F349865

General Info

Members Datasets Scaffolds Average Seq Length
237 165 474 290

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10001677|Ga0081455_1000167730
Length 304
Sequence VRAGPRPTVSVGPVRFTYAEAMTDASYYAPLAQAAERAGYTSMTVADSLIYPEKSDSRYPYTDTGDREFLQGKEFIETMVLCAHLFAVTSTLRLTPFVLKLPVRPPVLVAKQASSIAHLSGNRLGLGIGLSPWPEDFSVLGVPWERRGKRMDECIDILRGLTSGEFFGYEGEFYSFDPIQQCPAPTEPIPLLVGGHSDAALRRAVLKGDGWMHAGGDGDELDKLLARLAEIRKAEGDTRDDFEVHVISYDAYDLDGIKRLEDKGVTDCIVGFRMPYIKGPDTEPLETKVKHLEQYAENIIAKVG

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
28 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
29 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
46 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
48 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
49 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
50 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
51 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
61 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
62 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
63 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
64 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
65 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
66 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
67 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
68 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
69 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
70 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
71 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
72 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
73 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
74 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
75 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
88 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
89 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
92 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
95 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
111 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
112 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
126 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
127 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
128 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
131 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
132 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
133 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
134 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
135 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
136 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
137 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
138 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
139 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
143 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
144 2643221561 Nocardioides sp. Root151 Isolate Unclassified
145 2643221576 Nocardioides sp. Root614 Isolate Unclassified
146 2643221590 Nocardioides sp. Root682 Isolate Unclassified
147 2643221604 Nocardioides sp. Root190 Isolate Unclassified
148 2643221615 Nocardioides sp. Root224 Isolate Unclassified
149 2643221617 Nocardioides sp. Root79 Isolate Unclassified
150 2643221620 Nocardioides sp. Root240 Isolate Unclassified
151 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
152 2643221696 Nocardioides sp. Root140 Isolate Unclassified
153 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
154 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
155 2738541305 Nocardioides sp. CF167 Isolate Unclassified
156 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
157 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
158 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
159 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
160 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
161 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
162 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
163 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
164 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
165 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.3
Metatranscriptomes 0
Isolates 9.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.5
Nodule 0
Rhizoplane 3.38
Rhizosphere 72.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10001677 3300005937 Bacteria 26857
2 Ga0070658_10135710 3300005327 Bacteria 2053
3 Ga0070687_100207644 3300005343 Bacteria 1191
4 Ga0070668_100229431 3300005347 Bacteria 1534
5 Ga0070659_100009711 3300005366 Bacteria 7069
6 Ga0070667_100078667 3300005367 Bacteria 2818
7 Ga0070667_100657661 3300005367 Bacteria 968
8 Ga0070708_100129577 3300005445 Bacteria 2334
9 Ga0070663_100133659 3300005455 Bacteria 1887
10 Ga0070698_100001109 3300005471 Bacteria 29696
11 Ga0068855_100027129 3300005563 Bacteria 6852
12 Ga0068856_100050969 3300005614 Bacteria 4081
13 Ga0068861_100148481 3300005719 Bacteria 1921
14 Ga0068861_100223837 3300005719 Bacteria 1592
15 Ga0081539_10083765 3300005985 Bacteria 1669
16 Ga0081539_10113898 3300005985 Bacteria 1356
17 Ga0075365_10002024 3300006038 Bacteria 9622
18 Ga0075365_10011920 3300006038 Bacteria 5135
19 Ga0075365_10116461 3300006038 Bacteria 1840
20 Ga0075368_10001591 3300006042 Bacteria 7291
21 Ga0075363_100003082 3300006048 Bacteria 6992
22 Ga0075363_100026352 3300006048 Bacteria 2974
23 Ga0075363_100050404 3300006048 Bacteria 2218
24 Ga0075363_100163624 3300006048 Bacteria 1260
25 Ga0075364_10052204 3300006051 Bacteria 2671
26 Ga0075364_10292052 3300006051 Bacteria 1109
27 Ga0075362_10037192 3300006177 Bacteria 2133
28 Ga0075367_10100902 3300006178 Bacteria 1764
29 Ga0075370_10092557 3300006353 Bacteria 1745
30 Ga0105237_10067558 3300009545 Bacteria 3568
31 Ga0105237_10160738 3300009545 Bacteria 2245
32 Ga0105249_10300013 3300009553 Bacteria 1611
33 Ga0105239_10191948 3300010375 Bacteria 2286
34 Ga0157372_10760563 3300013307 Bacteria 1126
35 Ga0157375_10138081 3300013308 Bacteria 2563
36 Ga0163163_10196011 3300014325 Bacteria 2068
37 Ga0157380_10152365 3300014326 Bacteria 2000
38 Ga0157376_10199345 3300014969 Bacteria 1840
39 Ga0207642_10094562 3300025899 Bacteria 1485
40 Ga0207688_10137974 3300025901 Bacteria 1434
41 Ga0207647_10051466 3300025904 Bacteria 2545
42 Ga0207695_10136459 3300025913 Bacteria 2406
43 Ga0207671_10134338 3300025914 Bacteria 1901
44 Ga0207657_10006525 3300025919 Bacteria 12084
45 Ga0207681_10194031 3300025923 Bacteria 1556
46 Ga0207690_10083061 3300025932 Bacteria 2242
47 Ga0207690_10479859 3300025932 Bacteria 1003
48 Ga0207667_10015415 3300025949 Bacteria 8685
49 Ga0207667_10049939 3300025949 Bacteria 4415
50 Ga0207668_10216782 3300025972 Bacteria 1534
51 Ga0207658_10060446 3300025986 Bacteria 2828
52 Ga0207678_10042886 3300026067 Bacteria 3916
53 Ga0207708_10033174 3300026075 Bacteria 3921
54 Ga0207702_10068140 3300026078 Bacteria 3057
55 Ga0207675_100045864 3300026118 Bacteria 4082
56 Ga0207675_100508142 3300026118 Bacteria 1200
57 Ga0207683_10381906 3300026121 Bacteria 1295
58 Ga0209813_10017579 3300027866 Bacteria 1964
59 Ga0268264_10000249 3300028381 Bacteria 101309
60 Ga0316181_1244668 3300030744 Bacteria 1492
61 Ga0316182_1012920 3300030745 Bacteria 3888
62 Ga0265340_10001103 3300031247 Bacteria 15407
63 Ga0307413_10023235 3300031824 Bacteria 3357
64 Ga0307413_10414076 3300031824 Bacteria 1060
65 Ga0307407_10031514 3300031903 Bacteria 2872
66 Ga0307412_10225002 3300031911 Bacteria 1441
67 Ga0307409_100111455 3300031995 Bacteria 2295
68 Ga0307409_100123032 3300031995 Bacteria 2201
69 Ga0307416_100439075 3300032002 Bacteria 1355
70 Ga0307415_100003271 3300032126 Bacteria 8236
71 Ga0395899_0192256 3300037312 Bacteria 1428
72 Ga0395900_0088320 3300037418 Bacteria 3187
73 Ga0395898_0504167 3300037466 Bacteria 1151
74 Ga0395905_0049528 3300037471 Bacteria 3937
75 Ga0395905_0619788 3300037471 Bacteria 984
76 Ga0395901_0617737 3300038443 Bacteria 1091
77 Ga0439436_0067033 3300041404 Bacteria 1002
78 Ga0451787_760567 3300041441 Bacteria 1169
79 Ga0451793_0116831 3300041452 Bacteria 3271
80 Ga0451833_0356779 3300041491 Bacteria 3528
81 Ga0451837_0901177 3300041494 Bacteria 3397
82 Ga0451839_1264569 3300041496 Bacteria 2828
83 Ga0439431_0004742 3300041997 Bacteria 2992
84 Ga0439445_0005637 3300042004 Bacteria 2859
85 Ga0439432_024927 3300042006 Bacteria 1964
86 Ga0439446_0007759 3300042156 Bacteria 2828
87 Ga0439464_0012230 3300042439 Bacteria 2283
88 Ga0466969_0060924 3300044656 Bacteria 1834
89 Ga0466972_0020165 3300044658 Bacteria 3331
90 Ga0466972_0138605 3300044658 Bacteria 1145
91 Ga0466965_0067501 3300044683 Bacteria 1795
92 Ga0466966_0006571 3300044684 Bacteria 7698
93 Ga0466966_0039834 3300044684 Bacteria 3025
94 Ga0466966_0089957 3300044684 Bacteria 1906
95 Ga0466966_0157680 3300044684 Bacteria 1382
96 Ga0466961_0007281 3300044693 Bacteria 7041
97 Ga0466961_0021609 3300044693 Bacteria 4140
98 Ga0466961_0045060 3300044693 Bacteria 2822
99 Ga0466961_0082306 3300044693 Bacteria 2036
100 Ga0466961_0120302 3300044693 Bacteria 1649
101 Ga0466963_0006500 3300044694 Bacteria 6919
102 Ga0466963_0031537 3300044694 Bacteria 3427
103 Ga0466971_0005826 3300044719 Bacteria 5364
104 Ga0466971_0015137 3300044719 Bacteria 3394
105 Ga0466971_0159262 3300044719 Bacteria 1056
106 Ga0466968_0061913 3300044735 Bacteria 1615
107 Ga0466968_0140216 3300044735 Bacteria 1105
108 Ga0466970_0001799 3300044765 Bacteria 10335
109 Ga0466970_0019276 3300044765 Bacteria 3536
110 Ga0466970_0025959 3300044765 Bacteria 3070
111 Ga0466957_0022518 3300044842 Bacteria 3718
112 Ga0466957_0064734 3300044842 Bacteria 2250
113 Ga0466960_0000373 3300044901 Bacteria 15315
114 Ga0466960_0033224 3300044901 Bacteria 2396
115 Ga0466959_0017100 3300045049 Bacteria 5311
116 Ga0466959_0026340 3300045049 Bacteria 4310
117 Ga0466959_0042028 3300045049 Bacteria 3373
118 Ga0466959_0099336 3300045049 Bacteria 2084
119 Ga0466959_0142652 3300045049 Bacteria 1692
120 Ga0466959_0275571 3300045049 Bacteria 1156
121 Ga0466958_0004301 3300045836 Bacteria 7500
122 Ga0466958_0018114 3300045836 Bacteria 4081
123 Ga0466967_0024433 3300045976 Bacteria 4968
124 Ga0466967_0033097 3300045976 Bacteria 4374
125 Ga0466967_0043500 3300045976 Bacteria 3889
126 Ga0466967_0059224 3300045976 Bacteria 3389
127 Ga0466967_0168564 3300045976 Bacteria 2059
128 Ga0466967_0284451 3300045976 Bacteria 1587
129 Ga0495653_0085459 3300046463 Bacteria 2321
130 Ga0495635_0142816 3300046663 Bacteria 1630
131 Ga0495600_0108735 3300046809 Bacteria 1806
132 Ga0495672_0001134 3300047320 Bacteria 26962
133 Ga0496109_0096659 3300048912 Bacteria 2737
134 Ga0496110_0067533 3300048913 Bacteria 3164
135 Ga0496110_0119746 3300048913 Bacteria 2371
136 Ga0496114_0081829 3300048917 Bacteria 2728
137 Ga0496114_0205443 3300048917 Bacteria 1726
138 Ga0496115_0198864 3300048918 Bacteria 1656
139 Ga0496124_0078292 3300048927 Bacteria 2725
140 Ga0501031_0009478 3300049568 Bacteria 6333
141 Ga0501031_0046908 3300049568 Bacteria 2817
142 Ga0501032_0055414 3300049569 Bacteria 2667
143 Ga0501033_0090166 3300049570 Bacteria 2243
144 Ga0501034_0232044 3300049571 Bacteria 1794
145 Ga0501036_0076668 3300049572 Bacteria 2828
146 Ga0501036_0167472 3300049572 Bacteria 1852
147 Ga0501037_0007753 3300049573 Bacteria 7858
148 Ga0501038_0017163 3300049574 Bacteria 6545
149 Ga0501038_0283742 3300049574 Bacteria 1303
150 Ga0501039_0094118 3300049575 Bacteria 2335
151 Ga0501039_0176128 3300049575 Bacteria 1682
152 Ga0501040_0041481 3300049576 Bacteria 3135
153 Ga0501041_0167651 3300049577 Bacteria 1374
154 Ga0501042_0188296 3300049578 Bacteria 1489
155 Ga0501043_0020327 3300049579 Bacteria 5208
156 Ga0501043_0132626 3300049579 Bacteria 1952
157 Ga0501046_0002768 3300049580 Bacteria 16327
158 Ga0501046_0039847 3300049580 Bacteria 3758
159 Ga0501047_0018561 3300049581 Bacteria 6668
160 Ga0501047_0125612 3300049581 Bacteria 2445
161 Ga0501048_0004409 3300049582 Bacteria 10718
162 Ga0501048_0089750 3300049582 Bacteria 2168
163 Ga0501048_0126868 3300049582 Bacteria 1804
164 Ga0501067_0041728 3300049583 Bacteria 2548
165 Ga0501068_0015651 3300049584 Bacteria 4360
166 Ga0501068_0036802 3300049584 Bacteria 2928
167 Ga0501069_0001279 3300049585 Bacteria 12324
168 Ga0501069_0004619 3300049585 Bacteria 7123
169 Ga0501069_0069079 3300049585 Bacteria 1978
170 Ga0501069_0117677 3300049585 Bacteria 1516
171 Ga0501070_0049697 3300049586 Bacteria 3482
172 Ga0501070_0062298 3300049586 Bacteria 3090
173 Ga0501070_0077785 3300049586 Bacteria 2745
174 Ga0501070_0088834 3300049586 Bacteria 2558
175 Ga0501070_0113581 3300049586 Bacteria 2238
176 Ga0501071_0005227 3300049587 Bacteria 8317
177 Ga0501072_0098431 3300049588 Bacteria 2325
178 Ga0501073_0000600 3300049589 Bacteria 25383
179 Ga0501073_0037182 3300049589 Bacteria 3458
180 Ga0501073_0160942 3300049589 Bacteria 1555
181 Ga0501074_0288990 3300049590 Bacteria 1165
182 Ga0501075_0237123 3300049591 Bacteria 1391
183 Ga0501076_0139884 3300049592 Bacteria 1966
184 Ga0501076_0229095 3300049592 Bacteria 1519
185 Ga0501077_0202167 3300049593 Bacteria 1262
186 Ga0501079_0005632 3300049741 Bacteria 9349
187 Ga0501083_0009965 3300049744 Bacteria 6706
188 Ga0501035_0014176 3300049822 Bacteria 7356
189 Ga0501035_0027640 3300049822 Bacteria 5184
190 Ga0501044_0180287 3300049823 Bacteria 2079
191 Ga0501045_0331817 3300049824 Bacteria 1132
192 nmdc:mga03683_43288_c1 3300050489 Bacteria 1857
193 nmdc:mga03n38_120620_c1 3300050490 Bacteria 1288
194 nmdc:mga03n38_123838_c1 3300050490 Bacteria 1274
195 nmdc:mga00v17_15619_c1 3300050491 Bacteria 4264
196 nmdc:mga00v17_47480_c1 3300050491 Bacteria 2601
197 nmdc:mga0yw44_11344_c1 3300050492 Bacteria 4594
198 nmdc:mga0yw44_15880_c1 3300050492 Bacteria 4050
199 nmdc:mga0yw44_198767_c1 3300050492 Bacteria 1324
200 nmdc:mga06z11_23543_c1 3300050494 Bacteria 2895
201 nmdc:mga04h51_74329_c1 3300050495 Bacteria 1194
202 nmdc:mga07m45_8079_c1 3300050496 Bacteria 5396
203 Ga0500643_018590 3300053087 Bacteria 2304
204 Ga0500644_0000275 3300053088 Bacteria 28638
205 Ga0500641_0012662 3300053096 Bacteria 3086
206 Ga0500660_105147 3300053100 Bacteria 1220
207 Ga0500554_100110 3300053102 Bacteria 969
208 Ga0500556_0001103 3300053104 Bacteria 13473
209 Ga0500593_000832 3300053117 Bacteria 11534
210 Ga0501084_0023487 3300054114 Bacteria 5144
211 Ga0501084_0469963 3300054114 Bacteria 1063
212 Ga0501082_0144211 3300060353 Bacteria 2067
213 Ga0501082_0226941 3300060353 Bacteria 1625
214 Ga0466962_0022487 3300061719 Bacteria 3029
215 2523384186 2523231044 Bacteria 6434991
216 2643826701 2643221561 Bacteria 4984412
217 2643890556 2643221576 Bacteria 5214352
218 2643959612 2643221590 Bacteria 5214697
219 2644032945 2643221604 Bacteria 5014917
220 2644092908 2643221615 Bacteria 5487866
221 2644100567 2643221617 Bacteria 5139111
222 2644116975 2643221620 Bacteria 5134593
223 2644322521 2643221657 Bacteria 5490246
224 2644534057 2643221696 Bacteria 5431823
225 2645721456 2643221961 Bacteria 3919167
226 2645724570 2643221962 Bacteria 3874254
227 2738869454 2738541305 Bacteria 4910150
228 2774392566 2773857762 Bacteria 5971770
229 2809196362 2808606439 Bacteria 5952208
230 2812330945 2811994874 Bacteria 5367947
231 2812351472 2811994878 Bacteria 5992952
232 2855388780 2855386786 Bacteria 4752232
233 2891403758 2891395885 Bacteria 9251614
234 2891970914 2891968417 Bacteria 5821697
235 2904770300 2904765812 Bacteria 5369154
236 3003001507 3002998708 Bacteria 11715108
237 8055181569 8055172936 Bacteria 9305943
238 Ga0081455_10001677
239 Ga0070658_10135710
240 Ga0070687_100207644
241 Ga0070668_100229431
242 Ga0070659_100009711
243 Ga0070667_100078667
244 Ga0070667_100657661
245 Ga0070708_100129577
246 Ga0070663_100133659
247 Ga0070698_100001109
248 Ga0068855_100027129
249 Ga0068856_100050969
250 Ga0068861_100148481
251 Ga0068861_100223837
252 Ga0081539_10083765
253 Ga0081539_10113898
254 Ga0075365_10002024
255 Ga0075365_10011920
256 Ga0075365_10116461
257 Ga0075368_10001591
258 Ga0075363_100003082
259 Ga0075363_100026352
260 Ga0075363_100050404
261 Ga0075363_100163624
262 Ga0075364_10052204
263 Ga0075364_10292052
264 Ga0075362_10037192
265 Ga0075367_10100902
266 Ga0075370_10092557
267 Ga0105237_10067558
268 Ga0105237_10160738
269 Ga0105249_10300013
270 Ga0105239_10191948
271 Ga0157372_10760563
272 Ga0157375_10138081
273 Ga0163163_10196011
274 Ga0157380_10152365
275 Ga0157376_10199345
276 Ga0207642_10094562
277 Ga0207688_10137974
278 Ga0207647_10051466
279 Ga0207695_10136459
280 Ga0207671_10134338
281 Ga0207657_10006525
282 Ga0207681_10194031
283 Ga0207690_10083061
284 Ga0207690_10479859
285 Ga0207667_10015415
286 Ga0207667_10049939
287 Ga0207668_10216782
288 Ga0207658_10060446
289 Ga0207678_10042886
290 Ga0207708_10033174
291 Ga0207702_10068140
292 Ga0207675_100045864
293 Ga0207675_100508142
294 Ga0207683_10381906
295 Ga0209813_10017579
296 Ga0268264_10000249
297 Ga0316181_1244668
298 Ga0316182_1012920
299 Ga0265340_10001103
300 Ga0307413_10023235
301 Ga0307413_10414076
302 Ga0307407_10031514
303 Ga0307412_10225002
304 Ga0307409_100111455
305 Ga0307409_100123032
306 Ga0307416_100439075
307 Ga0307415_100003271
308 Ga0395899_0192256
309 Ga0395900_0088320
310 Ga0395898_0504167
311 Ga0395905_0049528
312 Ga0395905_0619788
313 Ga0395901_0617737
314 Ga0439436_0067033
315 Ga0451787_760567
316 Ga0451793_0116831
317 Ga0451833_0356779
318 Ga0451837_0901177
319 Ga0451839_1264569
320 Ga0439431_0004742
321 Ga0439445_0005637
322 Ga0439432_024927
323 Ga0439446_0007759
324 Ga0439464_0012230
325 Ga0466969_0060924
326 Ga0466972_0020165
327 Ga0466972_0138605
328 Ga0466965_0067501
329 Ga0466966_0006571
330 Ga0466966_0039834
331 Ga0466966_0089957
332 Ga0466966_0157680
333 Ga0466961_0007281
334 Ga0466961_0021609
335 Ga0466961_0045060
336 Ga0466961_0082306
337 Ga0466961_0120302
338 Ga0466963_0006500
339 Ga0466963_0031537
340 Ga0466971_0005826
341 Ga0466971_0015137
342 Ga0466971_0159262
343 Ga0466968_0061913
344 Ga0466968_0140216
345 Ga0466970_0001799
346 Ga0466970_0019276
347 Ga0466970_0025959
348 Ga0466957_0022518
349 Ga0466957_0064734
350 Ga0466960_0000373
351 Ga0466960_0033224
352 Ga0466959_0017100
353 Ga0466959_0026340
354 Ga0466959_0042028
355 Ga0466959_0099336
356 Ga0466959_0142652
357 Ga0466959_0275571
358 Ga0466958_0004301
359 Ga0466958_0018114
360 Ga0466967_0024433
361 Ga0466967_0033097
362 Ga0466967_0043500
363 Ga0466967_0059224
364 Ga0466967_0168564
365 Ga0466967_0284451
366 Ga0495653_0085459
367 Ga0495635_0142816
368 Ga0495600_0108735
369 Ga0495672_0001134
370 Ga0496109_0096659
371 Ga0496110_0067533
372 Ga0496110_0119746
373 Ga0496114_0081829
374 Ga0496114_0205443
375 Ga0496115_0198864
376 Ga0496124_0078292
377 Ga0501031_0009478
378 Ga0501031_0046908
379 Ga0501032_0055414
380 Ga0501033_0090166
381 Ga0501034_0232044
382 Ga0501036_0076668
383 Ga0501036_0167472
384 Ga0501037_0007753
385 Ga0501038_0017163
386 Ga0501038_0283742
387 Ga0501039_0094118
388 Ga0501039_0176128
389 Ga0501040_0041481
390 Ga0501041_0167651
391 Ga0501042_0188296
392 Ga0501043_0020327
393 Ga0501043_0132626
394 Ga0501046_0002768
395 Ga0501046_0039847
396 Ga0501047_0018561
397 Ga0501047_0125612
398 Ga0501048_0004409
399 Ga0501048_0089750
400 Ga0501048_0126868
401 Ga0501067_0041728
402 Ga0501068_0015651
403 Ga0501068_0036802
404 Ga0501069_0001279
405 Ga0501069_0004619
406 Ga0501069_0069079
407 Ga0501069_0117677
408 Ga0501070_0049697
409 Ga0501070_0062298
410 Ga0501070_0077785
411 Ga0501070_0088834
412 Ga0501070_0113581
413 Ga0501071_0005227
414 Ga0501072_0098431
415 Ga0501073_0000600
416 Ga0501073_0037182
417 Ga0501073_0160942
418 Ga0501074_0288990
419 Ga0501075_0237123
420 Ga0501076_0139884
421 Ga0501076_0229095
422 Ga0501077_0202167
423 Ga0501079_0005632
424 Ga0501083_0009965
425 Ga0501035_0014176
426 Ga0501035_0027640
427 Ga0501044_0180287
428 Ga0501045_0331817
429 nmdc:mga03683_43288_c1
430 nmdc:mga03n38_120620_c1
431 nmdc:mga03n38_123838_c1
432 nmdc:mga00v17_15619_c1
433 nmdc:mga00v17_47480_c1
434 nmdc:mga0yw44_11344_c1
435 nmdc:mga0yw44_15880_c1
436 nmdc:mga0yw44_198767_c1
437 nmdc:mga06z11_23543_c1
438 nmdc:mga04h51_74329_c1
439 nmdc:mga07m45_8079_c1
440 Ga0500643_018590
441 Ga0500644_0000275
442 Ga0500641_0012662
443 Ga0500660_105147
444 Ga0500554_100110
445 Ga0500556_0001103
446 Ga0500593_000832
447 Ga0501084_0023487
448 Ga0501084_0469963
449 Ga0501082_0144211
450 Ga0501082_0226941
451 Ga0466962_0022487
452 2523384186
453 2643826701
454 2643890556
455 2643959612
456 2644032945
457 2644092908
458 2644100567
459 2644116975
460 2644322521
461 2644534057
462 2645721456
463 2645724570
464 2738869454
465 2774392566
466 2809196362
467 2812330945
468 2812351472
469 2855388780
470 2891403758
471 2891970914
472 2904770300
473 3003001507
474 8055181569

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

9

252

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sdo-assembly1.cif.gz_A structure of a nitrilotriacetate monooxygenase from burkholderia pseudomallei 0.8271 1 234
1brl-assembly2.cif.gz_C three-dimensional structure of bacterial luciferase from vibrio harveyi at 2.4 angstroms resolution 0.7988 1 291
3fgc-assembly1.cif.gz_A crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication 0.7939 1 291
1brl-assembly2.cif.gz_C three-dimensional structure of bacterial luciferase from vibrio harveyi at 2.4 angstroms resolution 0.7937 1 291
3fgc-assembly2.cif.gz_C crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication 0.7932 1 288
ID Description Score Start End Superfamily
af_P9WKP1_2_288_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9913 2 290 3.20.20.30
af_P9WKP1_2_288_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9878 2 290 3.20.20.30
af_P9WKN5_1_280_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8941 1 285 3.20.20.30
af_O06216_16_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8929 17 284 3.20.20.30
af_P9WKN5_1_280_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8818 1 285 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A2T5L1V3-F1-model_v4 deleted 0.9879 1 291
AF-A0A5D9CBF0-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9813 1 290 GO:0008726
GO:0046306
AF-A0A2T5L1V3-F1-model_v4 deleted 0.9812 1 291
AF-A0A7I7WQI6-F1-model_v4 Luciferase-like domain-containing protein 0.9792 2 290 GO:0016705
AF-A0A5D9CBF0-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9779 1 290 GO:0008726
GO:0046306

Map