F349708

General Info

Members Datasets Scaffolds Average Seq Length
237 185 237 140

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100083205|Ga0070670_1000832053
Length 158
Sequence LRRPKRSSTWAWSLTTTSRLLLLDNSAWSRLLIGGLPEDRTETVLGWVEEGRLAVCLPFLLEAGYSARSTSDYGKLMRRLEHLPRLPVDDAVERVALDAQRELTAVGHHRLAPTDLVIAACAHLVGGGVLHYERDYDLISEHTRLNFESVWLAEAGAL

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
57 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
87 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
122 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
181 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 5.06
Rhizosphere 92.41
Stem 0
Stem Tuber 0
Unclassified 2.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10001539 3300003373 Bacteria 5254
2 Ga0070683_100097854 3300005329 Bacteria 2760
3 Ga0070683_100798004 3300005329 Bacteria 905
4 Ga0070670_100083205 3300005331 Bacteria 2750
5 Ga0068869_100403971 3300005334 Unclassified 1124
6 Ga0070680_100229042 3300005336 Bacteria 1569
7 Ga0070682_100271939 3300005337 Bacteria 1231
8 Ga0068868_100123937 3300005338 Bacteria 2109
9 Ga0068868_100839821 3300005338 Bacteria 831
10 Ga0070660_100423134 3300005339 Bacteria 1103
11 Ga0070692_10010571 3300005345 Bacteria 4209
12 Ga0070671_100507072 3300005355 Bacteria 1038
13 Ga0070688_100910121 3300005365 Unclassified 694
14 Ga0070659_100003962 3300005366 Bacteria 10536
15 Ga0070659_100064457 3300005366 Bacteria 2900
16 Ga0070659_100670598 3300005366 Bacteria 895
17 Ga0070703_10207546 3300005406 Bacteria 772
18 Ga0070709_10000278 3300005434 Bacteria 32498
19 Ga0070714_100505234 3300005435 Bacteria 1153
20 Ga0070713_100000055 3300005436 Bacteria 70759
21 Ga0070713_100055437 3300005436 Bacteria 3293
22 Ga0070710_10721873 3300005437 Bacteria 705
23 Ga0070711_100595501 3300005439 Bacteria 922
24 Ga0070663_100025253 3300005455 Bacteria 4010
25 Ga0070663_100234142 3300005455 Bacteria 1447
26 Ga0070663_100261519 3300005455 Bacteria 1373
27 Ga0070681_10028830 3300005458 Bacteria 5578
28 Ga0070681_10262900 3300005458 Bacteria 1637
29 Ga0068867_100003954 3300005459 Bacteria 10428
30 Ga0070685_11105576 3300005466 Unclassified 599
31 Ga0070679_100051868 3300005530 Bacteria 4086
32 Ga0070679_100055020 3300005530 Bacteria 3962
33 Ga0070684_100193392 3300005535 Bacteria 1852
34 Ga0070684_100646249 3300005535 Unclassified 985
35 Ga0070672_100000006 3300005543 Bacteria 117060
36 Ga0068857_101348858 3300005577 Bacteria 693
37 Ga0068854_100000083 3300005578 Bacteria 68056
38 Ga0070702_100048467 3300005615 Bacteria 2418
39 Ga0068852_100000131 3300005616 Bacteria 50602
40 Ga0068864_101537103 3300005618 Unclassified 669
41 Ga0068861_100230263 3300005719 Bacteria 1571
42 Ga0068870_10116768 3300005840 Bacteria 1531
43 Ga0068863_100001610 3300005841 Bacteria 22316
44 Ga0081538_10000628 3300005981 Bacteria 39094
45 Ga0081540_1060297 3300005983 Bacteria 1816
46 Ga0081539_10032083 3300005985 Bacteria 3223
47 Ga0070716_100005139 3300006173 Bacteria 6325
48 Ga0097621_101402696 3300006237 Bacteria 661
49 Ga0068871_100160054 3300006358 Unclassified 1925
50 Ga0075431_100009070 3300006847 Bacteria 9973
51 Ga0075431_100687642 3300006847 Bacteria 1001
52 Ga0075434_100056636 3300006871 Bacteria 3896
53 Ga0075429_100356399 3300006880 Bacteria 1281
54 Ga0068865_100225221 3300006881 Bacteria 1468
55 Ga0075435_101977797 3300007076 Unclassified 512
56 Ga0105240_10015638 3300009093 Bacteria 10304
57 Ga0105245_10000012 3300009098 Bacteria 267151
58 Ga0105245_10558314 3300009098 Unclassified 1167
59 Ga0105242_10010934 3300009176 Bacteria 6972
60 Ga0105239_10029935 3300010375 Bacteria 5988
61 Ga0157370_10015360 3300013104 Bacteria 7782
62 Ga0157370_10086367 3300013104 Bacteria 2947
63 Ga0157369_10002398 3300013105 Bacteria 22521
64 Ga0157369_10423965 3300013105 Unclassified 1379
65 Ga0157372_11009825 3300013307 Bacteria 963
66 Ga0157375_10432858 3300013308 Bacteria 1481
67 Ga0157380_11300703 3300014326 Bacteria 774
68 Ga0157380_12670144 3300014326 Bacteria 566
69 Ga0157380_12972112 3300014326 Unclassified 540
70 Ga0157377_10259953 3300014745 Bacteria 1129
71 Ga0157376_12510420 3300014969 Unclassified 555
72 Ga0213873_10029041 3300021358 Bacteria 1360
73 Ga0207653_10163817 3300025885 Bacteria 824
74 Ga0207688_10202432 3300025901 Bacteria 1191
75 Ga0207699_10000059 3300025906 Bacteria 94698
76 Ga0207643_10059387 3300025908 Bacteria 2181
77 Ga0207654_10009581 3300025911 Bacteria 4924
78 Ga0207695_10052362 3300025913 Bacteria 4277
79 Ga0207693_10000549 3300025915 Bacteria 33996
80 Ga0207657_10337122 3300025919 Bacteria 1191
81 Ga0207652_10040998 3300025921 Bacteria 3934
82 Ga0207650_10330470 3300025925 Bacteria 1250
83 Ga0207687_10000011 3300025927 Bacteria 388349
84 Ga0207687_10751244 3300025927 Bacteria 830
85 Ga0207700_10000009 3300025928 Bacteria 314953
86 Ga0207700_10189859 3300025928 Bacteria 1726
87 Ga0207664_10186649 3300025929 Bacteria 1783
88 Ga0207690_10002443 3300025932 Bacteria 11238
89 Ga0207690_10050085 3300025932 Bacteria 2787
90 Ga0207670_10081197 3300025936 Bacteria 2269
91 Ga0207704_10214600 3300025938 Bacteria 1419
92 Ga0207665_10014745 3300025939 Bacteria 5141
93 Ga0207691_10000025 3300025940 Bacteria 129424
94 Ga0207689_10204421 3300025942 Bacteria 1631
95 Ga0207661_10011236 3300025944 Bacteria 6479
96 Ga0207661_10107012 3300025944 Bacteria 2358
97 Ga0207661_10983127 3300025944 Bacteria 777
98 Ga0207661_11039355 3300025944 Bacteria 754
99 Ga0207679_10146310 3300025945 Bacteria 1917
100 Ga0207640_10000040 3300025981 Bacteria 106134
101 Ga0207677_10131713 3300026023 Bacteria 1900
102 Ga0207678_10043099 3300026067 Bacteria 3906
103 Ga0207678_10485156 3300026067 Bacteria 1076
104 Ga0207641_10004106 3300026088 Bacteria 12687
105 Ga0207648_10023730 3300026089 Bacteria 5488
106 Ga0207676_11977627 3300026095 Bacteria 582
107 Ga0207675_100057587 3300026118 Bacteria 3626
108 Ga0207698_10000009 3300026142 Bacteria 281300
109 Ga0265319_1005214 3300028563 Bacteria 6274
110 Ga0265319_1023989 3300028563 Unclassified 2202
111 Ga0265318_10142589 3300028577 Bacteria 879
112 Ga0265316_10592806 3300031344 Bacteria 786
113 Ga0265314_10079312 3300031711 Unclassified 2171
114 Ga0307406_11806601 3300031901 Bacteria 543
115 Ga0307416_102031825 3300032002 Unclassified 677
116 Ga0307415_100717970 3300032126 Bacteria 904
117 Ga0316583_10232129 3300032133 Bacteria 639
118 Ga0395898_0072487 3300037466 Bacteria 3328
119 Ga0395901_1165977 3300038443 Bacteria 738
120 Ga0395901_1311271 3300038443 Bacteria 685
121 Ga0436365_1056220 3300039437 Unclassified 1224
122 Ga0436361_1103403 3300039447 Bacteria 578
123 Ga0436362_1255609 3300039453 Unclassified 2807
124 Ga0451789_0303881 3300041443 Bacteria 749
125 Ga0451853_3129972 3300041512 Unclassified 804
126 Ga0466961_0722479 3300044693 Bacteria 596
127 Ga0466963_0011835 3300044694 Bacteria 5323
128 Ga0466963_0258702 3300044694 Bacteria 1222
129 Ga0466963_0267203 3300044694 Bacteria 1202
130 Ga0466963_0285421 3300044694 Bacteria 1160
131 Ga0466963_0632821 3300044694 Unclassified 755
132 Ga0466964_0043349 3300044706 Bacteria 1825
133 Ga0466964_0270308 3300044706 Bacteria 846
134 Ga0466964_0296308 3300044706 Bacteria 814
135 Ga0466971_0495160 3300044719 Bacteria 603
136 Ga0466957_0008525 3300044842 Bacteria 5834
137 Ga0466957_0022869 3300044842 Bacteria 3691
138 Ga0466958_0040690 3300045836 Bacteria 2794
139 Ga0466958_0233040 3300045836 Bacteria 1176
140 Ga0466958_1031322 3300045836 Bacteria 537
141 Ga0466967_0001754 3300045976 Bacteria 12955
142 Ga0466967_0859365 3300045976 Bacteria 902
143 Ga0466967_1199713 3300045976 Bacteria 756
144 Ga0466967_1204926 3300045976 Unclassified 754
145 Ga0495641_0577375 3300046461 Unclassified 514
146 Ga0495653_0322304 3300046463 Unclassified 1001
147 Ga0495662_0097669 3300046476 Bacteria 1436
148 Ga0495664_0000051 3300046477 Bacteria 59070
149 Ga0495608_0000001 3300046511 Bacteria 411278
150 Ga0495628_0155175 3300046516 Bacteria 1742
151 Ga0495628_0291038 3300046516 Bacteria 1211
152 Ga0495630_0100276 3300046517 Bacteria 2191
153 Ga0495652_0000066 3300046529 Bacteria 109895
154 Ga0495640_0424154 3300046533 Unclassified 815
155 Ga0495587_0520161 3300046536 Bacteria 657
156 Ga0495645_0000289 3300046543 Bacteria 37074
157 Ga0495667_0073510 3300046559 Bacteria 2227
158 Ga0495657_0000002 3300046675 Bacteria 411958
159 Ga0495599_0014491 3300046678 Bacteria 4882
160 Ga0495647_0000004 3300046681 Bacteria 140700
161 Ga0495658_0001576 3300046683 Bacteria 11899
162 Ga0495613_0000175 3300046689 Bacteria 62391
163 Ga0495600_0019072 3300046809 Bacteria 4377
164 Ga0495600_0028623 3300046809 Bacteria 3604
165 Ga0495660_0069095 3300046810 Bacteria 1878
166 Ga0495581_0796096 3300047315 Unclassified 542
167 Ga0495604_0000615 3300047317 Bacteria 30571
168 Ga0495604_0026490 3300047317 Bacteria 4615
169 Ga0495672_0023962 3300047320 Bacteria 3939
170 Ga0495676_0556817 3300047321 Bacteria 749
171 Ga0495680_0230999 3300047322 Unclassified 1317
172 Ga0495675_0000104 3300047444 Bacteria 60748
173 Ga0495675_0081820 3300047444 Unclassified 2033
174 Ga0495679_015959 3300047446 Bacteria 2729
175 Ga0495684_0458875 3300047471 Unclassified 884
176 Ga0495602_0000063 3300048088 Bacteria 104915
177 Ga0496100_0348996 3300048903 Bacteria 1117
178 Ga0496103_0012058 3300048906 Bacteria 5134
179 Ga0496104_0000004 3300048907 Bacteria 641830
180 Ga0496104_0102464 3300048907 Bacteria 2741
181 Ga0496105_0000001 3300048908 Bacteria 1328178
182 Ga0496106_0000042 3300048909 Bacteria 106662
183 Ga0496107_0017301 3300048910 Bacteria 5069
184 Ga0496108_0024458 3300048911 Bacteria 4972
185 Ga0496109_0000035 3300048912 Bacteria 159744
186 Ga0496112_1199610 3300048915 Bacteria 676
187 Ga0496115_0000178 3300048918 Bacteria 59512
188 Ga0496118_0087285 3300048921 Bacteria 2164
189 Ga0496119_0008536 3300048922 Bacteria 8985
190 Ga0496120_0137038 3300048923 Bacteria 1247
191 Ga0501031_0000044 3300049568 Bacteria 67192
192 Ga0501032_0000300 3300049569 Bacteria 41595
193 Ga0501033_0000393 3300049570 Bacteria 42051
194 Ga0501034_0000867 3300049571 Bacteria 44681
195 Ga0501036_0000475 3300049572 Bacteria 28670
196 Ga0501037_0000305 3300049573 Bacteria 41631
197 Ga0501038_0000310 3300049574 Bacteria 41581
198 Ga0501039_0062388 3300049575 Bacteria 2887
199 Ga0501040_0080402 3300049576 Bacteria 2257
200 Ga0501042_0117696 3300049578 Bacteria 1913
201 Ga0501043_0000350 3300049579 Bacteria 41992
202 Ga0501046_0000166 3300049580 Bacteria 67210
203 Ga0501047_0000512 3300049581 Bacteria 41820
204 Ga0501048_0000160 3300049582 Bacteria 41743
205 Ga0501067_0426142 3300049583 Bacteria 740
206 Ga0501068_0010083 3300049584 Bacteria 5302
207 Ga0501068_0148518 3300049584 Bacteria 1472
208 Ga0501068_0260287 3300049584 Bacteria 1107
209 Ga0501069_0009169 3300049585 Bacteria 5223
210 Ga0501070_0001691 3300049586 Bacteria 19553
211 Ga0501070_0163383 3300049586 Bacteria 1835
212 Ga0501070_0174767 3300049586 Bacteria 1768
213 Ga0501072_0396287 3300049588 Bacteria 1095
214 Ga0501073_0000526 3300049589 Bacteria 26875
215 Ga0501074_0003336 3300049590 Bacteria 11368
216 Ga0501079_0086223 3300049741 Bacteria 2430
217 Ga0501080_0006082 3300049742 Bacteria 10822
218 Ga0501083_0003277 3300049744 Bacteria 11306
219 Ga0501083_0119204 3300049744 Bacteria 1731
220 Ga0501035_0000545 3300049822 Bacteria 41853
221 Ga0501044_0000653 3300049823 Bacteria 41929
222 Ga0501044_0669084 3300049823 Unclassified 926
223 Ga0501044_0913773 3300049823 Bacteria 752
224 Ga0501045_0357230 3300049824 Bacteria 1087
225 nmdc:mga06r32_617974_c1 3300050510 Unclassified 1054
226 nmdc:mga0n895_16756_c1 3300050512 Bacteria 6734
227 nmdc:mga0rr50_1557355_c1 3300050513 Unclassified 558
228 Ga0495601_0000384 3300053077 Bacteria 23396
229 Ga0495612_0002802 3300053078 Bacteria 7208
230 Ga0495595_0000001 3300053084 Bacteria 495226
231 Ga0495595_0003167 3300053084 Bacteria 6525
232 Ga0495619_0000018 3300053085 Bacteria 209943
233 Ga0495619_0000094 3300053085 Bacteria 67416
234 Ga0495619_0153262 3300053085 Bacteria 1590
235 Ga0500566_0157570 3300053094 Bacteria 1187
236 Ga0501084_0072560 3300054114 Bacteria 2883
237 Ga0501082_0005415 3300060353 Bacteria 11076

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025911 Ga0207654_10009581 Ga0207654_100095813 115
2 3300025885 Ga0207653_10163817 Ga0207653_101638172 123
3 3300007076 Ga0075435_101977797 Ga0075435_1019777971 126
4 3300021358 Ga0213873_10029041 Ga0213873_100290413 126
5 3300050513 nmdc:mga0rr50_1557355_c1 nmdc:mga0rr50_1557355_c1_92_505 126
6 3300005578 Ga0068854_100000083 Ga0068854_10000008361 128
7 3300025981 Ga0207640_10000040 Ga0207640_1000004048 128
8 3300049588 Ga0501072_0396287 Ga0501072_0396287_14_403 128
9 3300049824 Ga0501045_0357230 Ga0501045_0357230_669_1058 128
10 3300050512 nmdc:mga0n895_16756_c1 nmdc:mga0n895_16756_c1_2953_3369 128
11 3300013308 Ga0157375_10432858 Ga0157375_104328582 130
12 3300049823 Ga0501044_0669084 Ga0501044_0669084_301_696 130
13 3300046810 Ga0495660_0069095 Ga0495660_0069095_925_1344 132
14 3300049584 Ga0501068_0260287 Ga0501068_0260287_462_881 132
15 3300053078 Ga0495612_0002802 Ga0495612_0002802_6171_6590 132
16 3300028563 Ga0265319_1005214 Ga0265319_10052144 135
17 3300032133 Ga0316583_10232129 Ga0316583_102321291 135
18 3300046809 Ga0495600_0019072 Ga0495600_0019072_2510_2917 135
19 3300005840 Ga0068870_10116768 Ga0068870_101167682 136
20 3300006881 Ga0068865_100225221 Ga0068865_1002252212 136
21 3300009098 Ga0105245_10558314 Ga0105245_105583141 136
22 3300013105 Ga0157369_10002398 Ga0157369_100023984 136
23 3300014326 Ga0157380_11300703 Ga0157380_113007032 136
24 3300025901 Ga0207688_10202432 Ga0207688_102024322 136
25 3300025908 Ga0207643_10059387 Ga0207643_100593873 136
26 3300025927 Ga0207687_10751244 Ga0207687_107512442 136
27 3300025938 Ga0207704_10214600 Ga0207704_102146002 136
28 3300025942 Ga0207689_10204421 Ga0207689_102044212 136
29 3300025945 Ga0207679_10146310 Ga0207679_101463103 136
30 3300026023 Ga0207677_10131713 Ga0207677_101317133 136
31 3300026118 Ga0207675_100057587 Ga0207675_1000575875 136
32 3300026095 Ga0207676_11977627 Ga0207676_119776272 137
33 3300048915 Ga0496112_1199610 Ga0496112_1199610_189_605 137
34 3300005329 Ga0070683_100097854 Ga0070683_1000978542 139
35 3300005336 Ga0070680_100229042 Ga0070680_1002290422 139
36 3300005339 Ga0070660_100423134 Ga0070660_1004231342 139
37 3300005345 Ga0070692_10010571 Ga0070692_100105714 139
38 3300005366 Ga0070659_100003962 Ga0070659_1000039627 139
39 3300005366 Ga0070659_100064457 Ga0070659_1000644577 139
40 3300005406 Ga0070703_10207546 Ga0070703_102075461 139
41 3300005435 Ga0070714_100505234 Ga0070714_1005052341 139
42 3300005436 Ga0070713_100000055 Ga0070713_10000005536 139
43 3300005436 Ga0070713_100055437 Ga0070713_1000554373 139
44 3300005437 Ga0070710_10721873 Ga0070710_107218732 139
45 3300005439 Ga0070711_100595501 Ga0070711_1005955012 139
46 3300005455 Ga0070663_100025253 Ga0070663_1000252534 139
47 3300005455 Ga0070663_100234142 Ga0070663_1002341422 139
48 3300005458 Ga0070681_10028830 Ga0070681_100288302 139
49 3300005458 Ga0070681_10262900 Ga0070681_102629003 139
50 3300005459 Ga0068867_100003954 Ga0068867_1000039548 139
51 3300005530 Ga0070679_100051868 Ga0070679_1000518682 139
52 3300005530 Ga0070679_100055020 Ga0070679_1000550201 139
53 3300005535 Ga0070684_100646249 Ga0070684_1006462492 139
54 3300005543 Ga0070672_100000006 Ga0070672_10000000616 139
55 3300005616 Ga0068852_100000131 Ga0068852_10000013147 139
56 3300005983 Ga0081540_1060297 Ga0081540_10602973 139
57 3300009093 Ga0105240_10015638 Ga0105240_100156385 139
58 3300009098 Ga0105245_10000012 Ga0105245_10000012219 139
59 3300009176 Ga0105242_10010934 Ga0105242_100109346 139
60 3300010375 Ga0105239_10029935 Ga0105239_100299353 139
61 3300013104 Ga0157370_10015360 Ga0157370_100153604 139
62 3300013104 Ga0157370_10086367 Ga0157370_100863673 139
63 3300014326 Ga0157380_12972112 Ga0157380_129721121 139
64 3300014969 Ga0157376_12510420 Ga0157376_125104201 139
65 3300025913 Ga0207695_10052362 Ga0207695_100523624 139
66 3300025919 Ga0207657_10337122 Ga0207657_103371222 139
67 3300025921 Ga0207652_10040998 Ga0207652_100409984 139
68 3300025927 Ga0207687_10000011 Ga0207687_10000011273 139
69 3300025928 Ga0207700_10000009 Ga0207700_10000009279 139
70 3300025928 Ga0207700_10189859 Ga0207700_101898592 139
71 3300025929 Ga0207664_10186649 Ga0207664_101866493 139
72 3300025932 Ga0207690_10002443 Ga0207690_100024437 139
73 3300025932 Ga0207690_10050085 Ga0207690_100500857 139
74 3300025936 Ga0207670_10081197 Ga0207670_100811973 139
75 3300025940 Ga0207691_10000025 Ga0207691_10000025106 139
76 3300025944 Ga0207661_10107012 Ga0207661_101070121 139
77 3300026067 Ga0207678_10043099 Ga0207678_100430994 139
78 3300026067 Ga0207678_10485156 Ga0207678_104851562 139
79 3300026089 Ga0207648_10023730 Ga0207648_100237304 139
80 3300026142 Ga0207698_10000009 Ga0207698_10000009177 139
81 3300041443 Ga0451789_0303881 Ga0451789_0303881_159_578 139
82 3300044693 Ga0466961_0722479 Ga0466961_0722479_32_451 139
83 3300044694 Ga0466963_0011835 Ga0466963_0011835_2787_3209 139
84 3300044719 Ga0466971_0495160 Ga0466971_0495160_76_498 139
85 3300044842 Ga0466957_0022869 Ga0466957_0022869_1694_2113 139
86 3300045836 Ga0466958_0040690 Ga0466958_0040690_609_1031 139
87 3300045836 Ga0466958_0233040 Ga0466958_0233040_417_836 139
88 3300045976 Ga0466967_1199713 Ga0466967_1199713_269_691 139
89 3300046477 Ga0495664_0000051 Ga0495664_0000051_31254_31673 139
90 3300046511 Ga0495608_0000001 Ga0495608_0000001_312833_313258 139
91 3300046516 Ga0495628_0291038 Ga0495628_0291038_480_899 139
92 3300046529 Ga0495652_0000066 Ga0495652_0000066_47262_47681 139
93 3300046536 Ga0495587_0520161 Ga0495587_0520161_33_452 139
94 3300046543 Ga0495645_0000289 Ga0495645_0000289_19879_20301 139
95 3300046675 Ga0495657_0000002 Ga0495657_0000002_313513_313938 139
96 3300046678 Ga0495599_0014491 Ga0495599_0014491_1682_2101 139
97 3300046683 Ga0495658_0001576 Ga0495658_0001576_2400_2822 139
98 3300046689 Ga0495613_0000175 Ga0495613_0000175_49263_49682 139
99 3300046809 Ga0495600_0028623 Ga0495600_0028623_654_1073 139
100 3300047317 Ga0495604_0000615 Ga0495604_0000615_10381_10800 139
101 3300047317 Ga0495604_0026490 Ga0495604_0026490_111_530 139
102 3300047321 Ga0495676_0556817 Ga0495676_0556817_255_674 139
103 3300047444 Ga0495675_0000104 Ga0495675_0000104_37695_38120 139
104 3300047444 Ga0495675_0081820 Ga0495675_0081820_645_1064 139
105 3300047446 Ga0495679_015959 Ga0495679_015959_569_991 139
106 3300048088 Ga0495602_0000063 Ga0495602_0000063_47113_47532 139
107 3300048907 Ga0496104_0000004 Ga0496104_0000004_576210_576632 139
108 3300048907 Ga0496104_0102464 Ga0496104_0102464_235_654 139
109 3300048908 Ga0496105_0000001 Ga0496105_0000001_65199_65621 139
110 3300048911 Ga0496108_0024458 Ga0496108_0024458_608_1027 139
111 3300048912 Ga0496109_0000035 Ga0496109_0000035_38637_39056 139
112 3300048918 Ga0496115_0000178 Ga0496115_0000178_33878_34297 139
113 3300048922 Ga0496119_0008536 Ga0496119_0008536_823_1245 139
114 3300048923 Ga0496120_0137038 Ga0496120_0137038_200_622 139
115 3300049568 Ga0501031_0000044 Ga0501031_0000044_9304_9726 139
116 3300049569 Ga0501032_0000300 Ga0501032_0000300_31864_32286 139
117 3300049570 Ga0501033_0000393 Ga0501033_0000393_9490_9912 139
118 3300049571 Ga0501034_0000867 Ga0501034_0000867_14249_14671 139
119 3300049572 Ga0501036_0000475 Ga0501036_0000475_9284_9706 139
120 3300049573 Ga0501037_0000305 Ga0501037_0000305_31905_32327 139
121 3300049574 Ga0501038_0000310 Ga0501038_0000310_9262_9684 139
122 3300049575 Ga0501039_0062388 Ga0501039_0062388_1904_2326 139
123 3300049576 Ga0501040_0080402 Ga0501040_0080402_1176_1598 139
124 3300049578 Ga0501042_0117696 Ga0501042_0117696_443_865 139
125 3300049579 Ga0501043_0000350 Ga0501043_0000350_9479_9901 139
126 3300049580 Ga0501046_0000166 Ga0501046_0000166_57492_57914 139
127 3300049581 Ga0501047_0000512 Ga0501047_0000512_32092_32514 139
128 3300049582 Ga0501048_0000160 Ga0501048_0000160_32070_32492 139
129 3300049583 Ga0501067_0426142 Ga0501067_0426142_204_626 139
130 3300049584 Ga0501068_0010083 Ga0501068_0010083_568_990 139
131 3300049584 Ga0501068_0148518 Ga0501068_0148518_1004_1423 139
132 3300049585 Ga0501069_0009169 Ga0501069_0009169_64_486 139
133 3300049586 Ga0501070_0001691 Ga0501070_0001691_968_1390 139
134 3300049586 Ga0501070_0163383 Ga0501070_0163383_445_867 139
135 3300049586 Ga0501070_0174767 Ga0501070_0174767_1068_1490 139
136 3300049589 Ga0501073_0000526 Ga0501073_0000526_17199_17621 139
137 3300049590 Ga0501074_0003336 Ga0501074_0003336_1651_2073 139
138 3300049741 Ga0501079_0086223 Ga0501079_0086223_693_1115 139
139 3300049742 Ga0501080_0006082 Ga0501080_0006082_1142_1564 139
140 3300049744 Ga0501083_0003277 Ga0501083_0003277_1593_2015 139
141 3300049744 Ga0501083_0119204 Ga0501083_0119204_480_899 139
142 3300049822 Ga0501035_0000545 Ga0501035_0000545_9340_9762 139
143 3300049823 Ga0501044_0000653 Ga0501044_0000653_9515_9937 139
144 3300049823 Ga0501044_0913773 Ga0501044_0913773_227_646 139
145 3300053077 Ga0495601_0000384 Ga0495601_0000384_5618_6037 139
146 3300053084 Ga0495595_0000001 Ga0495595_0000001_98021_98446 139
147 3300053084 Ga0495595_0003167 Ga0495595_0003167_5128_5547 139
148 3300053085 Ga0495619_0000018 Ga0495619_0000018_67449_67868 139
149 3300053085 Ga0495619_0000094 Ga0495619_0000094_44414_44839 139
150 3300054114 Ga0501084_0072560 Ga0501084_0072560_1740_2162 139
151 3300060353 Ga0501082_0005415 Ga0501082_0005415_9266_9688 139
152 3300005338 Ga0068868_100839821 Ga0068868_1008398211 140
153 3300006237 Ga0097621_101402696 Ga0097621_1014026962 140
154 3300013307 Ga0157372_11009825 Ga0157372_110098252 140
155 3300014326 Ga0157380_12670144 Ga0157380_126701441 140
156 3300032126 Ga0307415_100717970 Ga0307415_1007179702 140
157 3300045976 Ga0466967_1204926 Ga0466967_1204926_259_696 140
158 3300006871 Ga0075434_100056636 Ga0075434_1000566362 141
159 3300048921 Ga0496118_0087285 Ga0496118_0087285_129_554 141
160 3300003373 JGI25407J50210_10001539 JGI25407J50210_100015394 142
161 3300005329 Ga0070683_100798004 Ga0070683_1007980042 142
162 3300005331 Ga0070670_100083205 Ga0070670_1000832053 142
163 3300005334 Ga0068869_100403971 Ga0068869_1004039712 142
164 3300005337 Ga0070682_100271939 Ga0070682_1002719393 142
165 3300005338 Ga0068868_100123937 Ga0068868_1001239373 142
166 3300005355 Ga0070671_100507072 Ga0070671_1005070722 142
167 3300005365 Ga0070688_100910121 Ga0070688_1009101211 142
168 3300005366 Ga0070659_100670598 Ga0070659_1006705982 142
169 3300005434 Ga0070709_10000278 Ga0070709_1000027826 142
170 3300005455 Ga0070663_100261519 Ga0070663_1002615192 142
171 3300005466 Ga0070685_11105576 Ga0070685_111055762 142
172 3300005535 Ga0070684_100193392 Ga0070684_1001933923 142
173 3300005577 Ga0068857_101348858 Ga0068857_1013488582 142
174 3300005615 Ga0070702_100048467 Ga0070702_1000484672 142
175 3300005618 Ga0068864_101537103 Ga0068864_1015371031 142
176 3300005719 Ga0068861_100230263 Ga0068861_1002302632 142
177 3300005841 Ga0068863_100001610 Ga0068863_1000016109 142
178 3300005981 Ga0081538_10000628 Ga0081538_1000062827 142
179 3300005985 Ga0081539_10032083 Ga0081539_100320834 142
180 3300006173 Ga0070716_100005139 Ga0070716_1000051392 142
181 3300006358 Ga0068871_100160054 Ga0068871_1001600544 142
182 3300006847 Ga0075431_100009070 Ga0075431_1000090709 142
183 3300006847 Ga0075431_100687642 Ga0075431_1006876423 142
184 3300006880 Ga0075429_100356399 Ga0075429_1003563992 142
185 3300013105 Ga0157369_10423965 Ga0157369_104239653 142
186 3300014745 Ga0157377_10259953 Ga0157377_102599532 142
187 3300025906 Ga0207699_10000059 Ga0207699_1000005911 142
188 3300025915 Ga0207693_10000549 Ga0207693_1000054934 142
189 3300025925 Ga0207650_10330470 Ga0207650_103304703 142
190 3300025939 Ga0207665_10014745 Ga0207665_100147452 142
191 3300025944 Ga0207661_10011236 Ga0207661_100112365 142
192 3300025944 Ga0207661_10983127 Ga0207661_109831272 142
193 3300025944 Ga0207661_11039355 Ga0207661_110393552 142
194 3300026088 Ga0207641_10004106 Ga0207641_1000410615 142
195 3300028563 Ga0265319_1023989 Ga0265319_10239893 142
196 3300028577 Ga0265318_10142589 Ga0265318_101425892 142
197 3300031344 Ga0265316_10592806 Ga0265316_105928062 142
198 3300031711 Ga0265314_10079312 Ga0265314_100793124 142
199 3300031901 Ga0307406_11806601 Ga0307406_118066011 142
200 3300032002 Ga0307416_102031825 Ga0307416_1020318252 142
201 3300037466 Ga0395898_0072487 Ga0395898_0072487_2836_3264 142
202 3300038443 Ga0395901_1165977 Ga0395901_1165977_51_494 142
203 3300038443 Ga0395901_1311271 Ga0395901_1311271_136_564 142
204 3300039437 Ga0436365_1056220 Ga0436365_1056220_29_469 142
205 3300039447 Ga0436361_1103403 Ga0436361_1103403_58_498 142
206 3300039453 Ga0436362_1255609 Ga0436362_1255609_938_1378 142
207 3300041512 Ga0451853_3129972 Ga0451853_3129972_252_683 142
208 3300044694 Ga0466963_0258702 Ga0466963_0258702_366_794 142
209 3300044694 Ga0466963_0267203 Ga0466963_0267203_446_874 142
210 3300044694 Ga0466963_0285421 Ga0466963_0285421_178_606 142
211 3300044694 Ga0466963_0632821 Ga0466963_0632821_176_604 142
212 3300044706 Ga0466964_0043349 Ga0466964_0043349_297_725 142
213 3300044706 Ga0466964_0270308 Ga0466964_0270308_274_702 142
214 3300044706 Ga0466964_0296308 Ga0466964_0296308_62_490 142
215 3300044842 Ga0466957_0008525 Ga0466957_0008525_5181_5609 142
216 3300045836 Ga0466958_1031322 Ga0466958_1031322_26_454 142
217 3300045976 Ga0466967_0001754 Ga0466967_0001754_635_1063 142
218 3300045976 Ga0466967_0859365 Ga0466967_0859365_250_678 142
219 3300046461 Ga0495641_0577375 Ga0495641_0577375_27_467 142
220 3300046463 Ga0495653_0322304 Ga0495653_0322304_417_845 142
221 3300046476 Ga0495662_0097669 Ga0495662_0097669_825_1271 142
222 3300046516 Ga0495628_0155175 Ga0495628_0155175_541_981 142
223 3300046517 Ga0495630_0100276 Ga0495630_0100276_12_440 142
224 3300046533 Ga0495640_0424154 Ga0495640_0424154_203_643 142
225 3300046559 Ga0495667_0073510 Ga0495667_0073510_714_1154 142
226 3300046681 Ga0495647_0000004 Ga0495647_0000004_59244_59672 142
227 3300047315 Ga0495581_0796096 Ga0495581_0796096_18_458 142
228 3300047320 Ga0495672_0023962 Ga0495672_0023962_1257_1697 142
229 3300047322 Ga0495680_0230999 Ga0495680_0230999_664_1104 142
230 3300047471 Ga0495684_0458875 Ga0495684_0458875_304_744 142
231 3300048903 Ga0496100_0348996 Ga0496100_0348996_574_1002 142
232 3300048906 Ga0496103_0012058 Ga0496103_0012058_3661_4092 142
233 3300048909 Ga0496106_0000042 Ga0496106_0000042_9837_10265 142
234 3300048910 Ga0496107_0017301 Ga0496107_0017301_1674_2102 142
235 3300050510 nmdc:mga06r32_617974_c1 nmdc:mga06r32_617974_c1_451_888 142
236 3300053085 Ga0495619_0153262 Ga0495619_0153262_1067_1507 142
237 3300053094 Ga0500566_0157570 Ga0500566_0157570_660_1091 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

21

141

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h87-assembly1.cif.gz_B rv0301 rv0300 toxin antitoxin complex from mycobacterium tuberculosis 0.8568 1 139
5sv2-assembly1.cif.gz_A-2 toxin vapc21 from mycobacterium tuberculosis 0.8546 3 140
3h87-assembly1.cif.gz_B rv0301 rv0300 toxin antitoxin complex from mycobacterium tuberculosis 0.8511 1 139
5sv2-assembly1.cif.gz_A-2 toxin vapc21 from mycobacterium tuberculosis 0.843 3 140
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.8301 5 134
ID Description Score Start End Superfamily
af_P9WFB5_2_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9241 40 126 3.40.50.1010
af_L0T5V6_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8852 1 142 3.40.50.1010
3h87A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8808 1 135 3.40.50.1010
af_L0T5V6_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8791 1 142 3.40.50.1010
af_P95007_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8692 5 140 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A1X1Y5G4-F1-model_v4 Uncharacterized protein 0.991 23 142 GO:0004518
GO:0046872
AF-A0A1S1NL41-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9716 1 142 GO:0000287
GO:0004540
GO:0090729
AF-A0A1X1Y5G4-F1-model_v4 Uncharacterized protein 0.9592 23 142 GO:0004518
GO:0046872
AF-A0A7W0ZDP8-F1-model_v4 PIN domain-containing protein 0.9438 3 142 GO:0004518
GO:0046872
AF-A0A7W0MSI4-F1-model_v4 PIN domain-containing protein 0.9434 40 135 GO:0004518
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.93 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map