F350445

General Info

Members Datasets Scaffolds Average Seq Length
237 177 474 219

Family's Representative Sequence

Representative Sequence 3300053092|Ga0500583_0186398|Ga0500583_0186398_232_957
Length 241
Sequence MRYPGRDDRYCQDRTDPTRRARMNGVHDLGGMHGMGPIQKEKNEPVFHANWEERAFGITRAMGTWQLWNLDASRFQRELIAPVDYLRWSYYERWIRALEELMLKTQLVSRTELDTGRPDAGSTIHTPKFTAENVSVLASKGSPAKRDVPVTASFGVGQRVRARNINPVGHTRLPRYVRGKVGTIDRDHGVFVFPDTNALFLGEKPQHVYSVRFDARELWGAAASPHDSVYVDLWDDYLEHV

Samples

Sample ID Description Type Environment
1 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
60 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
84 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
90 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
91 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
103 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
104 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
105 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
108 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
175 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
176 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
177 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.05
Metatranscriptomes 1.69
Isolates 1.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 0.84
Rhizosphere 94.09
Stem 0
Stem Tuber 0
Unclassified 7.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500583_0186398 3300053092 Unclassified 1033
2 Ga0070683_100361261 3300005329 Bacteria 1383
3 Ga0070680_100029689 3300005336 Bacteria 4390
4 Ga0070661_100018980 3300005344 Bacteria 4896
5 Ga0070692_10333490 3300005345 Archaea 937
6 Ga0070669_100076194 3300005353 Bacteria 2489
7 Ga0070714_100084771 3300005435 Bacteria 2766
8 Ga0070710_10063426 3300005437 Bacteria 2111
9 Ga0070701_10031998 3300005438 Bacteria 2615
10 Ga0070711_100035781 3300005439 Bacteria 3323
11 Ga0070705_100031989 3300005440 Unclassified 2918
12 Ga0070708_100556792 3300005445 Bacteria 1081
13 Ga0070681_10010408 3300005458 Bacteria 9186
14 Ga0070681_10048126 3300005458 Bacteria 4262
15 Ga0070681_10251025 3300005458 Bacteria 1682
16 Ga0070706_100068054 3300005467 Bacteria 3292
17 Ga0070706_100310072 3300005467 Bacteria 1472
18 Ga0070707_100092833 3300005468 Bacteria 2922
19 Ga0070707_100244012 3300005468 Bacteria 1748
20 Ga0070697_100690202 3300005536 Bacteria 900
21 Ga0070695_100004860 3300005545 Bacteria 7910
22 Ga0070695_100043207 3300005545 Bacteria 2865
23 Ga0070696_100014950 3300005546 Bacteria 5211
24 Ga0070696_100031857 3300005546 Bacteria 3615
25 Ga0070704_100003233 3300005549 Bacteria 9309
26 Ga0070704_100101867 3300005549 Bacteria 2165
27 Ga0068855_100118082 3300005563 Bacteria 3038
28 Ga0068855_100203370 3300005563 Bacteria 2229
29 Ga0068856_100005860 3300005614 Bacteria 12114
30 Ga0068859_100108809 3300005617 Bacteria 2833
31 Ga0068864_100104285 3300005618 Bacteria 2518
32 Ga0068864_100111731 3300005618 Bacteria 2435
33 Ga0068858_100009669 3300005842 Bacteria 9189
34 Ga0068862_100066894 3300005844 Bacteria 3097
35 Ga0081455_10017310 3300005937 Bacteria 6917
36 Ga0081538_10012848 3300005981 Bacteria 6682
37 Ga0070717_10116699 3300006028 Bacteria 2282
38 Ga0097621_100668730 3300006237 Bacteria 954
39 Ga0068871_100035748 3300006358 Bacteria 3950
40 Ga0075428_100000956 3300006844 Bacteria 30619
41 Ga0075428_100120976 3300006844 Bacteria 2851
42 Ga0075430_100000199 3300006846 Bacteria 40674
43 Ga0075430_100305743 3300006846 Bacteria 1315
44 Ga0075430_100942980 3300006846 Bacteria 711
45 Ga0075431_100000510 3300006847 Bacteria 32484
46 Ga0075431_100000846 3300006847 Bacteria 26815
47 Ga0075431_100402136 3300006847 Bacteria 1370
48 Ga0075431_100841658 3300006847 Unclassified 889
49 Ga0075433_10008453 3300006852 Bacteria 8214
50 Ga0075433_10008725 3300006852 Bacteria 8089
51 Ga0075433_10024830 3300006852 Bacteria 5063
52 Ga0075434_100025174 3300006871 Bacteria 5822
53 Ga0075434_100079349 3300006871 Bacteria 3279
54 Ga0075429_100001877 3300006880 Bacteria 17415
55 Ga0075429_100317179 3300006880 Bacteria 1364
56 Ga0075436_100244085 3300006914 Bacteria 1278
57 Ga0097620_100108808 3300006931 Bacteria 2833
58 Ga0075435_100185751 3300007076 Unclassified 1758
59 Ga0111539_10000395 3300009094 Bacteria 54076
60 Ga0111539_10058937 3300009094 Bacteria 4554
61 Ga0111539_10850078 3300009094 Unclassified 1062
62 Ga0105245_10155019 3300009098 Bacteria 2169
63 Ga0114129_10077498 3300009147 Unclassified 4623
64 Ga0114129_10085069 3300009147 Bacteria 4388
65 Ga0114129_10226642 3300009147 Bacteria 2518
66 Ga0114129_10334303 3300009147 Bacteria 2010
67 Ga0105243_10028810 3300009148 Bacteria 4266
68 Ga0105241_10068018 3300009174 Bacteria 2758
69 Ga0105241_10109193 3300009174 Bacteria 2212
70 Ga0105248_10122711 3300009177 Bacteria 2931
71 Ga0105238_10441997 3300009551 Bacteria 1297
72 Ga0105249_10068906 3300009553 Bacteria 3264
73 Ga0105249_10125912 3300009553 Bacteria 2440
74 Ga0157369_10046900 3300013105 Bacteria 4694
75 Ga0163162_10042942 3300013306 Bacteria 4526
76 Ga0157372_10006145 3300013307 Bacteria 12762
77 Ga0157375_10280230 3300013308 Bacteria 1830
78 Ga0163163_10106008 3300014325 Bacteria 2836
79 Ga0157379_10349670 3300014968 Bacteria 1353
80 Ga0206356_10825083 3300020070 Bacteria 1598
81 Ga0206350_10050793 3300020080 Bacteria 1102
82 Ga0213873_10000839 3300021358 Bacteria 4953
83 Ga0213876_10015002 3300021384 Bacteria 4107
84 Ga0224712_10004270 3300022467 Bacteria 3836
85 Ga0228598_1001900 3300024227 Plasmid 4541
86 Ga0207426_1056026 3300025302 Bacteria 1152
87 Ga0207647_10147417 3300025904 Bacteria 1377
88 Ga0207684_10127476 3300025910 Bacteria 2184
89 Ga0207684_10254745 3300025910 Bacteria 1514
90 Ga0207684_10380959 3300025910 Bacteria 1213
91 Ga0207684_10729272 3300025910 Bacteria 841
92 Ga0207654_10087981 3300025911 Unclassified 1886
93 Ga0207707_10003037 3300025912 Bacteria 14914
94 Ga0207707_10032220 3300025912 Bacteria 4588
95 Ga0207707_10034043 3300025912 Bacteria 4458
96 Ga0207707_10350350 3300025912 Bacteria 1272
97 Ga0207660_10024010 3300025917 Bacteria 4124
98 Ga0207652_10145731 3300025921 Bacteria 2119
99 Ga0207646_10011679 3300025922 Bacteria 8492
100 Ga0207646_10078548 3300025922 Bacteria 2950
101 Ga0207646_10190603 3300025922 Bacteria 1852
102 Ga0207681_10112800 3300025923 Unclassified 1981
103 Ga0207687_10094022 3300025927 Bacteria 2193
104 Ga0207686_10726663 3300025934 Bacteria 791
105 Ga0207709_10027555 3300025935 Bacteria 3275
106 Ga0207689_10032201 3300025942 Bacteria 4361
107 Ga0207667_10078187 3300025949 Bacteria 3429
108 Ga0207667_10093625 3300025949 Bacteria 3103
109 Ga0207712_10116451 3300025961 Bacteria 2014
110 Ga0207703_10006146 3300026035 Bacteria 9609
111 Ga0207702_10061498 3300026078 Bacteria 3203
112 Ga0207641_10421812 3300026088 Bacteria 1285
113 Ga0207428_10000783 3300027907 Bacteria 35993
114 Ga0207428_10008936 3300027907 Bacteria 9024
115 Ga0268265_10052137 3300028380 Bacteria 3092
116 Ga0268265_10183288 3300028380 Bacteria 1801
117 Ga0268264_10827180 3300028381 Bacteria 926
118 Ga0265327_10002283 3300031251 Bacteria 20595
119 Ga0307513_10006745 3300031456 Bacteria 14973
120 Ga0307509_10000118 3300031507 Bacteria 115087
121 Ga0307516_10010439 3300031730 Bacteria 10207
122 Ga0307406_10084735 3300031901 Bacteria 2117
123 Ga0307407_10282293 3300031903 Bacteria 1151
124 Ga0307409_100312232 3300031995 Bacteria 1468
125 Ga0316593_10107175 3300032168 Unclassified 995
126 Ga0373940_0018842 3300035088 Bacteria 1736
127 Ga0373944_0023194 3300035089 Bacteria 1809
128 Ga0373954_0047104 3300035118 Bacteria 2016
129 Ga0373955_0002737 3300035172 Bacteria 7727
130 Ga0373942_0148515 3300035207 Unclassified 751
131 Ga0373933_0001830 3300035724 Bacteria 12312
132 Ga0373937_0005801 3300036401 Bacteria 10614
133 Ga0373937_0695650 3300036401 Bacteria 963
134 Ga0373925_0003690 3300037068 Bacteria 11767
135 Ga0373925_0027439 3300037068 Bacteria 4168
136 Ga0395899_0131478 3300037312 Bacteria 1787
137 Ga0395900_0326670 3300037418 Bacteria 1513
138 Ga0395900_0748976 3300037418 Bacteria 907
139 Ga0395898_0481346 3300037466 Bacteria 1181
140 Ga0436365_0624304 3300039437 Bacteria 6398
141 Ga0436365_1302027 3300039437 Bacteria 11105
142 Ga0436362_1238324 3300039453 Bacteria 10383
143 Ga0439461_0078341 3300041410 Bacteria 776
144 Ga0439465_0060173 3300041413 Bacteria 1258
145 Ga0439432_019170 3300042006 Bacteria 2281
146 Ga0439446_0143272 3300042156 Bacteria 782
147 Ga0451577_0024863 3300042876 Bacteria 5441
148 Ga0453683_0019351 3300044673 Bacteria 4363
149 Ga0453683_0076372 3300044673 Bacteria 2097
150 Ga0466965_0262127 3300044683 Bacteria 929
151 Ga0466966_0008157 3300044684 Bacteria 6942
152 Ga0466966_0293012 3300044684 Bacteria 978
153 Ga0466961_0259861 3300044693 Bacteria 1065
154 Ga0466963_0003799 3300044694 Bacteria 8705
155 Ga0453684_0216760 3300044712 Bacteria 2220
156 Ga0466971_0009046 3300044719 Bacteria 4352
157 Ga0466959_0006069 3300045049 Bacteria 8337
158 Ga0451576_0106314 3300045051 Bacteria 2920
159 Ga0451576_0191397 3300045051 Bacteria 2137
160 Ga0451576_0293013 3300045051 Bacteria 1701
161 Ga0466967_0021540 3300045976 Bacteria 5240
162 Ga0466967_0184772 3300045976 Bacteria 1968
163 Ga0466967_0316627 3300045976 Bacteria 1504
164 Ga0466967_0493205 3300045976 Bacteria 1201
165 Ga0495592_0001591 3300046454 Bacteria 15870
166 Ga0495638_0340376 3300046460 Bacteria 795
167 Ga0495651_0020436 3300046462 Bacteria 5140
168 Ga0495580_0090943 3300046472 Unclassified 2124
169 Ga0495580_0355694 3300046472 Bacteria 991
170 Ga0495580_0471562 3300046472 Bacteria 840
171 Ga0495594_0020470 3300046499 Bacteria 3524
172 Ga0495608_0002359 3300046511 Bacteria 13607
173 Ga0495618_0209480 3300046514 Bacteria 1232
174 Ga0495628_0026456 3300046516 Bacteria 4730
175 Ga0495632_0000022 3300046519 Bacteria 187045
176 Ga0495652_0132891 3300046529 Bacteria 1967
177 Ga0495587_0019627 3300046536 Bacteria 4182
178 Ga0495645_0003084 3300046543 Bacteria 11283
179 Ga0495667_0001979 3300046559 Bacteria 13569
180 Ga0495635_0055950 3300046663 Bacteria 2717
181 Ga0495657_0025769 3300046675 Bacteria 4173
182 Ga0495599_0012505 3300046678 Bacteria 5234
183 Ga0495623_0004752 3300046679 Bacteria 8927
184 Ga0495600_0002463 3300046809 Bacteria 10624
185 Ga0495604_0053505 3300047317 Bacteria 3119
186 Ga0495674_0148947 3300047319 Bacteria 1963
187 Ga0495680_0013783 3300047322 Bacteria 7035
188 Ga0495684_0374520 3300047471 Bacteria 1006
189 Ga0495602_0000568 3300048088 Bacteria 34391
190 Ga0496102_1075433 3300048905 Bacteria 724
191 Ga0496114_0148070 3300048917 Bacteria 2036
192 Ga0496126_0295763 3300048929 Bacteria 1338
193 Ga0501033_0755315 3300049570 Bacteria 659
194 Ga0501034_0148826 3300049571 Bacteria 2317
195 Ga0501036_0108390 3300049572 Bacteria 2348
196 Ga0501037_0107454 3300049573 Bacteria 2010
197 Ga0501038_0030884 3300049574 Bacteria 4736
198 Ga0501040_0406630 3300049576 Unclassified 978
199 Ga0501043_0104157 3300049579 Bacteria 2229
200 Ga0501046_0265085 3300049580 Bacteria 1261
201 Ga0501047_0142174 3300049581 Bacteria 2277
202 Ga0501048_0131604 3300049582 Bacteria 1768
203 Ga0501067_0080256 3300049583 Bacteria 1808
204 Ga0501067_0275458 3300049583 Unclassified 937
205 Ga0501073_0052558 3300049589 Bacteria 2852
206 Ga0501074_0037429 3300049590 Bacteria 3517
207 Ga0501080_0086164 3300049742 Bacteria 2918
208 Ga0501035_0657000 3300049822 Bacteria 849
209 Ga0501044_0260534 3300049823 Bacteria 1672
210 nmdc:mga07m45_307378_c1 3300050496 Bacteria 922
211 nmdc:mga05p37_18439_c1 3300050507 Bacteria 8430
212 nmdc:mga05p37_250008_c1 3300050507 Unclassified 2127
213 nmdc:mga05p37_522291_c1 3300050507 Bacteria 1358
214 nmdc:mga09592_5406_c1 3300050508 Bacteria 10380
215 nmdc:mga0qj67_294538_c1 3300050509 Bacteria 1315
216 nmdc:mga0qj67_4058_c1 3300050509 Bacteria 10614
217 nmdc:mga06r32_16269_c1 3300050510 Bacteria 6774
218 nmdc:mga06r32_293013_c1 3300050510 Bacteria 1614
219 nmdc:mga06r32_316322_c1 3300050510 Bacteria 1546
220 nmdc:mga06r32_769_c1 3300050510 Bacteria 28288
221 nmdc:mga08y16_1013_c1 3300050511 Bacteria 27501
222 nmdc:mga08y16_12218_c1 3300050511 Bacteria 9024
223 nmdc:mga08y16_736372_c1 3300050511 Unclassified 983
224 nmdc:mga0n895_788018_c1 3300050512 Unclassified 942
225 nmdc:mga0rr50_157099_c1 3300050513 Unclassified 1843
226 nmdc:mga0a205_8248_c1 3300050515 Bacteria 9469
227 nmdc:mga0a205_826_c1 3300050515 Bacteria 25211
228 Ga0495601_0000151 3300053077 Bacteria 38914
229 Ga0495612_0008289 3300053078 Bacteria 4217
230 Ga0495595_0000226 3300053084 Bacteria 22467
231 Ga0495619_0001310 3300053085 Bacteria 16345
232 Ga0501084_0338826 3300054114 Bacteria 1270
233 Ga0501082_0356612 3300060353 Bacteria 1275
234 Ga0530510_0023548 3300061734 Bacteria 4389
235 2558906100 2558860112 Bacteria 9931328
236 2870786737 2870782633 Bacteria 9624083
237 8054473722 8054472261 Bacteria 7464355
238 Ga0500583_0186398
239 Ga0070683_100361261
240 Ga0070680_100029689
241 Ga0070661_100018980
242 Ga0070692_10333490
243 Ga0070669_100076194
244 Ga0070714_100084771
245 Ga0070710_10063426
246 Ga0070701_10031998
247 Ga0070711_100035781
248 Ga0070705_100031989
249 Ga0070708_100556792
250 Ga0070681_10010408
251 Ga0070681_10048126
252 Ga0070681_10251025
253 Ga0070706_100068054
254 Ga0070706_100310072
255 Ga0070707_100092833
256 Ga0070707_100244012
257 Ga0070697_100690202
258 Ga0070695_100004860
259 Ga0070695_100043207
260 Ga0070696_100014950
261 Ga0070696_100031857
262 Ga0070704_100003233
263 Ga0070704_100101867
264 Ga0068855_100118082
265 Ga0068855_100203370
266 Ga0068856_100005860
267 Ga0068859_100108809
268 Ga0068864_100104285
269 Ga0068864_100111731
270 Ga0068858_100009669
271 Ga0068862_100066894
272 Ga0081455_10017310
273 Ga0081538_10012848
274 Ga0070717_10116699
275 Ga0097621_100668730
276 Ga0068871_100035748
277 Ga0075428_100000956
278 Ga0075428_100120976
279 Ga0075430_100000199
280 Ga0075430_100305743
281 Ga0075430_100942980
282 Ga0075431_100000510
283 Ga0075431_100000846
284 Ga0075431_100402136
285 Ga0075431_100841658
286 Ga0075433_10008453
287 Ga0075433_10008725
288 Ga0075433_10024830
289 Ga0075434_100025174
290 Ga0075434_100079349
291 Ga0075429_100001877
292 Ga0075429_100317179
293 Ga0075436_100244085
294 Ga0097620_100108808
295 Ga0075435_100185751
296 Ga0111539_10000395
297 Ga0111539_10058937
298 Ga0111539_10850078
299 Ga0105245_10155019
300 Ga0114129_10077498
301 Ga0114129_10085069
302 Ga0114129_10226642
303 Ga0114129_10334303
304 Ga0105243_10028810
305 Ga0105241_10068018
306 Ga0105241_10109193
307 Ga0105248_10122711
308 Ga0105238_10441997
309 Ga0105249_10068906
310 Ga0105249_10125912
311 Ga0157369_10046900
312 Ga0163162_10042942
313 Ga0157372_10006145
314 Ga0157375_10280230
315 Ga0163163_10106008
316 Ga0157379_10349670
317 Ga0206356_10825083
318 Ga0206350_10050793
319 Ga0213873_10000839
320 Ga0213876_10015002
321 Ga0224712_10004270
322 Ga0228598_1001900
323 Ga0207426_1056026
324 Ga0207647_10147417
325 Ga0207684_10127476
326 Ga0207684_10254745
327 Ga0207684_10380959
328 Ga0207684_10729272
329 Ga0207654_10087981
330 Ga0207707_10003037
331 Ga0207707_10032220
332 Ga0207707_10034043
333 Ga0207707_10350350
334 Ga0207660_10024010
335 Ga0207652_10145731
336 Ga0207646_10011679
337 Ga0207646_10078548
338 Ga0207646_10190603
339 Ga0207681_10112800
340 Ga0207687_10094022
341 Ga0207686_10726663
342 Ga0207709_10027555
343 Ga0207689_10032201
344 Ga0207667_10078187
345 Ga0207667_10093625
346 Ga0207712_10116451
347 Ga0207703_10006146
348 Ga0207702_10061498
349 Ga0207641_10421812
350 Ga0207428_10000783
351 Ga0207428_10008936
352 Ga0268265_10052137
353 Ga0268265_10183288
354 Ga0268264_10827180
355 Ga0265327_10002283
356 Ga0307513_10006745
357 Ga0307509_10000118
358 Ga0307516_10010439
359 Ga0307406_10084735
360 Ga0307407_10282293
361 Ga0307409_100312232
362 Ga0316593_10107175
363 Ga0373940_0018842
364 Ga0373944_0023194
365 Ga0373954_0047104
366 Ga0373955_0002737
367 Ga0373942_0148515
368 Ga0373933_0001830
369 Ga0373937_0005801
370 Ga0373937_0695650
371 Ga0373925_0003690
372 Ga0373925_0027439
373 Ga0395899_0131478
374 Ga0395900_0326670
375 Ga0395900_0748976
376 Ga0395898_0481346
377 Ga0436365_0624304
378 Ga0436365_1302027
379 Ga0436362_1238324
380 Ga0439461_0078341
381 Ga0439465_0060173
382 Ga0439432_019170
383 Ga0439446_0143272
384 Ga0451577_0024863
385 Ga0453683_0019351
386 Ga0453683_0076372
387 Ga0466965_0262127
388 Ga0466966_0008157
389 Ga0466966_0293012
390 Ga0466961_0259861
391 Ga0466963_0003799
392 Ga0453684_0216760
393 Ga0466971_0009046
394 Ga0466959_0006069
395 Ga0451576_0106314
396 Ga0451576_0191397
397 Ga0451576_0293013
398 Ga0466967_0021540
399 Ga0466967_0184772
400 Ga0466967_0316627
401 Ga0466967_0493205
402 Ga0495592_0001591
403 Ga0495638_0340376
404 Ga0495651_0020436
405 Ga0495580_0090943
406 Ga0495580_0355694
407 Ga0495580_0471562
408 Ga0495594_0020470
409 Ga0495608_0002359
410 Ga0495618_0209480
411 Ga0495628_0026456
412 Ga0495632_0000022
413 Ga0495652_0132891
414 Ga0495587_0019627
415 Ga0495645_0003084
416 Ga0495667_0001979
417 Ga0495635_0055950
418 Ga0495657_0025769
419 Ga0495599_0012505
420 Ga0495623_0004752
421 Ga0495600_0002463
422 Ga0495604_0053505
423 Ga0495674_0148947
424 Ga0495680_0013783
425 Ga0495684_0374520
426 Ga0495602_0000568
427 Ga0496102_1075433
428 Ga0496114_0148070
429 Ga0496126_0295763
430 Ga0501033_0755315
431 Ga0501034_0148826
432 Ga0501036_0108390
433 Ga0501037_0107454
434 Ga0501038_0030884
435 Ga0501040_0406630
436 Ga0501043_0104157
437 Ga0501046_0265085
438 Ga0501047_0142174
439 Ga0501048_0131604
440 Ga0501067_0080256
441 Ga0501067_0275458
442 Ga0501073_0052558
443 Ga0501074_0037429
444 Ga0501080_0086164
445 Ga0501035_0657000
446 Ga0501044_0260534
447 nmdc:mga07m45_307378_c1
448 nmdc:mga05p37_18439_c1
449 nmdc:mga05p37_250008_c1
450 nmdc:mga05p37_522291_c1
451 nmdc:mga09592_5406_c1
452 nmdc:mga0qj67_294538_c1
453 nmdc:mga0qj67_4058_c1
454 nmdc:mga06r32_16269_c1
455 nmdc:mga06r32_293013_c1
456 nmdc:mga06r32_316322_c1
457 nmdc:mga06r32_769_c1
458 nmdc:mga08y16_1013_c1
459 nmdc:mga08y16_12218_c1
460 nmdc:mga08y16_736372_c1
461 nmdc:mga0n895_788018_c1
462 nmdc:mga0rr50_157099_c1
463 nmdc:mga0a205_8248_c1
464 nmdc:mga0a205_826_c1
465 Ga0495601_0000151
466 Ga0495612_0008289
467 Ga0495595_0000226
468 Ga0495619_0001310
469 Ga0501084_0338826
470 Ga0501082_0356612
471 Ga0530510_0023548
472 2558906100
473 2870786737
474 8054473722

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02211

NHase_beta_C

Nitrile hydratase beta subunit, C-terminal

143

240

0.98

PF21006

NHase_beta_N

Nitrile hydratase beta subunit, N-terminal

23

141

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dd4-assembly1.cif.gz_G thiocyanate hydrolase (scnase) from thiobacillus thioparus recombinant apo-enzyme 0.9125 131 220
6ylh-assembly1.cif.gz_T rix1-rea1 pre-60s particle - full composite structure 0.8249 134 222
4v3p-assembly1.cif.gz_LU the molecular structure of the left-handed supra-molecular helix of eukaryotic polyribosomes 0.8214 134 220
8i9p-assembly1.cif.gz_LT cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state mak16 0.8191 134 222
6xu6-assembly1.cif.gz_CT drosophila melanogaster testis 80s ribosome 0.8159 134 220
ID Description Score Start End Superfamily
4ob3B02 Mainly Beta;Roll;SH3 type barrels.; 0.9598 126 219 2.30.30.50
3hhtB02 Mainly Beta;Roll;SH3 type barrels.; 0.9591 125 220 2.30.30.50
3hhtB02 Mainly Beta;Roll;SH3 type barrels.; 0.9494 125 220 2.30.30.50
3qxeB02 Mainly Beta;Roll;SH3 type barrels.; 0.9389 125 220 2.30.30.50
2dd4G00 Mainly Beta;Roll;SH3 type barrels.; 0.9125 131 220 2.30.30.50
ID Description Score Start End GO Terms
AF-A0A7X3LYK9-F1-model_v4 Nitrile hydratase subunit beta 0.9765 125 220
AF-A0A523CYD7-F1-model_v4 Nitrile hydratase subunit beta 0.9673 145 221
AF-A0A3N9TKK8-F1-model_v4 Nitrile hydratase subunit beta 0.9667 125 220
AF-A0A1Q7JMQ1-F1-model_v4 Nitrile hydratase beta subunit domain-containing protein 0.9649 123 220 GO:0016020
AF-A0A563EKX1-F1-model_v4 Nitrile hydratase subunit beta 0.9625 134 218

Map