F349710

General Info

Members Datasets Scaffolds Average Seq Length
237 190 474 143

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100524346|Ga0070670_1005243462
Length 146
Sequence MRFFVMVKATKDSENGVMPSEKLLADMGRFNEELVKAGVMLAGEGLHPSSKGSRVKFNGTSRVVVDGPFAETKELVAGFWLWQCKSKDEALEWAKRCPNPFEGGESEIEIRQVFEAEDFGAEFTPELREQEERQRAQVAELNKRAH

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
144 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
147 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
148 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
165 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
166 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
171 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
182 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
186 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
187 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
188 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
189 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
190 642555112 Paraburkholderia phymatum STM815 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 0.42
Isolates 1.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.3
Nodule 0.42
Rhizoplane 2.11
Rhizosphere 74.26
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100524346 3300005331 Bacteria 1055
2 ARCol0yngRDRAFT_1008378 3300000652 Bacteria 746
3 JGI24735J21928_10093456 3300002067 Bacteria 863
4 JGI25159J45721_1000163 3300002987 Bacteria 31237
5 JGI25159J45721_1007837 3300002987 Bacteria 3005
6 JGI25151J46595_10014331 3300003187 Bacteria 3534
7 JGI25151J46595_10104417 3300003187 Bacteria 755
8 JGI25160J50197_1000197 3300003354 Bacteria 50744
9 JGI25160J50197_1012169 3300003354 Bacteria 3005
10 JGI25161J50226_1000057 3300003374 Bacteria 102462
11 JGI25404J52841_10095317 3300003659 Bacteria 623
12 Ga0055537_1011209 3300003773 Bacteria 1836
13 Ga0055536_1031659 3300003781 Bacteria 1382
14 Ga0055534_1015064 3300003784 Bacteria 1427
15 Ga0055530_10001467 3300003791 Bacteria 17168
16 Ga0055531_10005092 3300003794 Bacteria 7770
17 Ga0055543_1000213 3300004625 Bacteria 46762
18 Ga0065165_1006096 3300005262 Bacteria 6462
19 Ga0065714_10184498 3300005288 Bacteria 950
20 Ga0065715_10279137 3300005293 Bacteria 1091
21 Ga0065707_10233992 3300005295 Bacteria 1178
22 Ga0070676_10359814 3300005328 Bacteria 1003
23 Ga0070676_11225806 3300005328 Bacteria 571
24 Ga0070683_100754881 3300005329 Bacteria 932
25 Ga0070683_101674711 3300005329 Bacteria 612
26 Ga0070677_10048118 3300005333 Bacteria 1712
27 Ga0068869_100707210 3300005334 Bacteria 860
28 Ga0070680_100118899 3300005336 Bacteria 2204
29 Ga0070680_100309038 3300005336 Bacteria 1341
30 Ga0070682_100161509 3300005337 Bacteria 1548
31 Ga0068868_102120379 3300005338 Bacteria 535
32 Ga0070687_100587283 3300005343 Bacteria 763
33 Ga0070661_100836853 3300005344 Bacteria 757
34 Ga0070674_100186747 3300005356 Bacteria 1591
35 Ga0070673_100102855 3300005364 Bacteria 2356
36 Ga0070659_100002738 3300005366 Bacteria 12541
37 Ga0070659_100169829 3300005366 Bacteria 1786
38 Ga0070667_100468911 3300005367 Bacteria 1152
39 Ga0070708_101190123 3300005445 Bacteria 713
40 Ga0070678_100022900 3300005456 Bacteria 4152
41 Ga0070678_100110019 3300005456 Bacteria 2154
42 Ga0070678_101044238 3300005456 Bacteria 753
43 Ga0070681_10000522 3300005458 Bacteria 31464
44 Ga0070685_10024005 3300005466 Bacteria 3345
45 Ga0070685_10056030 3300005466 Bacteria 2291
46 Ga0070706_100116018 3300005467 Bacteria 2494
47 Ga0070707_100113721 3300005468 Bacteria 2626
48 Ga0070698_100251467 3300005471 Bacteria 1700
49 Ga0070679_100180305 3300005530 Bacteria 2084
50 Ga0070679_100599352 3300005530 Bacteria 1045
51 Ga0070684_102194809 3300005535 Bacteria 521
52 Ga0068853_100500614 3300005539 Bacteria 1147
53 Ga0070686_101149381 3300005544 Bacteria 643
54 Ga0070693_100023188 3300005547 Unclassified 3314
55 Ga0070665_100060057 3300005548 Bacteria 3811
56 Ga0070665_100091689 3300005548 Bacteria 3043
57 Ga0068855_100009754 3300005563 Bacteria 11585
58 Ga0070664_100015574 3300005564 Bacteria 6222
59 Ga0070664_100154137 3300005564 Bacteria 2029
60 Ga0070702_101264891 3300005615 Bacteria 598
61 Ga0068852_100306980 3300005616 Bacteria 1537
62 Ga0068852_101636876 3300005616 Bacteria 666
63 Ga0068851_10196906 3300005834 Bacteria 1123
64 Ga0081538_10057707 3300005981 Bacteria 2258
65 Ga0081540_1009419 3300005983 Bacteria 6729
66 Ga0070717_10092736 3300006028 Bacteria 2552
67 Ga0075365_10458024 3300006038 Bacteria 901
68 Ga0075364_10019378 3300006051 Bacteria 4270
69 Ga0075362_10026685 3300006177 Bacteria 2469
70 Ga0075366_10069195 3300006195 Bacteria 2101
71 Ga0075366_10506171 3300006195 Bacteria 747
72 Ga0075370_10023268 3300006353 Bacteria 3411
73 Ga0075370_10163525 3300006353 Bacteria 1307
74 Ga0068871_100295665 3300006358 Bacteria 1420
75 Ga0068871_100460814 3300006358 Bacteria 1141
76 Ga0075428_101660957 3300006844 Bacteria 667
77 Ga0075433_10299803 3300006852 Bacteria 1423
78 Ga0075429_100324337 3300006880 Bacteria 1348
79 Ga0068865_100081850 3300006881 Bacteria 2320
80 Ga0111539_10607930 3300009094 Bacteria 1273
81 Ga0111539_10784420 3300009094 Bacteria 1109
82 Ga0111539_11346054 3300009094 Bacteria 828
83 Ga0105245_11714668 3300009098 Bacteria 681
84 Ga0105242_10171734 3300009176 Bacteria 1906
85 Ga0105242_11338443 3300009176 Bacteria 741
86 Ga0105237_10586232 3300009545 Bacteria 1122
87 Ga0105238_10043568 3300009551 Bacteria 4541
88 Ga0105249_10452307 3300009553 Bacteria 1323
89 Ga0105249_11693158 3300009553 Bacteria 705
90 Ga0105249_11855033 3300009553 Bacteria 675
91 Ga0099796_10066160 3300010159 Bacteria 1294
92 Ga0157369_10881334 3300013105 Bacteria 918
93 Ga0157372_10780645 3300013307 Bacteria 1110
94 Ga0163163_10988921 3300014325 Bacteria 904
95 Ga0157376_11364560 3300014969 Bacteria 740
96 Ga0206350_11133160 3300020080 Bacteria 617
97 Ga0213876_10004989 3300021384 Bacteria 7331
98 Ga0213875_10042422 3300021388 Bacteria 2137
99 Ga0207425_1005494 3300025245 Bacteria 3604
100 Ga0209129_1011489 3300025258 Bacteria 2108
101 Ga0209565_1001120 3300025263 Bacteria 13007
102 Ga0209130_1000146 3300025284 Bacteria 111777
103 Ga0209675_1009926 3300025291 Bacteria 3306
104 Ga0209676_1005116 3300025292 Bacteria 6990
105 Ga0209025_1020316 3300025294 Bacteria 3639
106 Ga0209025_1036456 3300025294 Bacteria 2202
107 Ga0209564_1009704 3300025295 Bacteria 4535
108 Ga0209758_1010565 3300025297 Bacteria 5502
109 Ga0209050_1007157 3300025298 Bacteria 6354
110 Ga0209050_1037465 3300025298 Bacteria 1398
111 Ga0207426_1000291 3300025302 Bacteria 99437
112 Ga0209051_1055426 3300025303 Bacteria 1286
113 Ga0209257_1005155 3300025304 Bacteria 9429
114 Ga0207697_10329394 3300025315 Bacteria 678
115 Ga0207697_10333490 3300025315 Bacteria 673
116 Ga0207682_10097733 3300025893 Bacteria 1280
117 Ga0207688_10359831 3300025901 Bacteria 898
118 Ga0207688_10788571 3300025901 Bacteria 602
119 Ga0207645_10060462 3300025907 Bacteria 2419
120 Ga0207643_10060885 3300025908 Bacteria 2156
121 Ga0207705_10136257 3300025909 Bacteria 1831
122 Ga0207684_10004721 3300025910 Bacteria 12779
123 Ga0207707_10000766 3300025912 Bacteria 31578
124 Ga0207695_10001526 3300025913 Bacteria 38277
125 Ga0207660_10045822 3300025917 Bacteria 3083
126 Ga0207660_11141907 3300025917 Bacteria 634
127 Ga0207649_10166962 3300025920 Bacteria 1530
128 Ga0207649_11128056 3300025920 Bacteria 619
129 Ga0207646_10415809 3300025922 Bacteria 1214
130 Ga0207646_11035040 3300025922 Bacteria 724
131 Ga0207681_10059315 3300025923 Bacteria 2623
132 Ga0207694_10028489 3300025924 Bacteria 4259
133 Ga0207650_10223612 3300025925 Bacteria 1516
134 Ga0207659_10778142 3300025926 Bacteria 822
135 Ga0207690_10049173 3300025932 Bacteria 2809
136 Ga0207686_10101830 3300025934 Bacteria 1919
137 Ga0207669_10037051 3300025937 Bacteria 2794
138 Ga0207691_10069910 3300025940 Bacteria 3170
139 Ga0207691_10996551 3300025940 Bacteria 699
140 Ga0207689_10036551 3300025942 Bacteria 4076
141 Ga0207689_10047674 3300025942 Bacteria 3535
142 Ga0207679_10158380 3300025945 Bacteria 1851
143 Ga0207679_10342151 3300025945 Bacteria 1301
144 Ga0207667_10012106 3300025949 Bacteria 9968
145 Ga0207712_10636180 3300025961 Bacteria 926
146 Ga0207658_10168981 3300025986 Bacteria 1800
147 Ga0207677_10239323 3300026023 Bacteria 1467
148 Ga0207702_11158252 3300026078 Bacteria 767
149 Ga0207648_10028158 3300026089 Bacteria 4984
150 Ga0207674_11528390 3300026116 Bacteria 636
151 Ga0207675_102444309 3300026118 Bacteria 534
152 Ga0207683_10096884 3300026121 Bacteria 2630
153 Ga0207683_10108947 3300026121 Bacteria 2479
154 Ga0207683_10330177 3300026121 Bacteria 1398
155 Ga0207683_10892025 3300026121 Bacteria 826
156 Ga0207698_10706309 3300026142 Bacteria 1004
157 Ga0209179_1014625 3300027512 Bacteria 1444
158 Ga0209588_1006828 3300027671 Bacteria 3337
159 Ga0207428_10704285 3300027907 Bacteria 722
160 Ga0268266_10281564 3300028379 Bacteria 1546
161 Ga0316180_1120196 3300030736 Bacteria 2312
162 Ga0307513_10000070 3300031456 Bacteria 139895
163 Ga0307408_100001514 3300031548 Bacteria 17281
164 Ga0307408_100479948 3300031548 Bacteria 1084
165 Ga0307405_10181317 3300031731 Bacteria 1512
166 Ga0307413_11532378 3300031824 Bacteria 590
167 Ga0307410_10220771 3300031852 Bacteria 1458
168 Ga0307410_11565953 3300031852 Bacteria 582
169 Ga0307412_10066011 3300031911 Bacteria 2451
170 Ga0307412_10465291 3300031911 Bacteria 1045
171 Ga0307409_102925809 3300031995 Bacteria 504
172 Ga0307416_100199912 3300032002 Bacteria 1895
173 Ga0307416_100652381 3300032002 Bacteria 1137
174 Ga0307414_11522664 3300032004 Bacteria 623
175 Ga0307411_10108609 3300032005 Bacteria 1980
176 Ga0307411_10713705 3300032005 Bacteria 875
177 Ga0307415_100231972 3300032126 Bacteria 1487
178 Ga0373962_0305144 3300035242 Bacteria 566
179 Ga0395905_0251115 3300037471 Bacteria 1652
180 Ga0395905_0380740 3300037471 Bacteria 1305
181 Ga0436364_0280795 3300037853 Bacteria 6341
182 Ga0436364_0422546 3300037853 Bacteria 666
183 Ga0436365_0259881 3300039437 Bacteria 3298
184 Ga0436365_0697272 3300039437 Bacteria 2293
185 Ga0436365_1483043 3300039437 Bacteria 14069
186 Ga0436362_0285306 3300039453 Bacteria 1054
187 Ga0451804_0954543 3300041463 Bacteria 607
188 Ga0451849_0398242 3300041505 Bacteria 782
189 Ga0451853_0330838 3300041512 Bacteria 2437
190 Ga0439455_0039497 3300042012 Bacteria 1204
191 Ga0439446_0070800 3300042156 Bacteria 1067
192 Ga0439464_0130248 3300042439 Bacteria 779
193 Ga0439460_0254327 3300042461 Bacteria 608
194 Ga0451577_0275794 3300042876 Bacteria 1523
195 Ga0466969_0297231 3300044656 Bacteria 731
196 Ga0466972_0036271 3300044658 Bacteria 2413
197 Ga0466966_0598201 3300044684 Bacteria 664
198 Ga0466970_0012871 3300044765 Bacteria 4284
199 Ga0466957_0931863 3300044842 Bacteria 622
200 Ga0466960_0099277 3300044901 Bacteria 1497
201 Ga0451576_0283190 3300045051 Bacteria 1733
202 Ga0466967_0311151 3300045976 Bacteria 1517
203 Ga0495580_0019311 3300046472 Bacteria 5064
204 Ga0495583_0204472 3300046506 Bacteria 801
205 Ga0495616_0046395 3300046513 Bacteria 2193
206 Ga0495643_0104861 3300046522 Bacteria 1444
207 Ga0495666_0009000 3300046526 Bacteria 4996
208 Ga0495642_0061550 3300046528 Bacteria 1558
209 Ga0495597_0040047 3300046542 Bacteria 2095
210 Ga0495597_0232429 3300046542 Bacteria 729
211 Ga0495659_0028625 3300046664 Bacteria 1929
212 Ga0495669_0148922 3300046684 Bacteria 1107
213 Ga0495581_0554327 3300047315 Bacteria 667
214 Ga0495604_0008645 3300047317 Bacteria 8048
215 Ga0495636_0099409 3300047318 Bacteria 1270
216 Ga0495636_0177552 3300047318 Bacteria 965
217 Ga0495679_014594 3300047446 Bacteria 2903
218 Ga0496102_0263715 3300048905 Bacteria 1624
219 Ga0496102_0505534 3300048905 Bacteria 1131
220 Ga0496103_0057305 3300048906 Bacteria 2419
221 Ga0496112_0558209 3300048915 Bacteria 1079
222 Ga0496118_0192547 3300048921 Bacteria 1218
223 Ga0496125_0490536 3300048928 Bacteria 694
224 Ga0501034_0035662 3300049571 Bacteria 5042
225 Ga0501040_0326409 3300049576 Bacteria 1098
226 Ga0501069_0045608 3300049585 Bacteria 2429
227 Ga0501075_1220970 3300049591 Bacteria 570
228 Ga0501265_049713 3300049762 Bacteria 657
229 nmdc:mga03683_115407_c1 3300050489 Bacteria 1191
230 nmdc:mga0k408_28726_c1 3300050493 Bacteria 3162
231 nmdc:mga08y16_707196_c1 3300050511 Bacteria 1007
232 Ga0500635_0071394 3300053080 Bacteria 1232
233 Ga0500566_0274920 3300053094 Bacteria 806
234 Ga0500645_002304 3300053730 Bacteria 8615
235 2792839402 2791355137 Bacteria 9654227
236 2904621626 2904615490 Bacteria 10047340
237 642595478 642555112 Bacteria 8676562
238 Ga0070670_100524346
239 ARCol0yngRDRAFT_1008378
240 JGI24735J21928_10093456
241 JGI25159J45721_1000163
242 JGI25159J45721_1007837
243 JGI25151J46595_10014331
244 JGI25151J46595_10104417
245 JGI25160J50197_1000197
246 JGI25160J50197_1012169
247 JGI25161J50226_1000057
248 JGI25404J52841_10095317
249 Ga0055537_1011209
250 Ga0055536_1031659
251 Ga0055534_1015064
252 Ga0055530_10001467
253 Ga0055531_10005092
254 Ga0055543_1000213
255 Ga0065165_1006096
256 Ga0065714_10184498
257 Ga0065715_10279137
258 Ga0065707_10233992
259 Ga0070676_10359814
260 Ga0070676_11225806
261 Ga0070683_100754881
262 Ga0070683_101674711
263 Ga0070677_10048118
264 Ga0068869_100707210
265 Ga0070680_100118899
266 Ga0070680_100309038
267 Ga0070682_100161509
268 Ga0068868_102120379
269 Ga0070687_100587283
270 Ga0070661_100836853
271 Ga0070674_100186747
272 Ga0070673_100102855
273 Ga0070659_100002738
274 Ga0070659_100169829
275 Ga0070667_100468911
276 Ga0070708_101190123
277 Ga0070678_100022900
278 Ga0070678_100110019
279 Ga0070678_101044238
280 Ga0070681_10000522
281 Ga0070685_10024005
282 Ga0070685_10056030
283 Ga0070706_100116018
284 Ga0070707_100113721
285 Ga0070698_100251467
286 Ga0070679_100180305
287 Ga0070679_100599352
288 Ga0070684_102194809
289 Ga0068853_100500614
290 Ga0070686_101149381
291 Ga0070693_100023188
292 Ga0070665_100060057
293 Ga0070665_100091689
294 Ga0068855_100009754
295 Ga0070664_100015574
296 Ga0070664_100154137
297 Ga0070702_101264891
298 Ga0068852_100306980
299 Ga0068852_101636876
300 Ga0068851_10196906
301 Ga0081538_10057707
302 Ga0081540_1009419
303 Ga0070717_10092736
304 Ga0075365_10458024
305 Ga0075364_10019378
306 Ga0075362_10026685
307 Ga0075366_10069195
308 Ga0075366_10506171
309 Ga0075370_10023268
310 Ga0075370_10163525
311 Ga0068871_100295665
312 Ga0068871_100460814
313 Ga0075428_101660957
314 Ga0075433_10299803
315 Ga0075429_100324337
316 Ga0068865_100081850
317 Ga0111539_10607930
318 Ga0111539_10784420
319 Ga0111539_11346054
320 Ga0105245_11714668
321 Ga0105242_10171734
322 Ga0105242_11338443
323 Ga0105237_10586232
324 Ga0105238_10043568
325 Ga0105249_10452307
326 Ga0105249_11693158
327 Ga0105249_11855033
328 Ga0099796_10066160
329 Ga0157369_10881334
330 Ga0157372_10780645
331 Ga0163163_10988921
332 Ga0157376_11364560
333 Ga0206350_11133160
334 Ga0213876_10004989
335 Ga0213875_10042422
336 Ga0207425_1005494
337 Ga0209129_1011489
338 Ga0209565_1001120
339 Ga0209130_1000146
340 Ga0209675_1009926
341 Ga0209676_1005116
342 Ga0209025_1020316
343 Ga0209025_1036456
344 Ga0209564_1009704
345 Ga0209758_1010565
346 Ga0209050_1007157
347 Ga0209050_1037465
348 Ga0207426_1000291
349 Ga0209051_1055426
350 Ga0209257_1005155
351 Ga0207697_10329394
352 Ga0207697_10333490
353 Ga0207682_10097733
354 Ga0207688_10359831
355 Ga0207688_10788571
356 Ga0207645_10060462
357 Ga0207643_10060885
358 Ga0207705_10136257
359 Ga0207684_10004721
360 Ga0207707_10000766
361 Ga0207695_10001526
362 Ga0207660_10045822
363 Ga0207660_11141907
364 Ga0207649_10166962
365 Ga0207649_11128056
366 Ga0207646_10415809
367 Ga0207646_11035040
368 Ga0207681_10059315
369 Ga0207694_10028489
370 Ga0207650_10223612
371 Ga0207659_10778142
372 Ga0207690_10049173
373 Ga0207686_10101830
374 Ga0207669_10037051
375 Ga0207691_10069910
376 Ga0207691_10996551
377 Ga0207689_10036551
378 Ga0207689_10047674
379 Ga0207679_10158380
380 Ga0207679_10342151
381 Ga0207667_10012106
382 Ga0207712_10636180
383 Ga0207658_10168981
384 Ga0207677_10239323
385 Ga0207702_11158252
386 Ga0207648_10028158
387 Ga0207674_11528390
388 Ga0207675_102444309
389 Ga0207683_10096884
390 Ga0207683_10108947
391 Ga0207683_10330177
392 Ga0207683_10892025
393 Ga0207698_10706309
394 Ga0209179_1014625
395 Ga0209588_1006828
396 Ga0207428_10704285
397 Ga0268266_10281564
398 Ga0316180_1120196
399 Ga0307513_10000070
400 Ga0307408_100001514
401 Ga0307408_100479948
402 Ga0307405_10181317
403 Ga0307413_11532378
404 Ga0307410_10220771
405 Ga0307410_11565953
406 Ga0307412_10066011
407 Ga0307412_10465291
408 Ga0307409_102925809
409 Ga0307416_100199912
410 Ga0307416_100652381
411 Ga0307414_11522664
412 Ga0307411_10108609
413 Ga0307411_10713705
414 Ga0307415_100231972
415 Ga0373962_0305144
416 Ga0395905_0251115
417 Ga0395905_0380740
418 Ga0436364_0280795
419 Ga0436364_0422546
420 Ga0436365_0259881
421 Ga0436365_0697272
422 Ga0436365_1483043
423 Ga0436362_0285306
424 Ga0451804_0954543
425 Ga0451849_0398242
426 Ga0451853_0330838
427 Ga0439455_0039497
428 Ga0439446_0070800
429 Ga0439464_0130248
430 Ga0439460_0254327
431 Ga0451577_0275794
432 Ga0466969_0297231
433 Ga0466972_0036271
434 Ga0466966_0598201
435 Ga0466970_0012871
436 Ga0466957_0931863
437 Ga0466960_0099277
438 Ga0451576_0283190
439 Ga0466967_0311151
440 Ga0495580_0019311
441 Ga0495583_0204472
442 Ga0495616_0046395
443 Ga0495643_0104861
444 Ga0495666_0009000
445 Ga0495642_0061550
446 Ga0495597_0040047
447 Ga0495597_0232429
448 Ga0495659_0028625
449 Ga0495669_0148922
450 Ga0495581_0554327
451 Ga0495604_0008645
452 Ga0495636_0099409
453 Ga0495636_0177552
454 Ga0495679_014594
455 Ga0496102_0263715
456 Ga0496102_0505534
457 Ga0496103_0057305
458 Ga0496112_0558209
459 Ga0496118_0192547
460 Ga0496125_0490536
461 Ga0501034_0035662
462 Ga0501040_0326409
463 Ga0501069_0045608
464 Ga0501075_1220970
465 Ga0501265_049713
466 nmdc:mga03683_115407_c1
467 nmdc:mga0k408_28726_c1
468 nmdc:mga08y16_707196_c1
469 Ga0500635_0071394
470 Ga0500566_0274920
471 Ga0500645_002304
472 2792839402
473 2904621626
474 642595478

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

1

117

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8448 1 114
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7755 1 114
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.6967 1 114
3znj-assembly3.cif.gz_9 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.6861 1 114
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.6602 1 114
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8448 1 114 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7755 1 114 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7035 1 114 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6719 1 114 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6574 2 114 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A852U2G1-F1-model_v4 YCII-related domain-containing protein 0.9757 1 139
AF-A0A6J4KQU2-F1-model_v4 PhnB protein 0.9718 1 100
AF-A0A6A7MRZ0-F1-model_v4 deleted 0.971 1 114
AF-A0A536M2Z6-F1-model_v4 YciI family protein 0.9689 1 118
AF-A0A7J7A2V9-F1-model_v4 deleted 0.9689 1 99

Map