F350113

General Info

Members Datasets Scaffolds Average Seq Length
237 129 474 142

Family's Representative Sequence

Representative Sequence 3300028653|Ga0265323_10054895|Ga0265323_100548951
Length 170
Sequence MRHLKRTAKLGRTSTHRNAMLANIVCSLILHKRVTTTLAKAKAARSVAEKIVTLGKHGTMQSRRLVAARLHTRGPAVQLTKDERQKWRQNEDVLRILFEDIAPAFKERNGGYTRIVKMNQRQGDSAQRAILEWVDFTPPAPAAEETTPGTEAKTPEKAKEGAGKKADAKA

Samples

Sample ID Description Type Environment
1 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
11 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
17 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
18 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
28 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
41 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
42 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
43 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
44 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
45 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
46 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
49 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
50 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
54 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
55 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
56 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
59 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
62 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
63 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
64 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
65 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
66 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
67 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
68 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
69 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
70 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
71 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
72 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
73 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
76 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
77 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
83 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
92 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
98 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
99 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
100 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
106 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
109 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.42
Rhizosphere 98.73
Stem 0
Stem Tuber 0
Unclassified 18.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265323_10054895 3300028653 Bacteria 1402
2 rootH2_10048816 3300003320 Bacteria 4109
3 Ga0058859_11744568 3300004798 Bacteria 1232
4 Ga0070689_100949580 3300005340 Bacteria 763
5 Ga0070689_100971854 3300005340 Bacteria 754
6 Ga0070689_101011458 3300005340 Bacteria 740
7 Ga0070691_10118193 3300005341 Bacteria 1332
8 Ga0070687_100248788 3300005343 Bacteria 1103
9 Ga0070675_101049281 3300005354 Bacteria 749
10 Ga0070688_100716283 3300005365 Unclassified 776
11 Ga0070700_100590592 3300005441 Unclassified 869
12 Ga0070695_101555281 3300005545 Unclassified 551
13 Ga0070693_100983099 3300005547 Unclassified 637
14 Ga0068864_100083228 3300005618 Bacteria 2810
15 Ga0068863_100006046 3300005841 Bacteria 11879
16 Ga0068863_100570673 3300005841 Bacteria 1118
17 Ga0068871_101471536 3300006358 Unclassified 643
18 Ga0075431_100250767 3300006847 Bacteria 1798
19 Ga0075434_100840061 3300006871 Bacteria 934
20 Ga0075435_101186598 3300007076 Bacteria 668
21 Ga0099795_10434867 3300007788 Unclassified 602
22 Ga0105240_10002989 3300009093 Bacteria 26600
23 Ga0105240_10199530 3300009093 Bacteria 2346
24 Ga0105240_10376526 3300009093 Bacteria 1604
25 Ga0111539_10086913 3300009094 Bacteria 3674
26 Ga0111539_11612826 3300009094 Bacteria 752
27 Ga0114129_11256765 3300009147 Bacteria 920
28 Ga0114129_11376207 3300009147 Bacteria 872
29 Ga0105248_11163422 3300009177 Bacteria 872
30 Ga0105238_10083212 3300009551 Bacteria 3190
31 Ga0105238_10714962 3300009551 Bacteria 1014
32 Ga0099796_10016168 3300010159 Bacteria 2198
33 Ga0157374_10501893 3300013296 Bacteria 1218
34 Ga0163163_10019324 3300014325 Bacteria 6397
35 Ga0157376_10047572 3300014969 Unclassified 3542
36 Ga0157376_10183427 3300014969 Bacteria 1915
37 Ga0207699_10370535 3300025906 Bacteria 1015
38 Ga0207707_10876638 3300025912 Bacteria 743
39 Ga0207695_10057722 3300025913 Bacteria 4032
40 Ga0207662_10280027 3300025918 Bacteria 1103
41 Ga0207694_10022169 3300025924 Bacteria 4816
42 Ga0207694_10711910 3300025924 Bacteria 847
43 Ga0207670_10959930 3300025936 Bacteria 718
44 Ga0207670_11001956 3300025936 Unclassified 703
45 Ga0207711_10484158 3300025941 Bacteria 1153
46 Ga0207667_10572952 3300025949 Bacteria 1140
47 Ga0207677_11813442 3300026023 Unclassified 566
48 Ga0207702_10001362 3300026078 Bacteria 24381
49 Ga0207641_10062690 3300026088 Bacteria 3174
50 Ga0207641_10539517 3300026088 Bacteria 1136
51 Ga0207676_10089560 3300026095 Bacteria 2522
52 Ga0265337_1000857 3300028556 Bacteria 15970
53 Ga0265337_1002009 3300028556 Bacteria 9654
54 Ga0265337_1006510 3300028556 Bacteria 4495
55 Ga0265337_1039354 3300028556 Bacteria 1367
56 Ga0265337_1079359 3300028556 Bacteria 898
57 Ga0265337_1116348 3300028556 Bacteria 725
58 Ga0265326_10018220 3300028558 Bacteria 2022
59 Ga0265326_10031050 3300028558 Bacteria 1522
60 Ga0265326_10066386 3300028558 Bacteria 1020
61 Ga0265326_10194428 3300028558 Unclassified 582
62 Ga0265326_10230390 3300028558 Bacteria 534
63 Ga0265319_1000179 3300028563 Bacteria 48318
64 Ga0265319_1018419 3300028563 Bacteria 2629
65 Ga0265319_1043913 3300028563 Bacteria 1499
66 Ga0265319_1215675 3300028563 Unclassified 587
67 Ga0265334_10034621 3300028573 Bacteria 2004
68 Ga0265334_10041044 3300028573 Bacteria 1810
69 Ga0265334_10055440 3300028573 Bacteria 1508
70 Ga0265334_10148135 3300028573 Bacteria 829
71 Ga0265318_10070483 3300028577 Bacteria 1296
72 Ga0265323_10002855 3300028653 Bacteria 7766
73 Ga0265323_10007169 3300028653 Bacteria 4651
74 Ga0265323_10076562 3300028653 Bacteria 1135
75 Ga0265323_10139418 3300028653 Bacteria 781
76 Ga0265323_10179621 3300028653 Bacteria 670
77 Ga0265322_10159909 3300028654 Unclassified 644
78 Ga0265336_10000642 3300028666 Bacteria 19093
79 Ga0265336_10046113 3300028666 Bacteria 1325
80 Ga0265336_10048307 3300028666 Bacteria 1290
81 Ga0265338_10000459 3300028800 Bacteria 72730
82 Ga0265338_10000987 3300028800 Bacteria 47972
83 Ga0265338_10001116 3300028800 Bacteria 44580
84 Ga0265338_10004100 3300028800 Bacteria 19960
85 Ga0265338_10004347 3300028800 Bacteria 19195
86 Ga0265338_10006718 3300028800 Bacteria 14526
87 Ga0265338_10009833 3300028800 Bacteria 11334
88 Ga0265338_10027235 3300028800 Bacteria 5739
89 Ga0265338_10029556 3300028800 Bacteria 5428
90 Ga0265338_10042438 3300028800 Bacteria 4235
91 Ga0265338_10066088 3300028800 Bacteria 3132
92 Ga0265338_10068316 3300028800 Bacteria 3062
93 Ga0265338_10135594 3300028800 Bacteria 1936
94 Ga0265338_10172876 3300028800 Bacteria 1654
95 Ga0265338_10218864 3300028800 Bacteria 1423
96 Ga0265338_10228202 3300028800 Bacteria 1386
97 Ga0265338_10357491 3300028800 Bacteria 1048
98 Ga0265324_10014194 3300029957 Bacteria 2952
99 Ga0265324_10061656 3300029957 Bacteria 1281
100 Ga0265324_10129236 3300029957 Bacteria 858
101 Ga0265332_10007610 3300031238 Bacteria 4894
102 Ga0265332_10050748 3300031238 Bacteria 1783
103 Ga0265332_10177824 3300031238 Bacteria 887
104 Ga0265328_10006717 3300031239 Bacteria 4845
105 Ga0265320_10000990 3300031240 Bacteria 21089
106 Ga0265320_10005988 3300031240 Bacteria 7726
107 Ga0265320_10010907 3300031240 Bacteria 5377
108 Ga0265320_10011003 3300031240 Bacteria 5348
109 Ga0265320_10054419 3300031240 Bacteria 1930
110 Ga0265320_10060266 3300031240 Bacteria 1813
111 Ga0265320_10302612 3300031240 Bacteria 707
112 Ga0265325_10021121 3300031241 Bacteria 3581
113 Ga0265325_10093693 3300031241 Bacteria 1478
114 Ga0265329_10001059 3300031242 Bacteria 13593
115 Ga0265329_10095468 3300031242 Unclassified 945
116 Ga0265340_10006982 3300031247 Bacteria 6164
117 Ga0265340_10039502 3300031247 Bacteria 2328
118 Ga0265340_10057148 3300031247 Bacteria 1875
119 Ga0265340_10073848 3300031247 Bacteria 1614
120 Ga0265340_10111100 3300031247 Bacteria 1267
121 Ga0265339_10186282 3300031249 Bacteria 1031
122 Ga0265331_10533305 3300031250 Unclassified 529
123 Ga0265327_10002213 3300031251 Bacteria 21222
124 Ga0265327_10106883 3300031251 Bacteria 1342
125 Ga0265327_10179950 3300031251 Bacteria 967
126 Ga0265327_10363070 3300031251 Unclassified 631
127 Ga0265316_10018377 3300031344 Bacteria 6008
128 Ga0265316_10102574 3300031344 Bacteria 2173
129 Ga0265316_10126764 3300031344 Bacteria 1924
130 Ga0265316_10156937 3300031344 Bacteria 1702
131 Ga0265316_10173919 3300031344 Bacteria 1605
132 Ga0265316_10190789 3300031344 Bacteria 1522
133 Ga0265316_10639310 3300031344 Bacteria 753
134 Ga0265316_10886493 3300031344 Unclassified 623
135 Ga0265316_10914912 3300031344 Unclassified 612
136 Ga0265316_11071337 3300031344 Unclassified 559
137 Ga0265313_10003061 3300031595 Bacteria 13878
138 Ga0265313_10007745 3300031595 Bacteria 7267
139 Ga0265314_10000087 3300031711 Bacteria 138681
140 Ga0265314_10136441 3300031711 Bacteria 1523
141 Ga0265314_10175983 3300031711 Bacteria 1287
142 Ga0265314_10237536 3300031711 Bacteria 1053
143 Ga0265314_10511865 3300031711 Unclassified 630
144 Ga0265342_10110732 3300031712 Bacteria 1554
145 Ga0316576_10325142 3300031727 Unclassified 1147
146 Ga0316578_10265414 3300031728 Unclassified 1029
147 Ga0316580_10117389 3300032139 Bacteria 815
148 Ga0373938_0026799 3300034957 Unclassified 1209
149 Ga0373926_0011475 3300035083 Unclassified 2981
150 Ga0373940_0020544 3300035088 Bacteria 1679
151 Ga0373936_0165287 3300035113 Unclassified 966
152 Ga0373939_0124275 3300035114 Bacteria 914
153 Ga0373945_0037551 3300035116 Unclassified 1739
154 Ga0373953_0168924 3300035117 Bacteria 941
155 Ga0373954_0018068 3300035118 Bacteria 3172
156 Ga0373956_0020596 3300035119 Bacteria 2808
157 Ga0373956_0062067 3300035119 Bacteria 1693
158 Ga0373943_0185146 3300035170 Unclassified 1146
159 Ga0373943_0874058 3300035170 Bacteria 537
160 Ga0316574_0027913 3300035398 Bacteria 3401
161 Ga0373924_0344461 3300035410 Bacteria 664
162 Ga0373931_0685601 3300035691 Unclassified 676
163 Ga0373927_0006730 3300035695 Bacteria 7824
164 Ga0373933_0557832 3300035724 Unclassified 752
165 Ga0373947_0006415 3300035725 Bacteria 6835
166 Ga0373947_0431529 3300035725 Bacteria 891
167 Ga0373937_0002552 3300036401 Bacteria 15128
168 Ga0373937_0455840 3300036401 Bacteria 1214
169 Ga0373937_0766986 3300036401 Bacteria 912
170 Ga0373937_0960010 3300036401 Bacteria 804
171 Ga0316582_0176542 3300036647 Bacteria 1452
172 Ga0316584_0409719 3300036712 Bacteria 964
173 Ga0373925_0004851 3300037068 Bacteria 10124
174 Ga0373925_0375107 3300037068 Bacteria 1158
175 Ga0451807_0580938 3300041486 Bacteria 1147
176 Ga0453684_0357869 3300044712 Bacteria 1644
177 Ga0453684_0585768 3300044712 Bacteria 1224
178 Ga0451576_0395239 3300045051 Bacteria 1449
179 Ga0451576_0965533 3300045051 Bacteria 893
180 Ga0495629_0021998 3300046459 Bacteria 4549
181 Ga0495651_0825739 3300046462 Unclassified 571
182 Ga0495653_0756436 3300046463 Bacteria 587
183 Ga0495594_0666618 3300046499 Unclassified 589
184 Ga0495618_0015524 3300046514 Bacteria 4648
185 Ga0495628_0299418 3300046516 Bacteria 1191
186 Ga0495628_0413708 3300046516 Bacteria 983
187 Ga0495630_0017575 3300046517 Bacteria 5241
188 Ga0495630_0081979 3300046517 Bacteria 2434
189 Ga0495630_0308991 3300046517 Bacteria 1208
190 Ga0495630_0584948 3300046517 Bacteria 856
191 Ga0495666_0107095 3300046526 Unclassified 1314
192 Ga0495640_0414275 3300046533 Unclassified 826
193 Ga0495586_0001064 3300046535 Bacteria 15493
194 Ga0495587_0251352 3300046536 Bacteria 994
195 Ga0495645_0313723 3300046543 Bacteria 1020
196 Ga0495645_0512130 3300046543 Bacteria 749
197 Ga0495622_0038309 3300046557 Bacteria 2232
198 Ga0495667_0022154 3300046559 Bacteria 4281
199 Ga0495634_0003274 3300046642 Bacteria 13068
200 Ga0495634_0145332 3300046642 Bacteria 1503
201 Ga0495635_0395510 3300046663 Unclassified 918
202 Ga0495599_0356029 3300046678 Bacteria 877
203 Ga0495599_0596650 3300046678 Bacteria 643
204 Ga0495647_0017462 3300046681 Bacteria 2540
205 Ga0495669_0503046 3300046684 Unclassified 589
206 Ga0495613_0084547 3300046689 Bacteria 2303
207 Ga0495613_0213030 3300046689 Bacteria 1358
208 Ga0495600_0438424 3300046809 Unclassified 809
209 Ga0495581_0604556 3300047315 Unclassified 635
210 Ga0495604_1030495 3300047317 Bacteria 508
211 Ga0495674_0010663 3300047319 Bacteria 8696
212 Ga0495674_0346337 3300047319 Unclassified 1207
213 Ga0495680_0002262 3300047322 Bacteria 19840
214 Ga0495675_0303997 3300047444 Unclassified 947
215 Ga0495684_1009624 3300047471 Unclassified 528
216 Ga0495614_0651709 3300048089 Unclassified 508
217 Ga0501031_0000292 3300049568 Bacteria 28530
218 Ga0501032_0042566 3300049569 Bacteria 3080
219 Ga0501032_0358149 3300049569 Bacteria 939
220 Ga0501033_0005947 3300049570 Bacteria 9579
221 Ga0501033_0154426 3300049570 Bacteria 1654
222 Ga0501037_0064852 3300049573 Bacteria 2661
223 Ga0501037_0583201 3300049573 Bacteria 752
224 Ga0501038_0540650 3300049574 Bacteria 887
225 Ga0501043_0117153 3300049579 Bacteria 2090
226 Ga0501043_0253572 3300049579 Bacteria 1355
227 Ga0501047_0133366 3300049581 Bacteria 2364
228 Ga0501074_0851362 3300049590 Bacteria 642
229 Ga0501080_0524250 3300049742 Bacteria 1057
230 Ga0501035_0003313 3300049822 Bacteria 15431
231 Ga0501035_0049897 3300049822 Bacteria 3751
232 Ga0501044_0000427 3300049823 Bacteria 52004
233 Ga0501044_0004160 3300049823 Bacteria 16259
234 Ga0501044_0397478 3300049823 Bacteria 1291
235 nmdc:mga06r32_1052905_c1 3300050510 Unclassified 764
236 nmdc:mga0a205_783447_c1 3300050515 Unclassified 801
237 Ga0495601_0959083 3300053077 Unclassified 539
238 Ga0265323_10054895
239 rootH2_10048816
240 Ga0058859_11744568
241 Ga0070689_100949580
242 Ga0070689_100971854
243 Ga0070689_101011458
244 Ga0070691_10118193
245 Ga0070687_100248788
246 Ga0070675_101049281
247 Ga0070688_100716283
248 Ga0070700_100590592
249 Ga0070695_101555281
250 Ga0070693_100983099
251 Ga0068864_100083228
252 Ga0068863_100006046
253 Ga0068863_100570673
254 Ga0068871_101471536
255 Ga0075431_100250767
256 Ga0075434_100840061
257 Ga0075435_101186598
258 Ga0099795_10434867
259 Ga0105240_10002989
260 Ga0105240_10199530
261 Ga0105240_10376526
262 Ga0111539_10086913
263 Ga0111539_11612826
264 Ga0114129_11256765
265 Ga0114129_11376207
266 Ga0105248_11163422
267 Ga0105238_10083212
268 Ga0105238_10714962
269 Ga0099796_10016168
270 Ga0157374_10501893
271 Ga0163163_10019324
272 Ga0157376_10047572
273 Ga0157376_10183427
274 Ga0207699_10370535
275 Ga0207707_10876638
276 Ga0207695_10057722
277 Ga0207662_10280027
278 Ga0207694_10022169
279 Ga0207694_10711910
280 Ga0207670_10959930
281 Ga0207670_11001956
282 Ga0207711_10484158
283 Ga0207667_10572952
284 Ga0207677_11813442
285 Ga0207702_10001362
286 Ga0207641_10062690
287 Ga0207641_10539517
288 Ga0207676_10089560
289 Ga0265337_1000857
290 Ga0265337_1002009
291 Ga0265337_1006510
292 Ga0265337_1039354
293 Ga0265337_1079359
294 Ga0265337_1116348
295 Ga0265326_10018220
296 Ga0265326_10031050
297 Ga0265326_10066386
298 Ga0265326_10194428
299 Ga0265326_10230390
300 Ga0265319_1000179
301 Ga0265319_1018419
302 Ga0265319_1043913
303 Ga0265319_1215675
304 Ga0265334_10034621
305 Ga0265334_10041044
306 Ga0265334_10055440
307 Ga0265334_10148135
308 Ga0265318_10070483
309 Ga0265323_10002855
310 Ga0265323_10007169
311 Ga0265323_10076562
312 Ga0265323_10139418
313 Ga0265323_10179621
314 Ga0265322_10159909
315 Ga0265336_10000642
316 Ga0265336_10046113
317 Ga0265336_10048307
318 Ga0265338_10000459
319 Ga0265338_10000987
320 Ga0265338_10001116
321 Ga0265338_10004100
322 Ga0265338_10004347
323 Ga0265338_10006718
324 Ga0265338_10009833
325 Ga0265338_10027235
326 Ga0265338_10029556
327 Ga0265338_10042438
328 Ga0265338_10066088
329 Ga0265338_10068316
330 Ga0265338_10135594
331 Ga0265338_10172876
332 Ga0265338_10218864
333 Ga0265338_10228202
334 Ga0265338_10357491
335 Ga0265324_10014194
336 Ga0265324_10061656
337 Ga0265324_10129236
338 Ga0265332_10007610
339 Ga0265332_10050748
340 Ga0265332_10177824
341 Ga0265328_10006717
342 Ga0265320_10000990
343 Ga0265320_10005988
344 Ga0265320_10010907
345 Ga0265320_10011003
346 Ga0265320_10054419
347 Ga0265320_10060266
348 Ga0265320_10302612
349 Ga0265325_10021121
350 Ga0265325_10093693
351 Ga0265329_10001059
352 Ga0265329_10095468
353 Ga0265340_10006982
354 Ga0265340_10039502
355 Ga0265340_10057148
356 Ga0265340_10073848
357 Ga0265340_10111100
358 Ga0265339_10186282
359 Ga0265331_10533305
360 Ga0265327_10002213
361 Ga0265327_10106883
362 Ga0265327_10179950
363 Ga0265327_10363070
364 Ga0265316_10018377
365 Ga0265316_10102574
366 Ga0265316_10126764
367 Ga0265316_10156937
368 Ga0265316_10173919
369 Ga0265316_10190789
370 Ga0265316_10639310
371 Ga0265316_10886493
372 Ga0265316_10914912
373 Ga0265316_11071337
374 Ga0265313_10003061
375 Ga0265313_10007745
376 Ga0265314_10000087
377 Ga0265314_10136441
378 Ga0265314_10175983
379 Ga0265314_10237536
380 Ga0265314_10511865
381 Ga0265342_10110732
382 Ga0316576_10325142
383 Ga0316578_10265414
384 Ga0316580_10117389
385 Ga0373938_0026799
386 Ga0373926_0011475
387 Ga0373940_0020544
388 Ga0373936_0165287
389 Ga0373939_0124275
390 Ga0373945_0037551
391 Ga0373953_0168924
392 Ga0373954_0018068
393 Ga0373956_0020596
394 Ga0373956_0062067
395 Ga0373943_0185146
396 Ga0373943_0874058
397 Ga0316574_0027913
398 Ga0373924_0344461
399 Ga0373931_0685601
400 Ga0373927_0006730
401 Ga0373933_0557832
402 Ga0373947_0006415
403 Ga0373947_0431529
404 Ga0373937_0002552
405 Ga0373937_0455840
406 Ga0373937_0766986
407 Ga0373937_0960010
408 Ga0316582_0176542
409 Ga0316584_0409719
410 Ga0373925_0004851
411 Ga0373925_0375107
412 Ga0451807_0580938
413 Ga0453684_0357869
414 Ga0453684_0585768
415 Ga0451576_0395239
416 Ga0451576_0965533
417 Ga0495629_0021998
418 Ga0495651_0825739
419 Ga0495653_0756436
420 Ga0495594_0666618
421 Ga0495618_0015524
422 Ga0495628_0299418
423 Ga0495628_0413708
424 Ga0495630_0017575
425 Ga0495630_0081979
426 Ga0495630_0308991
427 Ga0495630_0584948
428 Ga0495666_0107095
429 Ga0495640_0414275
430 Ga0495586_0001064
431 Ga0495587_0251352
432 Ga0495645_0313723
433 Ga0495645_0512130
434 Ga0495622_0038309
435 Ga0495667_0022154
436 Ga0495634_0003274
437 Ga0495634_0145332
438 Ga0495635_0395510
439 Ga0495599_0356029
440 Ga0495599_0596650
441 Ga0495647_0017462
442 Ga0495669_0503046
443 Ga0495613_0084547
444 Ga0495613_0213030
445 Ga0495600_0438424
446 Ga0495581_0604556
447 Ga0495604_1030495
448 Ga0495674_0010663
449 Ga0495674_0346337
450 Ga0495680_0002262
451 Ga0495675_0303997
452 Ga0495684_1009624
453 Ga0495614_0651709
454 Ga0501031_0000292
455 Ga0501032_0042566
456 Ga0501032_0358149
457 Ga0501033_0005947
458 Ga0501033_0154426
459 Ga0501037_0064852
460 Ga0501037_0583201
461 Ga0501038_0540650
462 Ga0501043_0117153
463 Ga0501043_0253572
464 Ga0501047_0133366
465 Ga0501074_0851362
466 Ga0501080_0524250
467 Ga0501035_0003313
468 Ga0501035_0049897
469 Ga0501044_0000427
470 Ga0501044_0004160
471 Ga0501044_0397478
472 nmdc:mga06r32_1052905_c1
473 nmdc:mga0a205_783447_c1
474 Ga0495601_0959083

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01196

Ribosomal_L17

Ribosomal protein L17

20

134

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sfr-assembly1.cif.gz_N unmethylated mtb ribosome 50s with seq-9 0.9351 10 116
7ane-assembly1.cif.gz_I leishmania major mitochondrial ribosome 0.9242 12 117
6hix-assembly1.cif.gz_AR cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the large mitoribosomal subunit 0.9228 12 117
4v4p-assembly1.cif.gz_A0 crystal structure of 70s ribosome with thrs operator and trnas. 0.9225 14 117
6yxy-assembly1.cif.gz_AR state b of the trypanosoma brucei mitoribosomal large subunit assembly intermediate 0.9214 12 115
ID Description Score Start End Superfamily
1vt2N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9387 13 114 3.90.1030.10
1vs8N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9317 13 114 3.90.1030.10
af_Q4DPQ0_51_164_3.90.1030.10 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9221 12 115 3.90.1030.10
1vt2N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9214 13 114 3.90.1030.10
1vs8N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9145 13 114 3.90.1030.10
ID Description Score Start End GO Terms
AF-A0A538LFX1-F1-model_v4 Large ribosomal subunit protein bL17 0.9602 13 116 GO:0003735
GO:0006412
GO:0022625
AF-A0A351MWS4-F1-model_v4 deleted 0.9571 22 116
AF-A0A1F9ENG3-F1-model_v4 50S ribosomal protein L17 0.9557 20 114 GO:0003735
GO:0006412
GO:0022625
AF-A0A3B8UXI4-F1-model_v4 deleted 0.9539 22 117
AF-A0A198UUV0-F1-model_v4 50S ribosomal protein L17 0.9539 25 117 GO:0003735
GO:0006412
GO:0022625

Map