F350075

General Info

Members Datasets Scaffolds Average Seq Length
237 187 474 242

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10014556|Ga0207709_100145565
Length 274
Sequence MVSGDDHDQYPCGIAAHPIGLGRCPRNRGRIGGVSEQTIALVTGANKGIGYEIAAGLGALGWRIGVGARDRQRRDTAVEKLRAAGTDAFGVPLDVTDDASVAAAAELIADHAGGLDVLVNNAAITGGVPQTPTTVDPTTVRIVVETNVIGVIRVTNAMLPMLCASASPRIVNMSSSVGSLALQTTPGIDMGPVPAAYLASKTFLNALTIQYVKELGDTNILINSGCPGFTATDLNGFRGVRTPQQGAAVAIRLATLPDDGPTGGFFDDAGTVPW

Samples

Sample ID Description Type Environment
1 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
73 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
78 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
85 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
86 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
87 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
88 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
89 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
105 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
106 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
165 2547132424 Nocardia nova SH22a Isolate Unclassified
166 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
167 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
168 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
169 2643221692 Nocardia sp. Root136 Isolate Unclassified
170 2643221714 Streptomyces sp. Root264 Isolate Unclassified
171 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
172 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
173 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
174 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
175 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
176 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
177 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
178 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
179 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
180 2919395869 Microbacterium resistens 2980 Isolate Unclassified
181 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
182 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
183 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
184 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
185 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
186 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
187 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.87
Metatranscriptomes 0.42
Isolates 9.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.06
Nodule 0
Rhizoplane 2.11
Rhizosphere 84.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207709_10014556 3300025935 Bacteria 4346
2 JGI24740J21852_10010241 3300001979 Bacteria 3622
3 JGI24737J22298_10012192 3300001990 Bacteria 2803
4 JGI25160J50197_1001744 3300003354 Bacteria 10564
5 Ga0070683_100104188 3300005329 Bacteria 2674
6 Ga0070670_100245878 3300005331 Bacteria 1558
7 Ga0070680_100430292 3300005336 Bacteria 1126
8 Ga0070682_100170559 3300005337 Bacteria 1512
9 Ga0068868_100267441 3300005338 Bacteria 1444
10 Ga0070691_10142641 3300005341 Bacteria 1222
11 Ga0070668_100077715 3300005347 Bacteria 2595
12 Ga0070671_100004644 3300005355 Bacteria 10891
13 Ga0070710_10000837 3300005437 Bacteria 14799
14 Ga0070710_10159890 3300005437 Bacteria 1396
15 Ga0068867_100151667 3300005459 Bacteria 1821
16 Ga0070706_100035533 3300005467 Bacteria 4601
17 Ga0070706_100094339 3300005467 Bacteria 2777
18 Ga0070679_100088830 3300005530 Bacteria 3077
19 Ga0070684_100180997 3300005535 Bacteria 1916
20 Ga0068853_100111273 3300005539 Bacteria 2433
21 Ga0070665_100121207 3300005548 Bacteria 2617
22 Ga0070665_100122053 3300005548 Bacteria 2607
23 Ga0070665_100413072 3300005548 Bacteria 1358
24 Ga0068855_100012739 3300005563 Bacteria 10141
25 Ga0068854_100003840 3300005578 Bacteria 9411
26 Ga0068852_100008952 3300005616 Bacteria 7408
27 Ga0068863_100072117 3300005841 Bacteria 3268
28 Ga0068858_100257291 3300005842 Bacteria 1659
29 Ga0068860_100019919 3300005843 Bacteria 6506
30 Ga0070717_10056464 3300006028 Bacteria 3244
31 Ga0070717_10169337 3300006028 Bacteria 1899
32 Ga0075365_10053261 3300006038 Bacteria 2679
33 Ga0075365_10142407 3300006038 Bacteria 1664
34 Ga0075365_10171486 3300006038 Bacteria 1514
35 Ga0075364_10062129 3300006051 Bacteria 2451
36 Ga0075434_100430115 3300006871 Bacteria 1341
37 Ga0105240_10017158 3300009093 Bacteria 9772
38 Ga0105240_10045726 3300009093 Bacteria 5552
39 Ga0105245_10759442 3300009098 Bacteria 1006
40 Ga0105243_10001649 3300009148 Bacteria 19357
41 Ga0105243_10888448 3300009148 Bacteria 885
42 Ga0105241_10003097 3300009174 Bacteria 12396
43 Ga0105248_10006251 3300009177 Bacteria 13058
44 Ga0105237_10038290 3300009545 Bacteria 4843
45 Ga0105238_10036629 3300009551 Bacteria 4988
46 Ga0105239_10091096 3300010375 Bacteria 3365
47 Ga0105239_10099723 3300010375 Bacteria 3212
48 Ga0105239_10634815 3300010375 Bacteria 1219
49 Ga0105246_10003607 3300011119 Bacteria 9362
50 Ga0157369_10221435 3300013105 Bacteria 1981
51 Ga0157374_10037697 3300013296 Bacteria 4439
52 Ga0157374_10420298 3300013296 Bacteria 1335
53 Ga0157372_10042337 3300013307 Bacteria 5037
54 Ga0157372_10185227 3300013307 Bacteria 2411
55 Ga0182008_10002310 3300014497 Bacteria 12017
56 Ga0157379_10052333 3300014968 Bacteria 3648
57 Ga0206353_11792755 3300020082 Bacteria 1309
58 Ga0207426_1000838 3300025302 Bacteria 32556
59 Ga0207692_10000869 3300025898 Bacteria 10879
60 Ga0207692_10124512 3300025898 Bacteria 1448
61 Ga0207647_10003687 3300025904 Bacteria 11456
62 Ga0207647_10012825 3300025904 Bacteria 5823
63 Ga0207684_10021482 3300025910 Bacteria 5512
64 Ga0207684_10253398 3300025910 Bacteria 1519
65 Ga0207654_10020653 3300025911 Bacteria 3495
66 Ga0207695_10001059 3300025913 Bacteria 48227
67 Ga0207671_10001032 3300025914 Bacteria 33903
68 Ga0207660_10452097 3300025917 Bacteria 1039
69 Ga0207657_10082264 3300025919 Bacteria 2703
70 Ga0207694_10090868 3300025924 Bacteria 2409
71 Ga0207694_10347352 3300025924 Bacteria 1228
72 Ga0207650_10480961 3300025925 Bacteria 1036
73 Ga0207644_10002833 3300025931 Bacteria 11181
74 Ga0207711_10009902 3300025941 Bacteria 7925
75 Ga0207689_10229212 3300025942 Bacteria 1535
76 Ga0207661_10153412 3300025944 Bacteria 1993
77 Ga0207667_10285265 3300025949 Bacteria 1687
78 Ga0207668_10036633 3300025972 Bacteria 3276
79 Ga0207640_10188471 3300025981 Bacteria 1553
80 Ga0207677_10267328 3300026023 Bacteria 1397
81 Ga0207677_10511954 3300026023 Bacteria 1040
82 Ga0207703_10818331 3300026035 Bacteria 890
83 Ga0207639_10005675 3300026041 Bacteria 8444
84 Ga0207678_10015578 3300026067 Bacteria 6685
85 Ga0207678_10299783 3300026067 Bacteria 1381
86 Ga0207641_10208991 3300026088 Bacteria 1804
87 Ga0268266_10037929 3300028379 Bacteria 4103
88 Ga0268266_10072049 3300028379 Bacteria 2995
89 Ga0268264_10475346 3300028381 Bacteria 1215
90 Ga0307517_10085057 3300028786 Bacteria 2654
91 Ga0307515_10046167 3300028794 Bacteria 6667
92 Ga0316179_1059444 3300030734 Bacteria 1527
93 Ga0316182_1135088 3300030745 Bacteria 1772
94 Ga0307513_10000201 3300031456 Bacteria 86237
95 Ga0307509_10036545 3300031507 Bacteria 5376
96 Ga0307516_10328818 3300031730 Bacteria 1198
97 Ga0307518_10145847 3300031838 Bacteria 1644
98 Ga0373951_0001159 3300035091 Bacteria 6981
99 Ga0373937_0212006 3300036401 Bacteria 1823
100 Ga0395900_0094208 3300037418 Bacteria 3076
101 Ga0395900_0347317 3300037418 Bacteria 1458
102 Ga0395898_0150314 3300037466 Bacteria 2228
103 Ga0395905_0128506 3300037471 Bacteria 2383
104 Ga0395901_0123055 3300038443 Bacteria 2726
105 Ga0439436_0016486 3300041404 Bacteria 2215
106 Ga0439439_0010752 3300041406 Bacteria 2193
107 Ga0451843_0328995 3300041509 Bacteria 2514
108 Ga0439433_0002574 3300041999 Bacteria 3851
109 Ga0439449_0026755 3300042007 Bacteria 2152
110 Ga0439457_002099 3300042014 Bacteria 5812
111 Ga0466969_0092527 3300044656 Bacteria 1431
112 Ga0466972_0003745 3300044658 Bacteria 7561
113 Ga0466972_0049714 3300044658 Bacteria 2025
114 Ga0466972_0103200 3300044658 Bacteria 1349
115 Ga0466965_0002779 3300044683 Bacteria 7524
116 Ga0466965_0005499 3300044683 Bacteria 5712
117 Ga0466965_0010266 3300044683 Bacteria 4362
118 Ga0466965_0011210 3300044683 Bacteria 4196
119 Ga0466965_0241241 3300044683 Bacteria 967
120 Ga0466966_0013139 3300044684 Bacteria 5482
121 Ga0466961_0010879 3300044693 Bacteria 5811
122 Ga0466961_0045177 3300044693 Bacteria 2818
123 Ga0466971_0126964 3300044719 Bacteria 1182
124 Ga0466970_0004757 3300044765 Bacteria 6706
125 Ga0466970_0176000 3300044765 Bacteria 1186
126 Ga0466960_0001001 3300044901 Bacteria 10090
127 Ga0466960_0001254 3300044901 Bacteria 9197
128 Ga0466960_0161304 3300044901 Bacteria 1204
129 Ga0466959_0033617 3300045049 Bacteria 3792
130 Ga0466958_0053874 3300045836 Bacteria 2439
131 Ga0466958_0275933 3300045836 Bacteria 1077
132 Ga0466967_0166313 3300045976 Bacteria 2073
133 Ga0495651_0498493 3300046462 Bacteria 780
134 Ga0495653_0023955 3300046463 Bacteria 4925
135 Ga0495582_0211351 3300046473 Bacteria 1109
136 Ga0495605_0006497 3300046474 Bacteria 6714
137 Ga0495639_0271459 3300046475 Bacteria 841
138 Ga0495662_0025290 3300046476 Bacteria 2866
139 Ga0495583_0005730 3300046506 Bacteria 8332
140 Ga0495606_0013002 3300046507 Bacteria 6619
141 Ga0495616_0036288 3300046513 Bacteria 2544
142 Ga0495620_0019630 3300046515 Bacteria 3319
143 Ga0495630_0623785 3300046517 Bacteria 826
144 Ga0495631_0005202 3300046518 Bacteria 6850
145 Ga0495632_0186953 3300046519 Bacteria 947
146 Ga0495622_0135508 3300046557 Bacteria 1120
147 Ga0495668_0005189 3300046616 Bacteria 8946
148 Ga0495625_0019333 3300046660 Bacteria 5287
149 Ga0495635_0340781 3300046663 Bacteria 1001
150 Ga0495657_0006752 3300046675 Bacteria 8946
151 Ga0495613_0088881 3300046689 Bacteria 2238
152 Ga0495671_0261275 3300046692 Bacteria 835
153 Ga0495649_0164609 3300046694 Bacteria 1162
154 Ga0495589_0001874 3300046794 Bacteria 11912
155 Ga0495589_0141854 3300046794 Bacteria 1150
156 Ga0495660_0011513 3300046810 Bacteria 5131
157 Ga0495636_0066495 3300047318 Bacteria 1532
158 Ga0495683_0008698 3300047323 Bacteria 5419
159 Ga0495687_006235 3300047443 Bacteria 7358
160 Ga0495687_019953 3300047443 Bacteria 3276
161 Ga0495681_0004161 3300047470 Bacteria 9943
162 Ga0495686_0124696 3300047472 Bacteria 1532
163 Ga0495626_0036730 3300048091 Bacteria 2332
164 Ga0496108_0000058 3300048911 Bacteria 123379
165 Ga0496109_0021048 3300048912 Bacteria 5767
166 Ga0496109_0424318 3300048912 Bacteria 1256
167 Ga0496110_0547555 3300048913 Bacteria 1052
168 Ga0496113_0192103 3300048916 Bacteria 1621
169 Ga0496124_0179641 3300048927 Bacteria 1630
170 Ga0501031_0006433 3300049568 Bacteria 7657
171 Ga0501031_0127972 3300049568 Bacteria 1659
172 Ga0501032_0025423 3300049569 Bacteria 4081
173 Ga0501032_0104250 3300049569 Bacteria 1879
174 Ga0501032_0133712 3300049569 Bacteria 1635
175 Ga0501032_0151614 3300049569 Bacteria 1524
176 Ga0501033_0003237 3300049570 Bacteria 13474
177 Ga0501033_0022158 3300049570 Bacteria 4793
178 Ga0501033_0022834 3300049570 Bacteria 4716
179 Ga0501036_0214086 3300049572 Bacteria 1618
180 Ga0501036_0347080 3300049572 Bacteria 1239
181 Ga0501037_0012641 3300049573 Bacteria 6220
182 Ga0501037_0110549 3300049573 Bacteria 1980
183 Ga0501038_0013634 3300049574 Bacteria 7407
184 Ga0501038_0063141 3300049574 Bacteria 3162
185 Ga0501038_0209051 3300049574 Bacteria 1562
186 Ga0501038_0296618 3300049574 Bacteria 1269
187 Ga0501043_0066990 3300049579 Bacteria 2820
188 Ga0501046_0027166 3300049580 Bacteria 4673
189 Ga0501047_0055404 3300049581 Bacteria 3835
190 Ga0501048_0006463 3300049582 Bacteria 8910
191 Ga0501067_0013599 3300049583 Bacteria 4506
192 Ga0501068_0001322 3300049584 Bacteria 13148
193 Ga0501070_0009655 3300049586 Bacteria 8157
194 Ga0501071_0008128 3300049587 Bacteria 6919
195 Ga0501073_0087314 3300049589 Bacteria 2169
196 Ga0501074_0053155 3300049590 Bacteria 2923
197 Ga0501080_0203535 3300049742 Bacteria 1817
198 Ga0501080_0260365 3300049742 Bacteria 1580
199 Ga0501083_0004797 3300049744 Bacteria 9553
200 Ga0501035_0045951 3300049822 Bacteria 3927
201 Ga0501044_0006799 3300049823 Bacteria 12605
202 Ga0501044_0100883 3300049823 Bacteria 2904
203 Ga0501045_0489326 3300049824 Bacteria 914
204 nmdc:mga00v17_179712_c1 3300050491 Bacteria 1365
205 nmdc:mga0yw44_211657_c1 3300050492 Bacteria 1282
206 nmdc:mga0yw44_29256_c1 3300050492 Bacteria 3179
207 Ga0500578_0154172 3300053086 Bacteria 1429
208 Ga0500616_0096774 3300053153 Bacteria 1450
209 Ga0500634_0083202 3300053161 Bacteria 1644
210 Ga0501084_0016947 3300054114 Bacteria 6055
211 Ga0501082_0132374 3300060353 Bacteria 2163
212 Ga0466962_0088439 3300061719 Bacteria 1483
213 Ga0466962_0187740 3300061719 Bacteria 1008
214 Ga0530510_0217677 3300061734 Bacteria 1419
215 2548696489 2547132424 Bacteria 8348532
216 2552107598 2551306166 Bacteria 9731570
217 2643943321 2643221587 Bacteria 7586415
218 2644430789 2643221677 Bacteria 7584031
219 2644514706 2643221692 Bacteria 7282860
220 2644626767 2643221714 Bacteria 9015452
221 2739238822 2738543011 Bacteria 5731169
222 2808916298 2808606375 Bacteria 9466072
223 2861526854 2861520306 Bacteria 8348283
224 2883823465 2883821847 Bacteria 5121194
225 2887485284 2887478801 Bacteria 8972725
226 2889301097 2889300758 Bacteria 5690814
227 2912728033 2912723979 Bacteria 8557534
228 2915361757 2915358134 Bacteria 6050864
229 2918502092 2918501144 Bacteria 8668083
230 2919396139 2919395869 Bacteria 3704152
231 2919714757 2919713450 Bacteria 7431245
232 2939744615 2939743619 Bacteria 5762299
233 2946068490 2946064051 Bacteria 8957905
234 3006495848 3006493962 Bacteria 8825450
235 8055176948 8055172936 Bacteria 9305943
236 8056582911 8056579771 Bacteria 5840325
237 8057571690 8057568493 Bacteria 7221719
238 Ga0207709_10014556
239 JGI24740J21852_10010241
240 JGI24737J22298_10012192
241 JGI25160J50197_1001744
242 Ga0070683_100104188
243 Ga0070670_100245878
244 Ga0070680_100430292
245 Ga0070682_100170559
246 Ga0068868_100267441
247 Ga0070691_10142641
248 Ga0070668_100077715
249 Ga0070671_100004644
250 Ga0070710_10000837
251 Ga0070710_10159890
252 Ga0068867_100151667
253 Ga0070706_100035533
254 Ga0070706_100094339
255 Ga0070679_100088830
256 Ga0070684_100180997
257 Ga0068853_100111273
258 Ga0070665_100121207
259 Ga0070665_100122053
260 Ga0070665_100413072
261 Ga0068855_100012739
262 Ga0068854_100003840
263 Ga0068852_100008952
264 Ga0068863_100072117
265 Ga0068858_100257291
266 Ga0068860_100019919
267 Ga0070717_10056464
268 Ga0070717_10169337
269 Ga0075365_10053261
270 Ga0075365_10142407
271 Ga0075365_10171486
272 Ga0075364_10062129
273 Ga0075434_100430115
274 Ga0105240_10017158
275 Ga0105240_10045726
276 Ga0105245_10759442
277 Ga0105243_10001649
278 Ga0105243_10888448
279 Ga0105241_10003097
280 Ga0105248_10006251
281 Ga0105237_10038290
282 Ga0105238_10036629
283 Ga0105239_10091096
284 Ga0105239_10099723
285 Ga0105239_10634815
286 Ga0105246_10003607
287 Ga0157369_10221435
288 Ga0157374_10037697
289 Ga0157374_10420298
290 Ga0157372_10042337
291 Ga0157372_10185227
292 Ga0182008_10002310
293 Ga0157379_10052333
294 Ga0206353_11792755
295 Ga0207426_1000838
296 Ga0207692_10000869
297 Ga0207692_10124512
298 Ga0207647_10003687
299 Ga0207647_10012825
300 Ga0207684_10021482
301 Ga0207684_10253398
302 Ga0207654_10020653
303 Ga0207695_10001059
304 Ga0207671_10001032
305 Ga0207660_10452097
306 Ga0207657_10082264
307 Ga0207694_10090868
308 Ga0207694_10347352
309 Ga0207650_10480961
310 Ga0207644_10002833
311 Ga0207711_10009902
312 Ga0207689_10229212
313 Ga0207661_10153412
314 Ga0207667_10285265
315 Ga0207668_10036633
316 Ga0207640_10188471
317 Ga0207677_10267328
318 Ga0207677_10511954
319 Ga0207703_10818331
320 Ga0207639_10005675
321 Ga0207678_10015578
322 Ga0207678_10299783
323 Ga0207641_10208991
324 Ga0268266_10037929
325 Ga0268266_10072049
326 Ga0268264_10475346
327 Ga0307517_10085057
328 Ga0307515_10046167
329 Ga0316179_1059444
330 Ga0316182_1135088
331 Ga0307513_10000201
332 Ga0307509_10036545
333 Ga0307516_10328818
334 Ga0307518_10145847
335 Ga0373951_0001159
336 Ga0373937_0212006
337 Ga0395900_0094208
338 Ga0395900_0347317
339 Ga0395898_0150314
340 Ga0395905_0128506
341 Ga0395901_0123055
342 Ga0439436_0016486
343 Ga0439439_0010752
344 Ga0451843_0328995
345 Ga0439433_0002574
346 Ga0439449_0026755
347 Ga0439457_002099
348 Ga0466969_0092527
349 Ga0466972_0003745
350 Ga0466972_0049714
351 Ga0466972_0103200
352 Ga0466965_0002779
353 Ga0466965_0005499
354 Ga0466965_0010266
355 Ga0466965_0011210
356 Ga0466965_0241241
357 Ga0466966_0013139
358 Ga0466961_0010879
359 Ga0466961_0045177
360 Ga0466971_0126964
361 Ga0466970_0004757
362 Ga0466970_0176000
363 Ga0466960_0001001
364 Ga0466960_0001254
365 Ga0466960_0161304
366 Ga0466959_0033617
367 Ga0466958_0053874
368 Ga0466958_0275933
369 Ga0466967_0166313
370 Ga0495651_0498493
371 Ga0495653_0023955
372 Ga0495582_0211351
373 Ga0495605_0006497
374 Ga0495639_0271459
375 Ga0495662_0025290
376 Ga0495583_0005730
377 Ga0495606_0013002
378 Ga0495616_0036288
379 Ga0495620_0019630
380 Ga0495630_0623785
381 Ga0495631_0005202
382 Ga0495632_0186953
383 Ga0495622_0135508
384 Ga0495668_0005189
385 Ga0495625_0019333
386 Ga0495635_0340781
387 Ga0495657_0006752
388 Ga0495613_0088881
389 Ga0495671_0261275
390 Ga0495649_0164609
391 Ga0495589_0001874
392 Ga0495589_0141854
393 Ga0495660_0011513
394 Ga0495636_0066495
395 Ga0495683_0008698
396 Ga0495687_006235
397 Ga0495687_019953
398 Ga0495681_0004161
399 Ga0495686_0124696
400 Ga0495626_0036730
401 Ga0496108_0000058
402 Ga0496109_0021048
403 Ga0496109_0424318
404 Ga0496110_0547555
405 Ga0496113_0192103
406 Ga0496124_0179641
407 Ga0501031_0006433
408 Ga0501031_0127972
409 Ga0501032_0025423
410 Ga0501032_0104250
411 Ga0501032_0133712
412 Ga0501032_0151614
413 Ga0501033_0003237
414 Ga0501033_0022158
415 Ga0501033_0022834
416 Ga0501036_0214086
417 Ga0501036_0347080
418 Ga0501037_0012641
419 Ga0501037_0110549
420 Ga0501038_0013634
421 Ga0501038_0063141
422 Ga0501038_0209051
423 Ga0501038_0296618
424 Ga0501043_0066990
425 Ga0501046_0027166
426 Ga0501047_0055404
427 Ga0501048_0006463
428 Ga0501067_0013599
429 Ga0501068_0001322
430 Ga0501070_0009655
431 Ga0501071_0008128
432 Ga0501073_0087314
433 Ga0501074_0053155
434 Ga0501080_0203535
435 Ga0501080_0260365
436 Ga0501083_0004797
437 Ga0501035_0045951
438 Ga0501044_0006799
439 Ga0501044_0100883
440 Ga0501045_0489326
441 nmdc:mga00v17_179712_c1
442 nmdc:mga0yw44_211657_c1
443 nmdc:mga0yw44_29256_c1
444 Ga0500578_0154172
445 Ga0500616_0096774
446 Ga0500634_0083202
447 Ga0501084_0016947
448 Ga0501082_0132374
449 Ga0466962_0088439
450 Ga0466962_0187740
451 Ga0530510_0217677
452 2548696489
453 2552107598
454 2643943321
455 2644430789
456 2644514706
457 2644626767
458 2739238822
459 2808916298
460 2861526854
461 2883823465
462 2887485284
463 2889301097
464 2912728033
465 2915361757
466 2918502092
467 2919396139
468 2919714757
469 2939744615
470 2946068490
471 3006495848
472 8055176948
473 8056582911
474 8057571690

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

38

240

0.89

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

44

259

0.85

PF08659

KR

KR domain

38

227

0.75

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

40

226

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cdy-assembly1.cif.gz_B the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9294 9 239
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9252 9 240
4ya6-assembly1.cif.gz_A crystal structure of ligo-apo form from sphingobium sp. strain syk-6 0.9137 9 200
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9114 8 239
7xwi-assembly1.cif.gz_D structure of patulin-detoxifying enzyme with nadph 0.9088 8 246
ID Description Score Start End Superfamily
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9782 9 84 3.40.50.720
af_K7MUD1_29_120_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9632 7 89 3.40.50.720
af_A4IB16_1_233_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9614 9 246 3.40.50.720
af_Q2FV41_2_233_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9607 9 245 3.40.50.720
af_Q0JBH4_12_100_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9553 9 93 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7U3UNG9-F1-model_v4 Putative short chain dehydrogenase 0.9892 5 246 GO:0016020
GO:0016616
AF-A0A495HTY8-F1-model_v4 deleted 0.9848 69 246
AF-A0A7X5WZF9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.984 1 246 GO:0016020
GO:0016616
AF-A0A1B8WHQ1-F1-model_v4 deleted 0.982 7 246
AF-A0A4D4LAY5-F1-model_v4 Dehydrogenase 0.9811 1 218 GO:0016491

Map