F350452

General Info

Members Datasets Scaffolds Average Seq Length
237 188 474 157

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_009857|Ga0500595_009857_1540_2052
Length 170
Sequence MIKLGSMCNEGDDVNDLDLHNPVFATYAIAASLMILKAVSMSWLTVVRMMQEKGGYRAPEDLRKTPLNPAPDPKQLEPNERVERVRRIQLNDVENLPFFLVAGGLFVLTKPTLAMAQWLLYGYVASRFLHFIAYFTAQTHDVRAALWTVGSLVLIFMTCWTLLAAFGLIA

Samples

Sample ID Description Type Environment
1 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
91 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
99 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
100 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
101 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
112 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
159 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
160 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
161 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
162 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
163 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
164 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
165 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
166 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
167 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
168 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
169 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
170 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
171 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
172 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
173 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
174 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
175 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
176 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
177 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
178 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
179 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
180 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
181 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
182 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
183 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
184 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
185 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
186 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
187 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
188 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.34
Metatranscriptomes 0
Isolates 12.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 12.24
Rhizoplane 3.8
Rhizosphere 80.17
Stem 0
Stem Tuber 0
Unclassified 17.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500595_009857 3300053119 Bacteria 3833
2 JGI25404J52841_10003152 3300003659 Bacteria 3225
3 Ga0070658_10419383 3300005327 Bacteria 1151
4 Ga0070658_11261640 3300005327 Bacteria 642
5 Ga0070683_100384622 3300005329 Bacteria 1337
6 Ga0070690_100058028 3300005330 Bacteria 2485
7 Ga0070680_100209643 3300005336 Bacteria 1644
8 Ga0070682_100946874 3300005337 Bacteria 711
9 Ga0070669_101657965 3300005353 Bacteria 557
10 Ga0070667_100151608 3300005367 Unclassified 2037
11 Ga0070667_100948858 3300005367 Bacteria 801
12 Ga0070714_100090709 3300005435 Bacteria 2677
13 Ga0070713_100102017 3300005436 Bacteria 2487
14 Ga0070710_10984990 3300005437 Unclassified 613
15 Ga0068867_100117692 3300005459 Unclassified 2049
16 Ga0070679_100306094 3300005530 Bacteria 1539
17 Ga0068853_100194870 3300005539 Bacteria 1842
18 Ga0070672_100275447 3300005543 Unclassified 1422
19 Ga0070686_100794973 3300005544 Bacteria 762
20 Ga0070693_100150719 3300005547 Bacteria 1473
21 Ga0070665_100000136 3300005548 Bacteria 138094
22 Ga0070665_101125005 3300005548 Bacteria 797
23 Ga0068855_100149796 3300005563 Unclassified 2653
24 Ga0068855_100989367 3300005563 Bacteria 884
25 Ga0068855_101301835 3300005563 Bacteria 752
26 Ga0068854_101048067 3300005578 Bacteria 724
27 Ga0068856_101661444 3300005614 Unclassified 651
28 Ga0068852_100531965 3300005616 Bacteria 1174
29 Ga0068852_101128557 3300005616 Bacteria 804
30 Ga0068859_100929323 3300005617 Unclassified 954
31 Ga0068859_101615135 3300005617 Bacteria 716
32 Ga0068864_100085020 3300005618 Unclassified 2781
33 Ga0068861_101406688 3300005719 Bacteria 681
34 Ga0068870_10606140 3300005840 Bacteria 745
35 Ga0068863_100053148 3300005841 Bacteria 3839
36 Ga0068863_100857023 3300005841 Bacteria 908
37 Ga0068858_100819454 3300005842 Bacteria 908
38 Ga0068862_100452705 3300005844 Bacteria 1210
39 Ga0081540_1006556 3300005983 Bacteria 8453
40 Ga0070717_10311036 3300006028 Bacteria 1402
41 Ga0097621_100366656 3300006237 Bacteria 1284
42 Ga0068865_100038601 3300006881 Bacteria 3233
43 Ga0097620_100929361 3300006931 Unclassified 954
44 Ga0097620_101615074 3300006931 Bacteria 716
45 Ga0105240_10287368 3300009093 Bacteria 1887
46 Ga0105240_10409082 3300009093 Bacteria 1526
47 Ga0105245_10236629 3300009098 Unclassified 1768
48 Ga0105243_11514022 3300009148 Bacteria 695
49 Ga0105242_10105306 3300009176 Bacteria 2396
50 Ga0105242_10561132 3300009176 Unclassified 1096
51 Ga0105242_10650456 3300009176 Bacteria 1025
52 Ga0105242_10852451 3300009176 Bacteria 907
53 Ga0105248_10013193 3300009177 Bacteria 9096
54 Ga0105248_10114773 3300009177 Bacteria 3038
55 Ga0105237_10364037 3300009545 Bacteria 1450
56 Ga0105238_10044998 3300009551 Bacteria 4460
57 Ga0105238_10442137 3300009551 Unclassified 1297
58 Ga0105238_10602675 3300009551 Bacteria 1106
59 Ga0105249_10114631 3300009553 Unclassified 2552
60 Ga0105249_10658184 3300009553 Bacteria 1105
61 Ga0105239_10802967 3300010375 Bacteria 1078
62 Ga0105239_11393898 3300010375 Bacteria 809
63 Ga0157369_10559563 3300013105 Bacteria 1182
64 Ga0157374_10791927 3300013296 Bacteria 964
65 Ga0157374_10949800 3300013296 Bacteria 878
66 Ga0163162_10259338 3300013306 Unclassified 1870
67 Ga0163162_10274127 3300013306 Bacteria 1819
68 Ga0163162_10290374 3300013306 Bacteria 1767
69 Ga0163162_11416193 3300013306 Bacteria 791
70 Ga0157372_10070992 3300013307 Bacteria 3920
71 Ga0157375_10006300 3300013308 Bacteria 10338
72 Ga0157375_10018662 3300013308 Bacteria 6295
73 Ga0157375_10109630 3300013308 Bacteria 2857
74 Ga0157375_10247000 3300013308 Bacteria 1945
75 Ga0157375_11777047 3300013308 Bacteria 731
76 Ga0163163_10083623 3300014325 Bacteria 3197
77 Ga0163163_10336097 3300014325 Unclassified 1565
78 Ga0157380_11970863 3300014326 Bacteria 645
79 Ga0182008_10315589 3300014497 Bacteria 821
80 Ga0157379_10061356 3300014968 Unclassified 3362
81 Ga0157376_10236309 3300014969 Bacteria 1700
82 Ga0207697_10271718 3300025315 Bacteria 751
83 Ga0207680_10115220 3300025903 Unclassified 1750
84 Ga0207684_10868774 3300025910 Bacteria 759
85 Ga0207707_10769139 3300025912 Unclassified 804
86 Ga0207695_10640425 3300025913 Bacteria 944
87 Ga0207671_10376630 3300025914 Bacteria 1127
88 Ga0207657_10681567 3300025919 Bacteria 799
89 Ga0207649_11080019 3300025920 Unclassified 633
90 Ga0207694_10038369 3300025924 Bacteria 3683
91 Ga0207694_11003983 3300025924 Unclassified 706
92 Ga0207650_10459805 3300025925 Bacteria 1060
93 Ga0207700_10099702 3300025928 Bacteria 2313
94 Ga0207664_10056496 3300025929 Bacteria 3117
95 Ga0207644_11035490 3300025931 Unclassified 689
96 Ga0207690_10001874 3300025932 Bacteria 12896
97 Ga0207706_10882777 3300025933 Bacteria 756
98 Ga0207686_10584625 3300025934 Bacteria 877
99 Ga0207686_10815165 3300025934 Unclassified 749
100 Ga0207670_10159188 3300025936 Unclassified 1684
101 Ga0207670_10639108 3300025936 Bacteria 876
102 Ga0207704_10008027 3300025938 Bacteria 5021
103 Ga0207691_10192458 3300025940 Unclassified 1778
104 Ga0207711_10033545 3300025941 Bacteria 4345
105 Ga0207711_10811617 3300025941 Bacteria 871
106 Ga0207711_10916864 3300025941 Bacteria 814
107 Ga0207679_10252992 3300025945 Bacteria 1499
108 Ga0207667_10130157 3300025949 Unclassified 2592
109 Ga0207667_10883319 3300025949 Bacteria 886
110 Ga0207668_10422691 3300025972 Bacteria 1131
111 Ga0207658_10111206 3300025986 Unclassified 2166
112 Ga0207658_10201745 3300025986 Bacteria 1661
113 Ga0207703_10431060 3300026035 Bacteria 1228
114 Ga0207639_10428367 3300026041 Unclassified 1197
115 Ga0207702_11087076 3300026078 Unclassified 794
116 Ga0207641_10014101 3300026088 Bacteria 6551
117 Ga0207641_10267421 3300026088 Unclassified 1603
118 Ga0207648_10155672 3300026089 Unclassified 2017
119 Ga0207676_10018822 3300026095 Bacteria 5028
120 Ga0207676_11308354 3300026095 Bacteria 720
121 Ga0207675_100399539 3300026118 Unclassified 1354
122 Ga0207683_10183858 3300026121 Bacteria 1896
123 Ga0207683_11050959 3300026121 Bacteria 756
124 Ga0207683_11327768 3300026121 Unclassified 666
125 Ga0207698_10149580 3300026142 Bacteria 2024
126 Ga0268266_10000003 3300028379 Bacteria 1701703
127 Ga0268266_10541782 3300028379 Bacteria 1114
128 Ga0307415_100414338 3300032126 Bacteria 1154
129 Ga0373955_0043617 3300035172 Bacteria 2413
130 Ga0373924_0050952 3300035410 Bacteria 1715
131 Ga0373927_0371758 3300035695 Bacteria 942
132 Ga0373933_0331563 3300035724 Unclassified 987
133 Ga0373947_0060914 3300035725 Bacteria 2292
134 Ga0373947_0071815 3300035725 Bacteria 2124
135 Ga0373925_0229082 3300037068 Bacteria 1485
136 Ga0373925_0306431 3300037068 Bacteria 1283
137 Ga0373925_0891209 3300037068 Unclassified 733
138 Ga0395905_0258542 3300037471 Bacteria 1626
139 Ga0436361_0785284 3300039447 Bacteria 1341
140 Ga0451793_0910198 3300041452 Bacteria 1402
141 Ga0451795_1534768 3300041456 Bacteria 634
142 Ga0451833_0681064 3300041491 Bacteria 943
143 Ga0451841_0799129 3300041498 Bacteria 1869
144 Ga0495592_0353906 3300046454 Bacteria 941
145 Ga0495592_0861410 3300046454 Unclassified 535
146 Ga0495580_0006453 3300046472 Bacteria 9549
147 Ga0495580_0376964 3300046472 Bacteria 959
148 Ga0495582_0320895 3300046473 Bacteria 891
149 Ga0495662_0040389 3300046476 Bacteria 2253
150 Ga0495664_0054167 3300046477 Bacteria 2385
151 Ga0495606_0058834 3300046507 Bacteria 2468
152 Ga0495608_0038984 3300046511 Bacteria 3187
153 Ga0495628_0112287 3300046516 Bacteria 2095
154 Ga0495630_0048402 3300046517 Bacteria 3181
155 Ga0495630_0133367 3300046517 Bacteria 1887
156 Ga0495663_0100209 3300046525 Bacteria 953
157 Ga0495642_0008085 3300046528 Bacteria 4025
158 Ga0495652_0699703 3300046529 Unclassified 682
159 Ga0495640_0122485 3300046533 Bacteria 1689
160 Ga0495633_0022057 3300046558 Bacteria 3174
161 Ga0495634_0053217 3300046642 Bacteria 2712
162 Ga0495635_0274468 3300046663 Bacteria 1133
163 Ga0495659_0442237 3300046664 Bacteria 565
164 Ga0495599_0138327 3300046678 Bacteria 1511
165 Ga0495613_0330882 3300046689 Bacteria 1050
166 Ga0495624_0168960 3300046690 Bacteria 1334
167 Ga0495670_0530290 3300046691 Unclassified 640
168 Ga0495671_0066483 3300046692 Bacteria 1774
169 Ga0495636_0041080 3300047318 Bacteria 1919
170 Ga0495674_0324967 3300047319 Bacteria 1253
171 Ga0495675_0203043 3300047444 Bacteria 1206
172 Ga0495684_0021763 3300047471 Bacteria 4936
173 Ga0495684_0788703 3300047471 Bacteria 622
174 Ga0496102_1131361 3300048905 Bacteria 703
175 Ga0496103_1000223 3300048906 Unclassified 521
176 Ga0496110_1571165 3300048913 Bacteria 568
177 Ga0496112_0133617 3300048915 Bacteria 2452
178 Ga0496113_1240817 3300048916 Unclassified 581
179 Ga0496114_0425687 3300048917 Bacteria 1176
180 Ga0496115_0011550 3300048918 Bacteria 6620
181 Ga0496121_0014076 3300048924 Bacteria 8534
182 Ga0496126_0268960 3300048929 Bacteria 1415
183 Ga0496126_0362815 3300048929 Bacteria 1183
184 Ga0501033_0000146 3300049570 Bacteria 68193
185 Ga0501036_0685420 3300049572 Unclassified 847
186 Ga0501037_0000130 3300049573 Bacteria 70192
187 Ga0501038_0024477 3300049574 Bacteria 5387
188 Ga0501043_0000099 3300049579 Bacteria 79242
189 Ga0501047_0278160 3300049581 Bacteria 1519
190 Ga0501067_0577063 3300049583 Bacteria 630
191 Ga0501067_0798063 3300049583 Unclassified 532
192 Ga0501068_0331762 3300049584 Bacteria 976
193 Ga0501069_0000059 3300049585 Bacteria 62956
194 Ga0501070_0000068 3300049586 Bacteria 87033
195 Ga0501071_0006740 3300049587 Bacteria 7474
196 Ga0501074_0000029 3300049590 Bacteria 66942
197 Ga0501076_0328960 3300049592 Unclassified 1254
198 Ga0501080_0005071 3300049742 Bacteria 11731
199 Ga0501083_0000100 3300049744 Bacteria 58909
200 Ga0501035_0000101 3300049822 Bacteria 106949
201 Ga0501044_0000010 3300049823 Bacteria 260121
202 nmdc:mga0yw44_492595_c1 3300050492 Bacteria 831
203 nmdc:mga08x19_145373_c1 3300050514 Bacteria 1603
204 Ga0495601_0265373 3300053077 Bacteria 1120
205 Ga0500595_171366 3300053119 Bacteria 603
206 Ga0501082_0074340 3300060353 Bacteria 2927
207 Ga0466962_0155553 3300061719 Bacteria 1110
208 2507511857 2507262055 Bacteria 8048963
209 2509140011 2508501127 Bacteria 7037543
210 2515624732 2515154112 Bacteria 8294334
211 2874592236 2874590934 Bacteria 8299676
212 2874647352 2874645413 Bacteria 8214782
213 2876774763 2876771140 Bacteria 8287509
214 2876819716 2876818435 Bacteria 8274608
215 2879079331 2879074833 Bacteria 8279565
216 2879129064 2879127579 Bacteria 8294491
217 2879144781 2879142872 Bacteria 8267021
218 2903730722 2903727486 Bacteria 8281579
219 2932806597 2932801729 Bacteria 7987968
220 2935613502 2935608549 Bacteria 8203142
221 2935824645 2935819856 Bacteria 8261050
222 2935851865 2935847175 Bacteria 8228321
223 2935911215 2935908558 Bacteria 8568796
224 2935920747 2935916978 Bacteria 9113783
225 2935928244 2935926038 Bacteria 8601059
226 2935937889 2935934488 Bacteria 8602579
227 2935945171 2935942939 Bacteria 8599779
228 2935954323 2935951376 Bacteria 8602333
229 2935971409 2935967501 Bacteria 8603075
230 2935982029 2935975950 Bacteria 8347125
231 8019624173 8019619141 Bacteria 9218857
232 8019637853 8019629233 Bacteria 8687553
233 8019641771 8019638758 Bacteria 9062356
234 8019665782 8019659431 Bacteria 8577854
235 8019675310 8019668869 Bacteria 8791617
236 8019680797 8019678201 Bacteria 8863603
237 8019694972 8019687851 Bacteria 8712826
238 Ga0500595_009857
239 JGI25404J52841_10003152
240 Ga0070658_10419383
241 Ga0070658_11261640
242 Ga0070683_100384622
243 Ga0070690_100058028
244 Ga0070680_100209643
245 Ga0070682_100946874
246 Ga0070669_101657965
247 Ga0070667_100151608
248 Ga0070667_100948858
249 Ga0070714_100090709
250 Ga0070713_100102017
251 Ga0070710_10984990
252 Ga0068867_100117692
253 Ga0070679_100306094
254 Ga0068853_100194870
255 Ga0070672_100275447
256 Ga0070686_100794973
257 Ga0070693_100150719
258 Ga0070665_100000136
259 Ga0070665_101125005
260 Ga0068855_100149796
261 Ga0068855_100989367
262 Ga0068855_101301835
263 Ga0068854_101048067
264 Ga0068856_101661444
265 Ga0068852_100531965
266 Ga0068852_101128557
267 Ga0068859_100929323
268 Ga0068859_101615135
269 Ga0068864_100085020
270 Ga0068861_101406688
271 Ga0068870_10606140
272 Ga0068863_100053148
273 Ga0068863_100857023
274 Ga0068858_100819454
275 Ga0068862_100452705
276 Ga0081540_1006556
277 Ga0070717_10311036
278 Ga0097621_100366656
279 Ga0068865_100038601
280 Ga0097620_100929361
281 Ga0097620_101615074
282 Ga0105240_10287368
283 Ga0105240_10409082
284 Ga0105245_10236629
285 Ga0105243_11514022
286 Ga0105242_10105306
287 Ga0105242_10561132
288 Ga0105242_10650456
289 Ga0105242_10852451
290 Ga0105248_10013193
291 Ga0105248_10114773
292 Ga0105237_10364037
293 Ga0105238_10044998
294 Ga0105238_10442137
295 Ga0105238_10602675
296 Ga0105249_10114631
297 Ga0105249_10658184
298 Ga0105239_10802967
299 Ga0105239_11393898
300 Ga0157369_10559563
301 Ga0157374_10791927
302 Ga0157374_10949800
303 Ga0163162_10259338
304 Ga0163162_10274127
305 Ga0163162_10290374
306 Ga0163162_11416193
307 Ga0157372_10070992
308 Ga0157375_10006300
309 Ga0157375_10018662
310 Ga0157375_10109630
311 Ga0157375_10247000
312 Ga0157375_11777047
313 Ga0163163_10083623
314 Ga0163163_10336097
315 Ga0157380_11970863
316 Ga0182008_10315589
317 Ga0157379_10061356
318 Ga0157376_10236309
319 Ga0207697_10271718
320 Ga0207680_10115220
321 Ga0207684_10868774
322 Ga0207707_10769139
323 Ga0207695_10640425
324 Ga0207671_10376630
325 Ga0207657_10681567
326 Ga0207649_11080019
327 Ga0207694_10038369
328 Ga0207694_11003983
329 Ga0207650_10459805
330 Ga0207700_10099702
331 Ga0207664_10056496
332 Ga0207644_11035490
333 Ga0207690_10001874
334 Ga0207706_10882777
335 Ga0207686_10584625
336 Ga0207686_10815165
337 Ga0207670_10159188
338 Ga0207670_10639108
339 Ga0207704_10008027
340 Ga0207691_10192458
341 Ga0207711_10033545
342 Ga0207711_10811617
343 Ga0207711_10916864
344 Ga0207679_10252992
345 Ga0207667_10130157
346 Ga0207667_10883319
347 Ga0207668_10422691
348 Ga0207658_10111206
349 Ga0207658_10201745
350 Ga0207703_10431060
351 Ga0207639_10428367
352 Ga0207702_11087076
353 Ga0207641_10014101
354 Ga0207641_10267421
355 Ga0207648_10155672
356 Ga0207676_10018822
357 Ga0207676_11308354
358 Ga0207675_100399539
359 Ga0207683_10183858
360 Ga0207683_11050959
361 Ga0207683_11327768
362 Ga0207698_10149580
363 Ga0268266_10000003
364 Ga0268266_10541782
365 Ga0307415_100414338
366 Ga0373955_0043617
367 Ga0373924_0050952
368 Ga0373927_0371758
369 Ga0373933_0331563
370 Ga0373947_0060914
371 Ga0373947_0071815
372 Ga0373925_0229082
373 Ga0373925_0306431
374 Ga0373925_0891209
375 Ga0395905_0258542
376 Ga0436361_0785284
377 Ga0451793_0910198
378 Ga0451795_1534768
379 Ga0451833_0681064
380 Ga0451841_0799129
381 Ga0495592_0353906
382 Ga0495592_0861410
383 Ga0495580_0006453
384 Ga0495580_0376964
385 Ga0495582_0320895
386 Ga0495662_0040389
387 Ga0495664_0054167
388 Ga0495606_0058834
389 Ga0495608_0038984
390 Ga0495628_0112287
391 Ga0495630_0048402
392 Ga0495630_0133367
393 Ga0495663_0100209
394 Ga0495642_0008085
395 Ga0495652_0699703
396 Ga0495640_0122485
397 Ga0495633_0022057
398 Ga0495634_0053217
399 Ga0495635_0274468
400 Ga0495659_0442237
401 Ga0495599_0138327
402 Ga0495613_0330882
403 Ga0495624_0168960
404 Ga0495670_0530290
405 Ga0495671_0066483
406 Ga0495636_0041080
407 Ga0495674_0324967
408 Ga0495675_0203043
409 Ga0495684_0021763
410 Ga0495684_0788703
411 Ga0496102_1131361
412 Ga0496103_1000223
413 Ga0496110_1571165
414 Ga0496112_0133617
415 Ga0496113_1240817
416 Ga0496114_0425687
417 Ga0496115_0011550
418 Ga0496121_0014076
419 Ga0496126_0268960
420 Ga0496126_0362815
421 Ga0501033_0000146
422 Ga0501036_0685420
423 Ga0501037_0000130
424 Ga0501038_0024477
425 Ga0501043_0000099
426 Ga0501047_0278160
427 Ga0501067_0577063
428 Ga0501067_0798063
429 Ga0501068_0331762
430 Ga0501069_0000059
431 Ga0501070_0000068
432 Ga0501071_0006740
433 Ga0501074_0000029
434 Ga0501076_0328960
435 Ga0501080_0005071
436 Ga0501083_0000100
437 Ga0501035_0000101
438 Ga0501044_0000010
439 nmdc:mga0yw44_492595_c1
440 nmdc:mga08x19_145373_c1
441 Ga0495601_0265373
442 Ga0500595_171366
443 Ga0501082_0074340
444 Ga0466962_0155553
445 2507511857
446 2509140011
447 2515624732
448 2874592236
449 2874647352
450 2876774763
451 2876819716
452 2879079331
453 2879129064
454 2879144781
455 2903730722
456 2932806597
457 2935613502
458 2935824645
459 2935851865
460 2935911215
461 2935920747
462 2935928244
463 2935937889
464 2935945171
465 2935954323
466 2935971409
467 2935982029
468 8019624173
469 8019637853
470 8019641771
471 8019665782
472 8019675310
473 8019680797
474 8019694972

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01124

MAPEG

MAPEG family

27

163

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.9183 9 152
5bqg-assembly1.cif.gz_A crystal structure of mpges-1 bound to an inhibitor 0.8538 4 152
6sss-assembly1.cif.gz_C crystal structure of human microsomal glutathione s-transferase 2 0.8305 12 152
6ssr-assembly1.cif.gz_A crystal structure of human microsomal glutathione s-transferase 2 at 3.8 angstroms resolution 0.8303 12 152
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.8276 9 152
ID Description Score Start End Superfamily
4wabA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.9165 9 152 1.20.120.550
af_B0R1E9_1_152_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.9087 1 152 1.20.120.550
4yl1A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8992 4 152 1.20.120.550
af_P10620_2_155_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8968 6 151 1.20.120.550
af_B0R1E9_1_152_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8863 1 152 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A1F3AFH6-F1-model_v4 Microsomal glutathione S-transferase 1 (EC 2.5.1.18) 0.98 1 152 GO:0004364
GO:0016020
AF-A0A2S5U0J8-F1-model_v4 deleted 0.9796 1 152
AF-A0A661FTJ4-F1-model_v4 Microsomal glutathione S-transferase 1 (EC 2.5.1.18) 0.9769 2 153 GO:0004364
GO:0016020
AF-A0A7J5ETQ7-F1-model_v4 Microsomal glutathione S-transferase 1 (EC 2.5.1.18) 0.9764 5 153 GO:0004364
GO:0016020
AF-A0A501XLW5-F1-model_v4 Microsomal glutathione S-transferase 1 (EC 2.5.1.18) 0.974 1 153 GO:0004364
GO:0016020

Map