:mga06r32_397031_c1 | nmdc:mga06r32_397031_c1_716_1174 | 130 |
| 117 | 3300050510 | nmdc:mga06r32_80439_c1 | nmdc:mga06r32_80439_c1_2084_2476 | 130 |
| 118 | 3300050515 | nmdc:mga0a205_355428_c1 | nmdc:mga0a205_355428_c1_469_864 | 130 |
| 119 | 3300059421 | Ga0590071_013502 | Ga0590071_013502_459_851 | 130 |
| 120 | 3300060353 | Ga0501082_1034692 | Ga0501082_1034692_36_431 | 130 |
| 121 | 3300061734 | Ga0530510_0226867 | Ga0530510_0226867_226_639 | 130 |
| 122 | 3300048903 | Ga0496100_0104144 | Ga0496100_0104144_1212_1622 | 132 |
| 123 | 3300048904 | Ga0496101_0074051 | Ga0496101_0074051_763_1173 | 132 |
| 124 | 3300048905 | Ga0496102_0186319 | Ga0496102_0186319_91_501 | 132 |
| 125 | 3300048907 | Ga0496104_0022516 | Ga0496104_0022516_4076_4750 | 132 |
| 126 | 3300048908 | Ga0496105_0077444 | Ga0496105_0077444_378_1052 | 132 |
| 127 | 3300048909 | Ga0496106_0121711 | Ga0496106_0121711_287_697 | 132 |
| 128 | 3300048910 | Ga0496107_0062060 | Ga0496107_0062060_931_1341 | 132 |
| 129 | 3300048911 | Ga0496108_0016323 | Ga0496108_0016323_5309_5719 | 132 |
| 130 | 3300048912 | Ga0496109_0086409 | Ga0496109_0086409_815_1489 | 132 |
| 131 | 3300048913 | Ga0496110_0034099 | Ga0496110_0034099_2738_3148 | 132 |
| 132 | 3300048914 | Ga0496111_0006373 | Ga0496111_0006373_1814_2224 | 132 |
| 133 | 3300048915 | Ga0496112_0024542 | Ga0496112_0024542_4863_5273 | 132 |
| 134 | 3300048916 | Ga0496113_0289883 | Ga0496113_0289883_127_537 | 132 |
| 135 | 3300048917 | Ga0496114_0977480 | Ga0496114_0977480_179_589 | 132 |
| 136 | 3300037068 | Ga0373925_0021087 | Ga0373925_0021087_336_740 | 133 |
| 137 | 3300049575 | Ga0501039_0363041 | Ga0501039_0363041_256_660 | 134 |
| 138 | 3300049582 | Ga0501048_1067209 | Ga0501048_1067209_162_566 | 134 |
| 139 | 3300049587 | Ga0501071_0298049 | Ga0501071_0298049_167_571 | 134 |
| 140 | 3300049591 | Ga0501075_0303370 | Ga0501075_0303370_462_866 | 134 |
| 141 | 3300049592 | Ga0501076_0215406 | Ga0501076_0215406_781_1185 | 134 |
| 142 | 3300049743 | Ga0501081_0236240 | Ga0501081_0236240_901_1305 | 134 |
| 143 | 3300060353 | Ga0501082_0235133 | Ga0501082_0235133_787_1191 | 134 |
| 144 | 3300061734 | Ga0530510_0077882 | Ga0530510_0077882_1504_1908 | 134 |
| 145 | 3300006353 | Ga0075370_10593614 | Ga0075370_105936142 | 135 |
| 146 | 3300027378 | Ga0209981_1006721 | Ga0209981_10067213 | 135 |
| 147 | 3300027543 | Ga0209999_1012828 | Ga0209999_10128282 | 135 |
| 148 | 3300027695 | Ga0209966_1000078 | Ga0209966_100007815 | 135 |
| 149 | 3300028800 | Ga0265338_10000557 | Ga0265338_1000055762 | 135 |
| 150 | 3300031247 | Ga0265340_10033340 | Ga0265340_100333403 | 135 |
| 151 | 3300035398 | Ga0316574_0076907 | Ga0316574_0076907_254_667 | 136 |
| 152 | 3300005459 | Ga0068867_100447568 | Ga0068867_1004475682 | 139 |
| 153 | 3300026089 | Ga0207648_10372546 | Ga0207648_103725462 | 139 |
| 154 | 3300035695 | Ga0373927_0780368 | Ga0373927_0780368_176_595 | 139 |
| 155 | 3300046492 | Ga0495585_0395304 | Ga0495585_0395304_177_596 | 139 |
| 156 | 3300046506 | Ga0495583_0000159 | Ga0495583_0000159_29028_29447 | 139 |
| 157 | 3300046507 | Ga0495606_0003437 | Ga0495606_0003437_2332_2751 | 139 |
| 158 | 3300046660 | Ga0495625_0011185 | Ga0495625_0011185_6023_6442 | 139 |
| 159 | 3300046692 | Ga0495671_0284178 | Ga0495671_0284178_121_540 | 139 |
| 160 | 3300046694 | Ga0495649_0001310 | Ga0495649_0001310_4019_4438 | 139 |
| 161 | 3300046794 | Ga0495589_0006046 | Ga0495589_0006046_3754_4173 | 139 |
| 162 | 3300047323 | Ga0495683_0094232 | Ga0495683_0094232_494_913 | 139 |
| 163 | 3300053093 | Ga0500651_0293809 | Ga0500651_0293809_439_858 | 139 |
| 164 | 3300053147 | Ga0500589_077173 | Ga0500589_077173_439_858 | 139 |
| 165 | 3300053177 | Ga0500636_0008626 | Ga0500636_0008626_3385_3804 | 139 |
| 166 | 3300037853 | Ga0436364_0777906 | Ga0436364_0777906_247_693 | 140 |
| 167 | 3300026142 | Ga0207698_10254341 | Ga0207698_102543412 | 141 |
| 168 | 3300003316 | rootH1_10070717 | rootH1_100707173 | 142 |
| 169 | 3300003320 | rootH2_10013669 | rootH2_100136692 | 142 |
| 170 | 3300003752 | Ga0055539_1000283 | Ga0055539_100028315 | 142 |
| 171 | 3300003756 | Ga0055533_1000103 | Ga0055533_100010388 | 142 |
| 172 | 3300003759 | Ga0055525_1001205 | Ga0055525_10012056 | 142 |
| 173 | 3300003761 | Ga0055535_1012776 | Ga0055535_10127761 | 142 |
| 174 | 3300005339 | Ga0070660_100764528 | Ga0070660_1007645282 | 142 |
| 175 | 3300005456 | Ga0070678_100674904 | Ga0070678_1006749042 | 142 |
| 176 | 3300005563 | Ga0068855_100003105 | Ga0068855_10000310511 | 142 |
| 177 | 3300005577 | Ga0068857_100204072 | Ga0068857_1002040723 | 142 |
| 178 | 3300006195 | Ga0075366_10009360 | Ga0075366_100093603 | 142 |
| 179 | 3300009093 | Ga0105240_10129175 | Ga0105240_101291754 | 142 |
| 180 | 3300009098 | Ga0105245_10287650 | Ga0105245_102876503 | 142 |
| 181 | 3300009545 | Ga0105237_10686000 | Ga0105237_106860002 | 142 |
| 182 | 3300015262 | Ga0182007_10034351 | Ga0182007_100343512 | 142 |
| 183 | 3300025226 | Ga0209674_100003 | Ga0209674_100003217 | 142 |
| 184 | 3300025230 | Ga0209563_100141 | Ga0209563_10014157 | 142 |
| 185 | 3300025242 | Ga0209258_100895 | Ga0209258_10089515 | 142 |
| 186 | 3300025253 | Ga0209677_100133 | Ga0209677_10013346 | 142 |
| 187 | 3300025927 | Ga0207687_11067270 | Ga0207687_110672702 | 142 |
| 188 | 3300025949 | Ga0207667_10011171 | Ga0207667_100111718 | 142 |
| 189 | 3300026116 | Ga0207674_10314246 | Ga0207674_103142461 | 142 |
| 190 | 3300031616 | Ga0307508_10644825 | Ga0307508_106448251 | 142 |
| 191 | 3300034820 | Ga0373959_0192530 | Ga0373959_0192530_46_474 | 142 |
| 192 | 3300037466 | Ga0395898_0006478 | Ga0395898_0006478_11964_12392 | 142 |
| 193 | 3300038443 | Ga0395901_0013605 | Ga0395901_0013605_3890_4318 | 142 |
| 194 | 3300044694 | Ga0466963_0263091 | Ga0466963_0263091_26_454 | 142 |
| 195 | 3300050493 | nmdc:mga0k408_54085_c1 | nmdc:mga0k408_54085_c1_784_1212 | 142 |
| 196 | 3300005337 | Ga0070682_101517380 | Ga0070682_1015173801 | 144 |
| 197 | 3300009093 | Ga0105240_10046750 | Ga0105240_100467504 | 144 |
| 198 | 3300009148 | Ga0105243_11887352 | Ga0105243_118873521 | 144 |
| 199 | 3300014969 | Ga0157376_10481051 | Ga0157376_104810512 | 144 |
| 200 | 3300025231 | Ga0207427_100546 | Ga0207427_10054620 | 144 |
| 201 | 3300025256 | Ga0209759_1005120 | Ga0209759_10051203 | 144 |
| 202 | 3300025913 | Ga0207695_10079786 | Ga0207695_100797862 | 144 |
| 203 | 3300035086 | Ga0373934_0004083 | Ga0373934_0004083_2236_2670 | 144 |
| 204 | 3300002705 | JGI25156J39149_1000364 | JGI25156J39149_100036413 | 145 |
| 205 | 3300002738 | JGI25154J39366_1000722 | JGI25154J39366_100072219 | 145 |
| 206 | 3300002741 | JGI25157J39369_1000018 | JGI25157J39369_1000018146 | 145 |
| 207 | 3300003752 | Ga0055539_1003944 | Ga0055539_10039442 | 145 |
| 208 | 3300005329 | Ga0070683_100895802 | Ga0070683_1008958022 | 145 |
| 209 | 3300005344 | Ga0070661_100382397 | Ga0070661_1003823972 | 145 |
| 210 | 3300005365 | Ga0070688_100335966 | Ga0070688_1003359662 | 145 |
| 211 | 3300005535 | Ga0070684_100644631 | Ga0070684_1006446312 | 145 |
| 212 | 3300005563 | Ga0068855_100136598 | Ga0068855_1001365982 | 145 |
| 213 | 3300005577 | Ga0068857_100003053 | Ga0068857_1000030539 | 145 |
| 214 | 3300005577 | Ga0068857_100307301 | Ga0068857_1003073012 | 145 |
| 215 | 3300005614 | Ga0068856_100005614 | Ga0068856_1000056148 | 145 |
| 216 | 3300005616 | Ga0068852_100380489 | Ga0068852_1003804892 | 145 |
| 217 | 3300009093 | Ga0105240_10048445 | Ga0105240_100484456 | 145 |
| 218 | 3300009545 | Ga0105237_10385229 | Ga0105237_103852292 | 145 |
| 219 | 3300010375 | Ga0105239_10039994 | Ga0105239_100399946 | 145 |
| 220 | 3300013105 | Ga0157369_10008425 | Ga0157369_100084258 | 145 |
| 221 | 3300025246 | Ga0209646_1000067 | Ga0209646_100006780 | 145 |
| 222 | 3300025250 | Ga0209026_1000033 | Ga0209026_1000033150 | 145 |
| 223 | 3300025253 | Ga0209677_100196 | Ga0209677_10019630 | 145 |
| 224 | 3300025256 | Ga0209759_1000024 | Ga0209759_1000024150 | 145 |
| 225 | 3300025911 | Ga0207654_10068252 | Ga0207654_100682522 | 145 |
| 226 | 3300025913 | Ga0207695_10020265 | Ga0207695_100202655 | 145 |
| 227 | 3300025914 | Ga0207671_10079710 | Ga0207671_100797103 | 145 |
| 228 | 3300025919 | Ga0207657_10400032 | Ga0207657_104000321 | 145 |
| 229 | 3300025920 | Ga0207649_10220896 | Ga0207649_102208961 | 145 |
| 230 | 3300025924 | Ga0207694_10006906 | Ga0207694_100069063 | 145 |
| 231 | 3300025944 | Ga0207661_10800921 | Ga0207661_108009211 | 145 |
| 232 | 3300025949 | Ga0207667_10056228 | Ga0207667_100562282 | 145 |
| 233 | 3300026067 | Ga0207678_10706153 | Ga0207678_107061532 | 145 |
| 234 | 3300026078 | Ga0207702_10001078 | Ga0207702_1000107819 | 145 |
| 235 | 3300026116 | Ga0207674_10005131 | Ga0207674_100051319 | 145 |
| 236 | 3300026116 | Ga0207674_10338326 | Ga0207674_103383262 | 145 |
| 237 | 3300044706 | Ga0466964_0000907 | Ga0466964_0000907_5303_5752 | 145 |
| 238 | 3300045976 | Ga0466967_0427559 | Ga0466967_0427559_435_887 | 145 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4uur-assembly2.cif.gz_B | cold-adapted truncated hemoglobin from the antarctic marine bacterium pseudoalteromonas haloplanktis tac125 | 0.8366 | 17 | 143 |
| 2xyk-assembly1.cif.gz_A | group ii 2-on-2 hemoglobin from the plant pathogen agrobacterium tumefaciens | 0.8297 | 13 | 142 |
| 2bkm-assembly2.cif.gz_B | crystal structure of the truncated hemoglobin from geobacillus stearothermophilus | 0.8266 | 14 | 142 |
| 4uur-assembly2.cif.gz_B | cold-adapted truncated hemoglobin from the antarctic marine bacterium pseudoalteromonas haloplanktis tac125 | 0.8247 | 17 | 143 |
| 1ux8-assembly1.cif.gz_A | x-ray structure of truncated oxygen-avid haemoglobin from bacillus subtilis | 0.8214 | 17 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4uurB00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.8366 | 17 | 143 | 1.10.490.10 |
| 2xykA00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.8297 | 13 | 142 | 1.10.490.10 |
| 4uurB00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.8247 | 17 | 143 | 1.10.490.10 |
| 2bkmA00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.823 | 14 | 142 | 1.10.490.10 |
| 1ux8A00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.8154 | 17 | 143 | 1.10.490.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519HF18-F1-model_v4 | deleted | 0.8742 | 14 | 78 |
|
| AF-A0A1T2ECM2-F1-model_v4 | Globin | 0.8737 | 15 | 143 |
GO:0005344
GO:0019825 GO:0020037 |
| AF-A0A139KJW0-F1-model_v4 | Protozoan/cyanobacterial globin family protein | 0.8737 | 18 | 141 |
GO:0005344
GO:0019825 GO:0020037 |
| AF-A0A1Q6CIM7-F1-model_v4 | Hemoglobin-like oxygen-binding protein | 0.8733 | 17 | 143 |
GO:0005344
GO:0019825 GO:0020037 |
| AF-A0A1Y5F9N0-F1-model_v4 | Globin | 0.8725 | 14 | 142 |
GO:0005344
GO:0019825 GO:0020037 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar