F349267

General Info

Members Datasets Scaffolds Average Seq Length
236 149 472 229

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0141559|Ga0436364_0141559_7719_8384
Length 221
Sequence MRVLVVEDIPRHANRIAEGLRDQGMAVDVAYDGHEALAKLNLTAYDVVLLDRDLPGIHGDQLCQLVTRIDEPPMILMLTAAGAATDRVEGLALGADDYLPKPFHFPELILRIRALGRRKPAARQRTLQVAGIELDQLTGIITRQGQTIALTAKERAVLEALLKASPAPLSTEQLLRQAWDENADPFTNTVKVTIARLRRKLGPPEVIHTTPGIGYRITETP

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
30 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
77 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
78 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
79 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
80 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
81 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
82 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
83 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
84 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
115 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
116 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
117 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
118 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
119 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
134 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
145 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
146 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
147 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
148 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
149 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.03
Metatranscriptomes 0.85
Isolates 2.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.54
Nodule 0
Rhizoplane 23.73
Rhizosphere 66.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0141559 3300037853 Bacteria 12383
2 JGI25406J46586_10001219 3300003203 Bacteria 12124
3 Ga0070658_10285294 3300005327 Bacteria 1406
4 Ga0070668_100643453 3300005347 Bacteria 931
5 Ga0070674_100189046 3300005356 Bacteria 1583
6 Ga0070673_100505025 3300005364 Bacteria 1094
7 Ga0070714_100004894 3300005435 Bacteria 10168
8 Ga0070714_100006311 3300005435 Bacteria 9138
9 Ga0070714_100182423 3300005435 Bacteria 1910
10 Ga0070713_100001609 3300005436 Bacteria 14458
11 Ga0070713_100060061 3300005436 Bacteria 3177
12 Ga0070700_100201295 3300005441 Bacteria 1399
13 Ga0068867_100085741 3300005459 Bacteria 2381
14 Ga0070706_100048376 3300005467 Bacteria 3924
15 Ga0070679_100039321 3300005530 Bacteria 4702
16 Ga0070684_100000799 3300005535 Bacteria 21882
17 Ga0070696_100001899 3300005546 Bacteria 13743
18 Ga0068857_100000561 3300005577 Bacteria 27093
19 Ga0068852_100533550 3300005616 Bacteria 1172
20 Ga0068862_100456175 3300005844 Bacteria 1206
21 Ga0081539_10000031 3300005985 Bacteria 313232
22 Ga0081539_10017696 3300005985 Bacteria 4989
23 Ga0070717_10025069 3300006028 Bacteria 4737
24 Ga0075365_10053267 3300006038 Bacteria 2679
25 Ga0075428_100000718 3300006844 Bacteria 34349
26 Ga0075428_100208625 3300006844 Bacteria 2111
27 Ga0075430_100042249 3300006846 Bacteria 3855
28 Ga0075431_100046357 3300006847 Bacteria 4482
29 Ga0075431_100513226 3300006847 Bacteria 1188
30 Ga0075433_10017487 3300006852 Bacteria 5940
31 Ga0075433_10018030 3300006852 Bacteria 5859
32 Ga0075434_100013894 3300006871 Bacteria 7681
33 Ga0075434_100078150 3300006871 Bacteria 3304
34 Ga0075429_100044288 3300006880 Bacteria 3872
35 Ga0075436_100044069 3300006914 Bacteria 3076
36 Ga0075435_100047674 3300007076 Bacteria 3440
37 Ga0075435_100206613 3300007076 Bacteria 1665
38 Ga0105251_10247256 3300009011 Bacteria 804
39 Ga0105250_10155682 3300009092 Bacteria 952
40 Ga0105240_10005139 3300009093 Bacteria 19587
41 Ga0105240_10332425 3300009093 Bacteria 1728
42 Ga0111539_10014872 3300009094 Bacteria 9704
43 Ga0105245_10079744 3300009098 Bacteria 2990
44 Ga0105245_10091094 3300009098 Bacteria 2806
45 Ga0114129_10034987 3300009147 Bacteria 7096
46 Ga0114129_10227756 3300009147 Bacteria 2511
47 Ga0114129_10510995 3300009147 Bacteria 1568
48 Ga0105248_10981261 3300009177 Bacteria 954
49 Ga0105249_10095935 3300009553 Bacteria 2781
50 Ga0105239_10297701 3300010375 Bacteria 1817
51 Ga0157373_10061344 3300013100 Bacteria 2663
52 Ga0157369_10049097 3300013105 Bacteria 4575
53 Ga0157375_10221783 3300013308 Bacteria 2049
54 Ga0163163_10459512 3300014325 Bacteria 1333
55 Ga0163161_10064031 3300017792 Bacteria 2681
56 Ga0197907_10365196 3300020069 Bacteria 1225
57 Ga0206356_10082017 3300020070 Bacteria 1326
58 Ga0213876_10055706 3300021384 Bacteria 2087
59 Ga0207699_10093498 3300025906 Bacteria 1893
60 Ga0207684_10011413 3300025910 Bacteria 7774
61 Ga0207657_10534423 3300025919 Bacteria 917
62 Ga0207687_10114161 3300025927 Bacteria 2010
63 Ga0207700_10015886 3300025928 Bacteria 4982
64 Ga0207700_10043121 3300025928 Bacteria 3312
65 Ga0207700_10087136 3300025928 Bacteria 2455
66 Ga0207664_10001019 3300025929 Bacteria 18787
67 Ga0207664_10001902 3300025929 Bacteria 13715
68 Ga0207664_10002144 3300025929 Bacteria 12981
69 Ga0207664_10019644 3300025929 Bacteria 4998
70 Ga0207679_10306422 3300025945 Bacteria 1371
71 Ga0207667_10100691 3300025949 Bacteria 2981
72 Ga0207651_10345143 3300025960 Bacteria 1252
73 Ga0207712_10068795 3300025961 Bacteria 2538
74 Ga0207668_10367344 3300025972 Bacteria 1207
75 Ga0207640_10332632 3300025981 Bacteria 1214
76 Ga0207708_10014478 3300026075 Bacteria 5903
77 Ga0207648_10101694 3300026089 Bacteria 2518
78 Ga0207674_10081145 3300026116 Bacteria 3245
79 Ga0207675_100123955 3300026118 Bacteria 2446
80 Ga0207675_100133175 3300026118 Bacteria 2357
81 Ga0207675_100439201 3300026118 Bacteria 1291
82 Ga0207428_10002158 3300027907 Bacteria 19749
83 Ga0207428_10069461 3300027907 Bacteria 2770
84 Ga0316179_1005631 3300030734 Bacteria 1580
85 Ga0307408_100121304 3300031548 Bacteria 2025
86 Ga0307508_10181514 3300031616 Bacteria 1707
87 Ga0307413_10141743 3300031824 Bacteria 1662
88 Ga0307409_100406916 3300031995 Bacteria 1301
89 Ga0307416_100162416 3300032002 Bacteria 2067
90 Ga0307416_100226201 3300032002 Bacteria 1799
91 Ga0307414_10178173 3300032004 Bacteria 1707
92 Ga0307415_100000015 3300032126 Bacteria 79927
93 Ga0395900_0045950 3300037418 Bacteria 4498
94 Ga0395898_0048066 3300037466 Bacteria 4185
95 Ga0395898_0287538 3300037466 Bacteria 1568
96 Ga0395905_0338662 3300037471 Bacteria 1395
97 Ga0436364_0714365 3300037853 Bacteria 6431
98 Ga0436364_1043459 3300037853 Bacteria 789
99 Ga0395901_0182155 3300038443 Bacteria 2203
100 Ga0436365_0771022 3300039437 Bacteria 5095
101 Ga0436363_0346174 3300039450 Bacteria 998
102 Ga0451789_0575608 3300041443 Bacteria 1524
103 Ga0451797_1563140 3300041453 Bacteria 3820
104 Ga0451843_1139464 3300041509 Bacteria 1828
105 Ga0451853_1457988 3300041512 Bacteria 1550
106 Ga0439448_0040353 3300042005 Bacteria 1507
107 Ga0439463_010321 3300042016 Bacteria 2295
108 Ga0439464_0079765 3300042439 Bacteria 976
109 Ga0439440_0010351 3300042993 Bacteria 1948
110 Ga0466969_0067432 3300044656 Bacteria 1727
111 Ga0466965_0025323 3300044683 Bacteria 2872
112 Ga0466966_0056803 3300044684 Bacteria 2475
113 Ga0466966_0202357 3300044684 Bacteria 1201
114 Ga0466961_0011007 3300044693 Bacteria 5781
115 Ga0466961_0066923 3300044693 Bacteria 2282
116 Ga0466961_0093707 3300044693 Bacteria 1895
117 Ga0466961_0213979 3300044693 Bacteria 1189
118 Ga0466963_0143311 3300044694 Bacteria 1656
119 Ga0466963_0261042 3300044694 Bacteria 1216
120 Ga0466971_0028077 3300044719 Bacteria 2519
121 Ga0466971_0077923 3300044719 Bacteria 1509
122 Ga0466968_0019803 3300044735 Bacteria 2712
123 Ga0466968_0115877 3300044735 Bacteria 1209
124 Ga0466968_0171743 3300044735 Bacteria 1005
125 Ga0466970_0254612 3300044765 Bacteria 984
126 Ga0466959_0016731 3300045049 Bacteria 5365
127 Ga0466959_0044615 3300045049 Bacteria 3266
128 Ga0466959_0219746 3300045049 Bacteria 1318
129 Ga0466958_0008411 3300045836 Bacteria 5723
130 Ga0466958_0054279 3300045836 Bacteria 2430
131 Ga0466958_0078290 3300045836 Bacteria 2031
132 Ga0466958_0206510 3300045836 Bacteria 1251
133 Ga0466967_0008293 3300045976 Bacteria 7594
134 Ga0495616_0130933 3300046513 Bacteria 1150
135 Ga0495630_0096719 3300046517 Bacteria 2232
136 Ga0496100_0009523 3300048903 Bacteria 5460
137 Ga0496100_0012380 3300048903 Bacteria 4889
138 Ga0496100_0068766 3300048903 Bacteria 2356
139 Ga0496101_0009860 3300048904 Bacteria 6292
140 Ga0496101_0042214 3300048904 Bacteria 3255
141 Ga0496101_0247076 3300048904 Bacteria 1389
142 Ga0496102_0052806 3300048905 Bacteria 3704
143 Ga0496102_0053169 3300048905 Bacteria 3692
144 Ga0496102_0528355 3300048905 Bacteria 1102
145 Ga0496103_0280517 3300048906 Bacteria 1072
146 Ga0496104_0010068 3300048907 Bacteria 8439
147 Ga0496104_0054118 3300048907 Bacteria 3793
148 Ga0496104_0357250 3300048907 Bacteria 1373
149 Ga0496105_0035067 3300048908 Bacteria 4129
150 Ga0496105_0067360 3300048908 Bacteria 2956
151 Ga0496105_0067720 3300048908 Bacteria 2948
152 Ga0496105_0082208 3300048908 Bacteria 2660
153 Ga0496105_0098402 3300048908 Bacteria 2415
154 Ga0496105_0138899 3300048908 Bacteria 2001
155 Ga0496106_0000253 3300048909 Bacteria 37605
156 Ga0496107_0002983 3300048910 Bacteria 11210
157 Ga0496107_0360033 3300048910 Bacteria 1082
158 Ga0496108_0005939 3300048911 Bacteria 9889
159 Ga0496108_0006181 3300048911 Bacteria 9689
160 Ga0496108_0230465 3300048911 Bacteria 1611
161 Ga0496108_0363327 3300048911 Bacteria 1264
162 Ga0496108_0395893 3300048911 Bacteria 1206
163 Ga0496109_0003963 3300048912 Bacteria 12360
164 Ga0496109_0009280 3300048912 Bacteria 8381
165 Ga0496109_0111686 3300048912 Bacteria 2541
166 Ga0496109_0267100 3300048912 Bacteria 1612
167 Ga0496109_0357339 3300048912 Bacteria 1380
168 Ga0496109_0412486 3300048912 Bacteria 1276
169 Ga0496109_0465405 3300048912 Bacteria 1194
170 Ga0496110_0020102 3300048913 Bacteria 5633
171 Ga0496110_0058585 3300048913 Bacteria 3392
172 Ga0496110_0233547 3300048913 Bacteria 1673
173 Ga0496110_0372379 3300048913 Bacteria 1301
174 Ga0496111_0063685 3300048914 Bacteria 2674
175 Ga0496111_0116609 3300048914 Bacteria 1969
176 Ga0496111_0304178 3300048914 Bacteria 1182
177 Ga0496112_0012230 3300048915 Bacteria 7879
178 Ga0496112_0090683 3300048915 Bacteria 3025
179 Ga0496112_0255759 3300048915 Bacteria 1702
180 Ga0496112_0378831 3300048915 Bacteria 1356
181 Ga0496113_0029167 3300048916 Bacteria 3980
182 Ga0496113_0282399 3300048916 Bacteria 1328
183 Ga0496113_0600424 3300048916 Bacteria 881
184 Ga0496114_0002654 3300048917 Bacteria 13645
185 Ga0496114_0083728 3300048917 Bacteria 2699
186 Ga0496114_0236812 3300048917 Bacteria 1604
187 Ga0496114_0277419 3300048917 Bacteria 1477
188 Ga0496114_0352610 3300048917 Bacteria 1301
189 Ga0496115_0031146 3300048918 Bacteria 4200
190 Ga0496119_0002064 3300048922 Bacteria 22724
191 Ga0496121_0073525 3300048924 Bacteria 2739
192 Ga0496122_0012004 3300048925 Bacteria 8687
193 Ga0496122_0276635 3300048925 Bacteria 921
194 Ga0496123_0001045 3300048926 Bacteria 41909
195 Ga0496124_0488787 3300048927 Bacteria 829
196 Ga0496126_0032258 3300048929 Bacteria 4936
197 Ga0501034_0268122 3300049571 Bacteria 1649
198 Ga0501043_0138986 3300049579 Bacteria 1903
199 Ga0501046_0044813 3300049580 Bacteria 3517
200 Ga0501047_0047816 3300049581 Bacteria 4133
201 Ga0501047_0273557 3300049581 Bacteria 1535
202 Ga0501067_0078042 3300049583 Bacteria 1835
203 Ga0501070_0012951 3300049586 Bacteria 7029
204 Ga0501070_0030622 3300049586 Bacteria 4509
205 Ga0501074_0077492 3300049590 Bacteria 2385
206 Ga0501198_049532 3300049649 Bacteria 746
207 Ga0501080_0084973 3300049742 Bacteria 2940
208 Ga0501083_0007534 3300049744 Bacteria 7713
209 Ga0501035_0114115 3300049822 Bacteria 2366
210 nmdc:mga00v17_275398_c1 3300050491 Bacteria 1092
211 nmdc:mga0yw44_74705_c1 3300050492 Bacteria 2112
212 nmdc:mga0k408_111856_c1 3300050493 Bacteria 1614
213 nmdc:mga06z11_102375_c1 3300050494 Bacteria 1573
214 nmdc:mga05p37_21589_c1 3300050507 Bacteria 7800
215 nmdc:mga05p37_23476_c1 3300050507 Bacteria 7484
216 nmdc:mga05p37_740_c1 3300050507 Bacteria 36197
217 nmdc:mga0qj67_76333_c1 3300050509 Bacteria 2680
218 nmdc:mga06r32_32273_c1 3300050510 Bacteria 4926
219 nmdc:mga06r32_39080_c1 3300050510 Bacteria 4501
220 nmdc:mga08y16_1965_c1 3300050511 Bacteria 20967
221 nmdc:mga08y16_2688_c1 3300050511 Bacteria 18261
222 nmdc:mga0n895_38985_c1 3300050512 Bacteria 4607
223 nmdc:mga0n895_58397_c1 3300050512 Bacteria 3804
224 nmdc:mga0rr50_116043_c1 3300050513 Bacteria 2125
225 nmdc:mga0rr50_3569_c1 3300050513 Bacteria 8987
226 nmdc:mga08x19_29564_c1 3300050514 Bacteria 3437
227 nmdc:mga0a205_2126_c1 3300050515 Bacteria 14512
228 nmdc:mga0a205_44405_c1 3300050515 Bacteria 4284
229 Ga0500573_0284492 3300053140 Bacteria 835
230 Ga0466962_0011740 3300061719 Bacteria 4218
231 Ga0466962_0256960 3300061719 Bacteria 859
232 2552112914 2551306166 Bacteria 9731570
233 2676476020 2675903058 Bacteria 6822861
234 2791912372 2791354901 Bacteria 8322202
235 2827630582 2827628540 Bacteria 6858585
236 8056066185 8056060235 Bacteria 7259403
237 Ga0436364_0141559
238 JGI25406J46586_10001219
239 Ga0070658_10285294
240 Ga0070668_100643453
241 Ga0070674_100189046
242 Ga0070673_100505025
243 Ga0070714_100004894
244 Ga0070714_100006311
245 Ga0070714_100182423
246 Ga0070713_100001609
247 Ga0070713_100060061
248 Ga0070700_100201295
249 Ga0068867_100085741
250 Ga0070706_100048376
251 Ga0070679_100039321
252 Ga0070684_100000799
253 Ga0070696_100001899
254 Ga0068857_100000561
255 Ga0068852_100533550
256 Ga0068862_100456175
257 Ga0081539_10000031
258 Ga0081539_10017696
259 Ga0070717_10025069
260 Ga0075365_10053267
261 Ga0075428_100000718
262 Ga0075428_100208625
263 Ga0075430_100042249
264 Ga0075431_100046357
265 Ga0075431_100513226
266 Ga0075433_10017487
267 Ga0075433_10018030
268 Ga0075434_100013894
269 Ga0075434_100078150
270 Ga0075429_100044288
271 Ga0075436_100044069
272 Ga0075435_100047674
273 Ga0075435_100206613
274 Ga0105251_10247256
275 Ga0105250_10155682
276 Ga0105240_10005139
277 Ga0105240_10332425
278 Ga0111539_10014872
279 Ga0105245_10079744
280 Ga0105245_10091094
281 Ga0114129_10034987
282 Ga0114129_10227756
283 Ga0114129_10510995
284 Ga0105248_10981261
285 Ga0105249_10095935
286 Ga0105239_10297701
287 Ga0157373_10061344
288 Ga0157369_10049097
289 Ga0157375_10221783
290 Ga0163163_10459512
291 Ga0163161_10064031
292 Ga0197907_10365196
293 Ga0206356_10082017
294 Ga0213876_10055706
295 Ga0207699_10093498
296 Ga0207684_10011413
297 Ga0207657_10534423
298 Ga0207687_10114161
299 Ga0207700_10015886
300 Ga0207700_10043121
301 Ga0207700_10087136
302 Ga0207664_10001019
303 Ga0207664_10001902
304 Ga0207664_10002144
305 Ga0207664_10019644
306 Ga0207679_10306422
307 Ga0207667_10100691
308 Ga0207651_10345143
309 Ga0207712_10068795
310 Ga0207668_10367344
311 Ga0207640_10332632
312 Ga0207708_10014478
313 Ga0207648_10101694
314 Ga0207674_10081145
315 Ga0207675_100123955
316 Ga0207675_100133175
317 Ga0207675_100439201
318 Ga0207428_10002158
319 Ga0207428_10069461
320 Ga0316179_1005631
321 Ga0307408_100121304
322 Ga0307508_10181514
323 Ga0307413_10141743
324 Ga0307409_100406916
325 Ga0307416_100162416
326 Ga0307416_100226201
327 Ga0307414_10178173
328 Ga0307415_100000015
329 Ga0395900_0045950
330 Ga0395898_0048066
331 Ga0395898_0287538
332 Ga0395905_0338662
333 Ga0436364_0714365
334 Ga0436364_1043459
335 Ga0395901_0182155
336 Ga0436365_0771022
337 Ga0436363_0346174
338 Ga0451789_0575608
339 Ga0451797_1563140
340 Ga0451843_1139464
341 Ga0451853_1457988
342 Ga0439448_0040353
343 Ga0439463_010321
344 Ga0439464_0079765
345 Ga0439440_0010351
346 Ga0466969_0067432
347 Ga0466965_0025323
348 Ga0466966_0056803
349 Ga0466966_0202357
350 Ga0466961_0011007
351 Ga0466961_0066923
352 Ga0466961_0093707
353 Ga0466961_0213979
354 Ga0466963_0143311
355 Ga0466963_0261042
356 Ga0466971_0028077
357 Ga0466971_0077923
358 Ga0466968_0019803
359 Ga0466968_0115877
360 Ga0466968_0171743
361 Ga0466970_0254612
362 Ga0466959_0016731
363 Ga0466959_0044615
364 Ga0466959_0219746
365 Ga0466958_0008411
366 Ga0466958_0054279
367 Ga0466958_0078290
368 Ga0466958_0206510
369 Ga0466967_0008293
370 Ga0495616_0130933
371 Ga0495630_0096719
372 Ga0496100_0009523
373 Ga0496100_0012380
374 Ga0496100_0068766
375 Ga0496101_0009860
376 Ga0496101_0042214
377 Ga0496101_0247076
378 Ga0496102_0052806
379 Ga0496102_0053169
380 Ga0496102_0528355
381 Ga0496103_0280517
382 Ga0496104_0010068
383 Ga0496104_0054118
384 Ga0496104_0357250
385 Ga0496105_0035067
386 Ga0496105_0067360
387 Ga0496105_0067720
388 Ga0496105_0082208
389 Ga0496105_0098402
390 Ga0496105_0138899
391 Ga0496106_0000253
392 Ga0496107_0002983
393 Ga0496107_0360033
394 Ga0496108_0005939
395 Ga0496108_0006181
396 Ga0496108_0230465
397 Ga0496108_0363327
398 Ga0496108_0395893
399 Ga0496109_0003963
400 Ga0496109_0009280
401 Ga0496109_0111686
402 Ga0496109_0267100
403 Ga0496109_0357339
404 Ga0496109_0412486
405 Ga0496109_0465405
406 Ga0496110_0020102
407 Ga0496110_0058585
408 Ga0496110_0233547
409 Ga0496110_0372379
410 Ga0496111_0063685
411 Ga0496111_0116609
412 Ga0496111_0304178
413 Ga0496112_0012230
414 Ga0496112_0090683
415 Ga0496112_0255759
416 Ga0496112_0378831
417 Ga0496113_0029167
418 Ga0496113_0282399
419 Ga0496113_0600424
420 Ga0496114_0002654
421 Ga0496114_0083728
422 Ga0496114_0236812
423 Ga0496114_0277419
424 Ga0496114_0352610
425 Ga0496115_0031146
426 Ga0496119_0002064
427 Ga0496121_0073525
428 Ga0496122_0012004
429 Ga0496122_0276635
430 Ga0496123_0001045
431 Ga0496124_0488787
432 Ga0496126_0032258
433 Ga0501034_0268122
434 Ga0501043_0138986
435 Ga0501046_0044813
436 Ga0501047_0047816
437 Ga0501047_0273557
438 Ga0501067_0078042
439 Ga0501070_0012951
440 Ga0501070_0030622
441 Ga0501074_0077492
442 Ga0501198_049532
443 Ga0501080_0084973
444 Ga0501083_0007534
445 Ga0501035_0114115
446 nmdc:mga00v17_275398_c1
447 nmdc:mga0yw44_74705_c1
448 nmdc:mga0k408_111856_c1
449 nmdc:mga06z11_102375_c1
450 nmdc:mga05p37_21589_c1
451 nmdc:mga05p37_23476_c1
452 nmdc:mga05p37_740_c1
453 nmdc:mga0qj67_76333_c1
454 nmdc:mga06r32_32273_c1
455 nmdc:mga06r32_39080_c1
456 nmdc:mga08y16_1965_c1
457 nmdc:mga08y16_2688_c1
458 nmdc:mga0n895_38985_c1
459 nmdc:mga0n895_58397_c1
460 nmdc:mga0rr50_116043_c1
461 nmdc:mga0rr50_3569_c1
462 nmdc:mga08x19_29564_c1
463 nmdc:mga0a205_2126_c1
464 nmdc:mga0a205_44405_c1
465 Ga0500573_0284492
466 Ga0466962_0011740
467 Ga0466962_0256960
468 2552112914
469 2676476020
470 2791912372
471 2827630582
472 8056066185

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

3

113

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

145

217

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9552 2 116
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9526 2 116
3w9s-assembly1.cif.gz_B crystal structure analysis of the n-terminal receiver domain of response regulator pmra 0.949 2 115
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9485 2 112
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9482 2 119
ID Description Score Start End Superfamily
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9674 2 80 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9632 2 115 3.40.50.2300
af_P14375_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9622 2 112 3.40.50.2300
3dzdB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9529 2 112 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9492 2 77 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2H6F9D1-F1-model_v4 Transcriptional regulatory protein ZraR 0.9728 2 115 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-E1R266-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9627 2 118 GO:0000160
GO:0016301
AF-A0A1V5JWS4-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9623 2 112 GO:0000155
GO:0005524
GO:0006355
AF-A0A251W874-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9615 2 112 GO:0000155
AF-A0A831JKG9-F1-model_v4 deleted 0.9593 2 113

Map