F349326

General Info

Members Datasets Scaffolds Average Seq Length
236 184 472 230

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0042534|Ga0466957_0042534_1553_2308
Length 251
Sequence VSPDAVPGAVGALDLPTFGERVNLRQQVAHALRAAMIAGEMRPGVVYSAPALAMRFGVSATPVREAMLDLAKEGLVEAVRNKGFRVTELSEQELDEITMIRALIEVPTIGDVARRCDPELAPRVEALRSVAREIEALAEQKDLIRYVEADRTFHLSLLALAGNASLVALVGELRSRSRLYGLQQLADRGQLADSAREHEQLVDLVLAGHGAAAEALMRRHIGHVRGTWAGRGVQAAADAAAADLSRPPVRA

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
94 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
99 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
100 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
164 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
165 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
166 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
167 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
168 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
169 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
170 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
171 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
172 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
173 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
174 2891562705 Microbispora tritici MT50 Isolate Unclassified
175 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
176 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
177 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
178 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
179 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
180 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
181 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
182 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
183 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
184 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.41
Metatranscriptomes 1.69
Isolates 8.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.69
Nodule 0
Rhizoplane 7.2
Rhizosphere 80.93
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0042534 3300044842 Bacteria 2749
2 JGI25152J39213_1000445 3300002773 Bacteria 24511
3 JGI25406J46586_10009421 3300003203 Bacteria 4373
4 rootL2_10033154 3300003322 Bacteria 26828
5 Ga0070683_100162372 3300005329 Bacteria 2120
6 Ga0070683_100503028 3300005329 Bacteria 1158
7 Ga0068869_100180206 3300005334 Bacteria 1656
8 Ga0068868_100006764 3300005338 Bacteria 8146
9 Ga0070660_100323015 3300005339 Bacteria 1268
10 Ga0070675_100434621 3300005354 Bacteria 1175
11 Ga0070674_100162131 3300005356 Bacteria 1697
12 Ga0070674_100897516 3300005356 Bacteria 772
13 Ga0070673_100906932 3300005364 Bacteria 817
14 Ga0070667_100079073 3300005367 Bacteria 2811
15 Ga0070667_100082536 3300005367 Bacteria 2752
16 Ga0070714_100014815 3300005435 Bacteria 6267
17 Ga0070714_100151334 3300005435 Bacteria 2091
18 Ga0070713_100029743 3300005436 Bacteria 4329
19 Ga0070713_100156382 3300005436 Bacteria 2032
20 Ga0070713_100339505 3300005436 Bacteria 1391
21 Ga0070710_10004320 3300005437 Bacteria 6737
22 Ga0070710_10015606 3300005437 Bacteria 3848
23 Ga0070710_10032539 3300005437 Bacteria 2825
24 Ga0070711_100007312 3300005439 Bacteria 6716
25 Ga0070711_100146700 3300005439 Bacteria 1775
26 Ga0070705_100172726 3300005440 Bacteria 1456
27 Ga0070708_100056910 3300005445 Bacteria 3479
28 Ga0070681_10841962 3300005458 Bacteria 835
29 Ga0070706_100003149 3300005467 Bacteria 16310
30 Ga0070707_100000381 3300005468 Bacteria 43789
31 Ga0070707_100126745 3300005468 Bacteria 2481
32 Ga0070698_100000951 3300005471 Bacteria 31690
33 Ga0070699_100052677 3300005518 Bacteria 3521
34 Ga0070699_100448932 3300005518 Bacteria 1169
35 Ga0070684_100043485 3300005535 Bacteria 3879
36 Ga0070684_100834732 3300005535 Bacteria 862
37 Ga0070697_100008481 3300005536 Bacteria 8021
38 Ga0070697_100240034 3300005536 Bacteria 1547
39 Ga0068855_100496400 3300005563 Bacteria 1327
40 Ga0068857_100123473 3300005577 Bacteria 2333
41 Ga0068857_100399555 3300005577 Bacteria 1279
42 Ga0068856_100060920 3300005614 Bacteria 3728
43 Ga0068856_100152945 3300005614 Bacteria 2316
44 Ga0068859_100646129 3300005617 Bacteria 1150
45 Ga0068864_100186562 3300005618 Bacteria 1899
46 Ga0068863_100116961 3300005841 Bacteria 2541
47 Ga0068858_100032797 3300005842 Bacteria 4824
48 Ga0068860_100388410 3300005843 Bacteria 1379
49 Ga0081455_10009504 3300005937 Bacteria 9992
50 Ga0081455_10091653 3300005937 Bacteria 2461
51 Ga0081539_10000574 3300005985 Bacteria 75794
52 Ga0070717_10038638 3300006028 Bacteria 3880
53 Ga0070717_10232078 3300006028 Bacteria 1625
54 Ga0070716_100209413 3300006173 Bacteria 1302
55 Ga0070712_100108222 3300006175 Bacteria 2069
56 Ga0070712_100118077 3300006175 Bacteria 1991
57 Ga0070712_100161948 3300006175 Bacteria 1728
58 Ga0070712_100190545 3300006175 Bacteria 1604
59 Ga0068871_100527991 3300006358 Bacteria 1067
60 Ga0075434_100687412 3300006871 Bacteria 1041
61 Ga0097620_100645990 3300006931 Bacteria 1150
62 Ga0105245_10164495 3300009098 Bacteria 2108
63 Ga0114129_11029719 3300009147 Bacteria 1035
64 Ga0105243_10002445 3300009148 Bacteria 15517
65 Ga0105248_10085261 3300009177 Bacteria 3554
66 Ga0105237_10009000 3300009545 Bacteria 10739
67 Ga0105238_10111395 3300009551 Bacteria 2717
68 Ga0105239_10020508 3300010375 Bacteria 7290
69 Ga0105246_10013328 3300011119 Bacteria 5151
70 Ga0105246_10595604 3300011119 Bacteria 954
71 Ga0157370_10168771 3300013104 Bacteria 2034
72 Ga0157370_10739052 3300013104 Bacteria 897
73 Ga0157374_10037034 3300013296 Bacteria 4474
74 Ga0163162_10037860 3300013306 Bacteria 4814
75 Ga0157375_10062713 3300013308 Bacteria 3695
76 Ga0163163_10994983 3300014325 Bacteria 902
77 Ga0157379_10022858 3300014968 Bacteria 5542
78 Ga0157376_10144824 3300014969 Bacteria 2136
79 Ga0197907_10262026 3300020069 Bacteria 1105
80 Ga0206353_11059185 3300020082 Bacteria 2201
81 Ga0206353_11204451 3300020082 Bacteria 2369
82 Ga0213873_10014228 3300021358 Bacteria 1760
83 Ga0224712_10146016 3300022467 Bacteria 1045
84 Ga0209129_1000052 3300025258 Bacteria 265251
85 Ga0209025_1020330 3300025294 Bacteria 3638
86 Ga0207426_1028119 3300025302 Bacteria 1866
87 Ga0207697_10055418 3300025315 Bacteria 1644
88 Ga0207692_10009931 3300025898 Bacteria 3991
89 Ga0207692_10067884 3300025898 Bacteria 1868
90 Ga0207692_10166467 3300025898 Bacteria 1274
91 Ga0207710_10278744 3300025900 Bacteria 841
92 Ga0207684_10004890 3300025910 Bacteria 12510
93 Ga0207707_10315809 3300025912 Bacteria 1350
94 Ga0207693_10039943 3300025915 Bacteria 3695
95 Ga0207693_10103990 3300025915 Bacteria 2227
96 Ga0207693_10175596 3300025915 Bacteria 1686
97 Ga0207646_10017862 3300025922 Bacteria 6625
98 Ga0207646_10172182 3300025922 Bacteria 1955
99 Ga0207700_10361508 3300025928 Bacteria 1266
100 Ga0207700_10575375 3300025928 Bacteria 1001
101 Ga0207700_10697321 3300025928 Bacteria 906
102 Ga0207664_10030022 3300025929 Bacteria 4148
103 Ga0207664_10117176 3300025929 Bacteria 2223
104 Ga0207709_10001815 3300025935 Bacteria 14245
105 Ga0207665_10024055 3300025939 Bacteria 4014
106 Ga0207691_10183158 3300025940 Bacteria 1829
107 Ga0207661_10049061 3300025944 Bacteria 3359
108 Ga0207661_10123781 3300025944 Bacteria 2206
109 Ga0207651_10463037 3300025960 Bacteria 1090
110 Ga0207658_10213596 3300025986 Bacteria 1618
111 Ga0207677_10017740 3300026023 Bacteria 4253
112 Ga0207703_10077747 3300026035 Bacteria 2755
113 Ga0207678_10154484 3300026067 Bacteria 1959
114 Ga0207702_10018672 3300026078 Bacteria 5736
115 Ga0207702_10050092 3300026078 Bacteria 3526
116 Ga0207641_10572411 3300026088 Bacteria 1103
117 Ga0207676_10297939 3300026095 Bacteria 1471
118 Ga0207674_10049588 3300026116 Bacteria 4293
119 Ga0207674_10133711 3300026116 Bacteria 2443
120 Ga0207428_10132605 3300027907 Bacteria 1906
121 Ga0268264_11019034 3300028381 Bacteria 835
122 Ga0307515_10019377 3300028794 Bacteria 12254
123 Ga0307512_10005175 3300030522 Bacteria 13759
124 Ga0307513_10100011 3300031456 Bacteria 2926
125 Ga0307408_100216026 3300031548 Bacteria 1562
126 Ga0307508_10002856 3300031616 Bacteria 17914
127 Ga0307516_10048122 3300031730 Bacteria 4197
128 Ga0307518_10000028 3300031838 Bacteria 98010
129 Ga0307410_10038501 3300031852 Bacteria 3133
130 Ga0307406_10250093 3300031901 Bacteria 1335
131 Ga0307406_10596847 3300031901 Bacteria 910
132 Ga0307407_10039388 3300031903 Bacteria 2628
133 Ga0307407_10127185 3300031903 Bacteria 1625
134 Ga0373926_0047234 3300035083 Bacteria 1546
135 Ga0373934_0057034 3300035086 Bacteria 1554
136 Ga0373923_0186259 3300035111 Bacteria 955
137 Ga0373945_0038503 3300035116 Bacteria 1720
138 Ga0373955_0280517 3300035172 Unclassified 1002
139 Ga0373924_0033907 3300035410 Bacteria 2064
140 Ga0373937_0021513 3300036401 Bacteria 5789
141 Ga0395899_0016626 3300037312 Bacteria 5612
142 Ga0395901_0417662 3300038443 Bacteria 1376
143 Ga0436365_0005268 3300039437 Bacteria 1693
144 Ga0436365_1284729 3300039437 Bacteria 12713
145 Ga0436362_0816001 3300039453 Bacteria 1891
146 Ga0451577_0201115 3300042876 Bacteria 1799
147 Ga0466972_0025547 3300044658 Bacteria 2927
148 Ga0466966_0158700 3300044684 Bacteria 1377
149 Ga0466961_0008808 3300044693 Bacteria 6436
150 Ga0466961_0165181 3300044693 Bacteria 1378
151 Ga0466963_0003411 3300044694 Bacteria 9091
152 Ga0466963_0015046 3300044694 Bacteria 4783
153 Ga0466964_0027522 3300044706 Bacteria 2233
154 Ga0466971_0122836 3300044719 Bacteria 1202
155 Ga0466970_0015333 3300044765 Bacteria 3940
156 Ga0466960_0025147 3300044901 Bacteria 2692
157 Ga0466959_0007090 3300045049 Bacteria 7840
158 Ga0466959_0098124 3300045049 Bacteria 2099
159 Ga0466958_0094295 3300045836 Bacteria 1854
160 Ga0466958_0168928 3300045836 Bacteria 1385
161 Ga0466967_0016279 3300045976 Bacteria 5858
162 Ga0466967_0045851 3300045976 Bacteria 3802
163 Ga0466967_0178754 3300045976 Bacteria 2000
164 Ga0495603_0032638 3300046455 Bacteria 3132
165 Ga0495653_0196773 3300046463 Bacteria 1371
166 Ga0495580_0170500 3300046472 Bacteria 1505
167 Ga0495582_0076092 3300046473 Bacteria 1860
168 Ga0495608_0084501 3300046511 Bacteria 2059
169 Ga0495628_0135636 3300046516 Unclassified 1881
170 Ga0495631_0121697 3300046518 Bacteria 1122
171 Ga0495652_0027088 3300046529 Bacteria 5053
172 Ga0495645_0049901 3300046543 Bacteria 3047
173 Ga0495633_0166879 3300046558 Bacteria 1015
174 Ga0495634_0157496 3300046642 Unclassified 1434
175 Ga0495634_0167176 3300046642 Bacteria 1384
176 Ga0495659_0040116 3300046664 Bacteria 1667
177 Ga0495661_0254892 3300046665 Bacteria 894
178 Ga0495599_0174146 3300046678 Bacteria 1327
179 Ga0495647_0048734 3300046681 Bacteria 1639
180 Ga0495624_0394121 3300046690 Bacteria 831
181 Ga0495684_0151136 3300047471 Bacteria 1736
182 Ga0495593_0313965 3300047673 Bacteria 784
183 Ga0495602_0035838 3300048088 Bacteria 4623
184 Ga0495602_0305470 3300048088 Bacteria 1163
185 Ga0496102_0321111 3300048905 Bacteria 1459
186 Ga0496102_0549833 3300048905 Bacteria 1077
187 Ga0496104_0008319 3300048907 Bacteria 9213
188 Ga0496104_0433815 3300048907 Bacteria 1226
189 Ga0496105_0011244 3300048908 Bacteria 7063
190 Ga0496105_0325250 3300048908 Bacteria 1232
191 Ga0496106_0346851 3300048909 Bacteria 1193
192 Ga0496108_0006705 3300048911 Bacteria 9324
193 Ga0496108_0750542 3300048911 Bacteria 844
194 Ga0496109_0030766 3300048912 Bacteria 4811
195 Ga0496109_0722091 3300048912 Bacteria 934
196 Ga0496111_0043363 3300048914 Bacteria 3233
197 Ga0496112_0172548 3300048915 Bacteria 2128
198 Ga0496113_0247482 3300048916 Bacteria 1423
199 Ga0496114_0179630 3300048917 Bacteria 1848
200 Ga0496114_0243399 3300048917 Bacteria 1582
201 Ga0496115_0091730 3300048918 Bacteria 2483
202 Ga0496126_0208282 3300048929 Bacteria 1647
203 Ga0501036_0063806 3300049572 Bacteria 3118
204 Ga0501037_0002848 3300049573 Bacteria 12540
205 Ga0501038_0001599 3300049574 Bacteria 21000
206 Ga0501043_0003402 3300049579 Bacteria 13081
207 Ga0501047_0005651 3300049581 Bacteria 11774
208 Ga0501048_0001147 3300049582 Bacteria 19890
209 Ga0501073_0171362 3300049589 Bacteria 1502
210 Ga0501074_0057127 3300049590 Bacteria 2811
211 Ga0501044_0139010 3300049823 Bacteria 2418
212 Ga0501044_0277217 3300049823 Bacteria 1611
213 nmdc:mga09592_271420_c1 3300050508 Bacteria 1471
214 nmdc:mga0n895_309384_c1 3300050512 Bacteria 1601
215 Ga0466962_0043105 3300061719 Bacteria 2159
216 2586061090 2585427649 Bacteria 9053857
217 2676476481 2675903058 Bacteria 6822861
218 2676493201 2675903060 Bacteria 10051191
219 2844850962 2844849076 Bacteria 4091819
220 2856744686 2856741275 Bacteria 8096094
221 2861524025 2861520306 Bacteria 8348283
222 2873319416 2873314349 Bacteria 8512634
223 2884700569 2884693830 Bacteria 11273186
224 2891400660 2891395885 Bacteria 9251614
225 2891562348 2891554331 Bacteria 8812224
226 2891565627 2891562705 Bacteria 8039471
227 2895430743 2895427314 Bacteria 13147766
228 2895450210 2895442618 Bacteria 11027144
229 2946024335 2946024296 Bacteria 3508095
230 2995469382 2995463766 Bacteria 8577691
231 2995728473 2995726249 Bacteria 3470435
232 2997607086 2997600082 Bacteria 9896405
233 3003005227 3002998708 Bacteria 11715108
234 8055068639 8055066027 Bacteria 9479577
235 8055174523 8055172936 Bacteria 9305943
236 8057572496 8057568493 Bacteria 7221719
237 Ga0466957_0042534
238 JGI25152J39213_1000445
239 JGI25406J46586_10009421
240 rootL2_10033154
241 Ga0070683_100162372
242 Ga0070683_100503028
243 Ga0068869_100180206
244 Ga0068868_100006764
245 Ga0070660_100323015
246 Ga0070675_100434621
247 Ga0070674_100162131
248 Ga0070674_100897516
249 Ga0070673_100906932
250 Ga0070667_100079073
251 Ga0070667_100082536
252 Ga0070714_100014815
253 Ga0070714_100151334
254 Ga0070713_100029743
255 Ga0070713_100156382
256 Ga0070713_100339505
257 Ga0070710_10004320
258 Ga0070710_10015606
259 Ga0070710_10032539
260 Ga0070711_100007312
261 Ga0070711_100146700
262 Ga0070705_100172726
263 Ga0070708_100056910
264 Ga0070681_10841962
265 Ga0070706_100003149
266 Ga0070707_100000381
267 Ga0070707_100126745
268 Ga0070698_100000951
269 Ga0070699_100052677
270 Ga0070699_100448932
271 Ga0070684_100043485
272 Ga0070684_100834732
273 Ga0070697_100008481
274 Ga0070697_100240034
275 Ga0068855_100496400
276 Ga0068857_100123473
277 Ga0068857_100399555
278 Ga0068856_100060920
279 Ga0068856_100152945
280 Ga0068859_100646129
281 Ga0068864_100186562
282 Ga0068863_100116961
283 Ga0068858_100032797
284 Ga0068860_100388410
285 Ga0081455_10009504
286 Ga0081455_10091653
287 Ga0081539_10000574
288 Ga0070717_10038638
289 Ga0070717_10232078
290 Ga0070716_100209413
291 Ga0070712_100108222
292 Ga0070712_100118077
293 Ga0070712_100161948
294 Ga0070712_100190545
295 Ga0068871_100527991
296 Ga0075434_100687412
297 Ga0097620_100645990
298 Ga0105245_10164495
299 Ga0114129_11029719
300 Ga0105243_10002445
301 Ga0105248_10085261
302 Ga0105237_10009000
303 Ga0105238_10111395
304 Ga0105239_10020508
305 Ga0105246_10013328
306 Ga0105246_10595604
307 Ga0157370_10168771
308 Ga0157370_10739052
309 Ga0157374_10037034
310 Ga0163162_10037860
311 Ga0157375_10062713
312 Ga0163163_10994983
313 Ga0157379_10022858
314 Ga0157376_10144824
315 Ga0197907_10262026
316 Ga0206353_11059185
317 Ga0206353_11204451
318 Ga0213873_10014228
319 Ga0224712_10146016
320 Ga0209129_1000052
321 Ga0209025_1020330
322 Ga0207426_1028119
323 Ga0207697_10055418
324 Ga0207692_10009931
325 Ga0207692_10067884
326 Ga0207692_10166467
327 Ga0207710_10278744
328 Ga0207684_10004890
329 Ga0207707_10315809
330 Ga0207693_10039943
331 Ga0207693_10103990
332 Ga0207693_10175596
333 Ga0207646_10017862
334 Ga0207646_10172182
335 Ga0207700_10361508
336 Ga0207700_10575375
337 Ga0207700_10697321
338 Ga0207664_10030022
339 Ga0207664_10117176
340 Ga0207709_10001815
341 Ga0207665_10024055
342 Ga0207691_10183158
343 Ga0207661_10049061
344 Ga0207661_10123781
345 Ga0207651_10463037
346 Ga0207658_10213596
347 Ga0207677_10017740
348 Ga0207703_10077747
349 Ga0207678_10154484
350 Ga0207702_10018672
351 Ga0207702_10050092
352 Ga0207641_10572411
353 Ga0207676_10297939
354 Ga0207674_10049588
355 Ga0207674_10133711
356 Ga0207428_10132605
357 Ga0268264_11019034
358 Ga0307515_10019377
359 Ga0307512_10005175
360 Ga0307513_10100011
361 Ga0307408_100216026
362 Ga0307508_10002856
363 Ga0307516_10048122
364 Ga0307518_10000028
365 Ga0307410_10038501
366 Ga0307406_10250093
367 Ga0307406_10596847
368 Ga0307407_10039388
369 Ga0307407_10127185
370 Ga0373926_0047234
371 Ga0373934_0057034
372 Ga0373923_0186259
373 Ga0373945_0038503
374 Ga0373955_0280517
375 Ga0373924_0033907
376 Ga0373937_0021513
377 Ga0395899_0016626
378 Ga0395901_0417662
379 Ga0436365_0005268
380 Ga0436365_1284729
381 Ga0436362_0816001
382 Ga0451577_0201115
383 Ga0466972_0025547
384 Ga0466966_0158700
385 Ga0466961_0008808
386 Ga0466961_0165181
387 Ga0466963_0003411
388 Ga0466963_0015046
389 Ga0466964_0027522
390 Ga0466971_0122836
391 Ga0466970_0015333
392 Ga0466960_0025147
393 Ga0466959_0007090
394 Ga0466959_0098124
395 Ga0466958_0094295
396 Ga0466958_0168928
397 Ga0466967_0016279
398 Ga0466967_0045851
399 Ga0466967_0178754
400 Ga0495603_0032638
401 Ga0495653_0196773
402 Ga0495580_0170500
403 Ga0495582_0076092
404 Ga0495608_0084501
405 Ga0495628_0135636
406 Ga0495631_0121697
407 Ga0495652_0027088
408 Ga0495645_0049901
409 Ga0495633_0166879
410 Ga0495634_0157496
411 Ga0495634_0167176
412 Ga0495659_0040116
413 Ga0495661_0254892
414 Ga0495599_0174146
415 Ga0495647_0048734
416 Ga0495624_0394121
417 Ga0495684_0151136
418 Ga0495593_0313965
419 Ga0495602_0035838
420 Ga0495602_0305470
421 Ga0496102_0321111
422 Ga0496102_0549833
423 Ga0496104_0008319
424 Ga0496104_0433815
425 Ga0496105_0011244
426 Ga0496105_0325250
427 Ga0496106_0346851
428 Ga0496108_0006705
429 Ga0496108_0750542
430 Ga0496109_0030766
431 Ga0496109_0722091
432 Ga0496111_0043363
433 Ga0496112_0172548
434 Ga0496113_0247482
435 Ga0496114_0179630
436 Ga0496114_0243399
437 Ga0496115_0091730
438 Ga0496126_0208282
439 Ga0501036_0063806
440 Ga0501037_0002848
441 Ga0501038_0001599
442 Ga0501043_0003402
443 Ga0501047_0005651
444 Ga0501048_0001147
445 Ga0501073_0171362
446 Ga0501074_0057127
447 Ga0501044_0139010
448 Ga0501044_0277217
449 nmdc:mga09592_271420_c1
450 nmdc:mga0n895_309384_c1
451 Ga0466962_0043105
452 2586061090
453 2676476481
454 2676493201
455 2844850962
456 2856744686
457 2861524025
458 2873319416
459 2884700569
460 2891400660
461 2891562348
462 2891565627
463 2895430743
464 2895450210
465 2946024335
466 2995469382
467 2995728473
468 2997607086
469 3003005227
470 8055068639
471 8055174523
472 8057572496

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

24

86

0.98

PF07729

FCD

FCD domain

96

223

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b5y-assembly1.cif.gz_D s. agalactiae busr in complex with its busab-promotor dna 0.871 24 90
4h0e-assembly1.cif.gz_A crystal structure of mutant orr3 in complex with ntd of arar 0.8428 22 89
5kvr-assembly1.cif.gz_A-2 x-ray crystal structure of a fragment (1-75) of a transcriptional regulator pdhr from escherichia coli cft073 0.8391 18 89
2heo-assembly1.cif.gz_A general structure-based approach to the design of protein ligands: application to the design of kv1.2 potassium channel blockers. 0.832 46 90
3edp-assembly1.cif.gz_B the crystal structure of the protein lin2111 (functionally unknown) from listeria innocua clip11262 0.8205 24 100
ID Description Score Start End Superfamily
3sxyB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9515 28 90 1.10.10.10
af_Q79G00_16_82_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9463 27 88 1.10.10.10
af_P0ACM2_11_76_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9247 24 89 1.10.10.10
3sxyB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9234 28 90 1.10.10.10
4p9fA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9171 24 90 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0M8R6N6-F1-model_v4 deleted 0.9224 26 228
AF-A0A559UE35-F1-model_v4 deleted 0.9125 27 230
AF-K0EKZ5-F1-model_v4 GntR family transcriptional regulator 0.9078 27 230 GO:0003677
GO:0003700
AF-A0A428YSS4-F1-model_v4 GntR family transcriptional regulator 0.9061 24 229 GO:0003677
GO:0003700
AF-A0A2G1XB18-F1-model_v4 GntR family transcriptional regulator 0.9028 27 233 GO:0003677
GO:0003700

Map