F349237

General Info

Members Datasets Scaffolds Average Seq Length
236 83 234 87

Family's Representative Sequence

Representative Sequence 3300032168|Ga0316593_10130678|Ga0316593_101306783
Length 94
Sequence MSDENNSAETTASNRTLAGRVISNAMDKTITVLIERRVQHPLYGKFIRRTTKIHAHDADNACGRGDLVTVEQCRPLSKTKSWRLIEIVEKARLA

Samples

Sample ID Description Type Environment
1 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
2 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
44 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
45 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
46 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
47 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
48 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
49 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
50 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
51 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
58 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
59 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
60 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
61 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
62 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
63 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
64 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
65 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
66 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
67 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
68 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
69 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
70 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
71 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
75 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
76 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
77 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
78 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
79 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
80 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
81 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
82 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
83 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 65.25
Metatranscriptomes 33.9
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 0.42
Rhizosphere 88.56
Stem 0
Stem Tuber 0
Unclassified 10.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10175884 3300005295 Bacteria 1451
2 Ga0070676_10747938 3300005328 Bacteria 717
3 Ga0070670_100287219 3300005331 Bacteria 1437
4 Ga0068868_100564894 3300005338 Bacteria 1004
5 Ga0070689_101214173 3300005340 Bacteria 677
6 Ga0070675_101302212 3300005354 Bacteria 669
7 Ga0070674_100990442 3300005356 Bacteria 737
8 Ga0070673_101652293 3300005364 Bacteria 606
9 Ga0070667_100513791 3300005367 Bacteria 1099
10 Ga0070705_101419357 3300005440 Bacteria 579
11 Ga0070663_100704860 3300005455 Bacteria 858
12 Ga0068867_100287201 3300005459 Bacteria 1351
13 Ga0070672_101176248 3300005543 Bacteria 683
14 Ga0070665_100598287 3300005548 Bacteria 1116
15 Ga0068857_101002556 3300005577 Bacteria 804
16 Ga0068859_100406184 3300005617 Bacteria 1458
17 Ga0068864_100419719 3300005618 Bacteria 1275
18 Ga0068863_100036803 3300005841 Bacteria 4661
19 Ga0068860_100406402 3300005843 Bacteria 1348
20 Ga0068862_100038406 3300005844 Bacteria 4060
21 Ga0075370_10456389 3300006353 Bacteria 769
22 Ga0097620_100406189 3300006931 Bacteria 1458
23 Ga0105248_10182010 3300009177 Bacteria 2368
24 Ga0105249_10478945 3300009553 Bacteria 1287
25 Ga0105239_12330566 3300010375 Bacteria 623
26 Ga0105246_11624561 3300011119 Bacteria 612
27 Ga0163162_10962972 3300013306 Bacteria 964
28 Ga0163163_10074299 3300014325 Bacteria 3391
29 Ga0157380_11414454 3300014326 Bacteria 746
30 Ga0157379_10635942 3300014968 Bacteria 998
31 Ga0207650_10846496 3300025925 Bacteria 776
32 Ga0207691_10994625 3300025940 Bacteria 700
33 Ga0207711_10950589 3300025941 Bacteria 798
34 Ga0207658_10447421 3300025986 Bacteria 1143
35 Ga0207641_10745529 3300026088 Bacteria 966
36 Ga0207648_10235994 3300026089 Bacteria 1627
37 Ga0207676_10128448 3300026095 Bacteria 2151
38 Ga0207674_10384869 3300026116 Bacteria 1356
39 Ga0268266_10461343 3300028379 Bacteria 1209
40 Ga0268264_10212458 3300028381 Bacteria 1777
41 Ga0316575_10017921 3300031665 Bacteria 2695
42 Ga0316575_10019855 3300031665 Bacteria 2573
43 Ga0316575_10229835 3300031665 Bacteria 775
44 Ga0316575_10235919 3300031665 Bacteria 765
45 Ga0316575_10312205 3300031665 Bacteria 666
46 Ga0316579_10001358 3300031691 Bacteria 8860
47 Ga0316579_10003462 3300031691 Bacteria 6155
48 Ga0316579_10053887 3300031691 Bacteria 1885
49 Ga0316579_10069834 3300031691 Bacteria 1662
50 Ga0316579_10132227 3300031691 Bacteria 1202
51 Ga0316579_10291690 3300031691 Bacteria 788
52 Ga0316576_10008136 3300031727 Bacteria 6658
53 Ga0316576_10042328 3300031727 Bacteria 3282
54 Ga0316576_10137292 3300031727 Bacteria 1840
55 Ga0316576_10138081 3300031727 Bacteria 1834
56 Ga0316576_10171769 3300031727 Bacteria 1636
57 Ga0316576_10191299 3300031727 Bacteria 1542
58 Ga0316576_10237845 3300031727 Bacteria 1368
59 Ga0316576_10294040 3300031727 Bacteria 1214
60 Ga0316576_11058407 3300031727 Bacteria 576
61 Ga0316576_11280644 3300031727 Bacteria 516
62 Ga0316578_10030344 3300031728 Bacteria 3072
63 Ga0316578_10062841 3300031728 Bacteria 2189
64 Ga0316578_10095665 3300031728 Bacteria 1777
65 Ga0316578_10139542 3300031728 Bacteria 1460
66 Ga0316578_10315186 3300031728 Bacteria 934
67 Ga0316578_10364728 3300031728 Bacteria 859
68 Ga0316578_10415772 3300031728 Bacteria 796
69 Ga0316578_10737737 3300031728 Bacteria 572
70 Ga0316578_10831442 3300031728 Bacteria 534
71 Ga0316577_10018529 3300031733 Bacteria 3851
72 Ga0316577_10024307 3300031733 Bacteria 3367
73 Ga0316577_10029780 3300031733 Bacteria 3046
74 Ga0316577_10134032 3300031733 Bacteria 1394
75 Ga0316577_10231956 3300031733 Bacteria 1043
76 Ga0316577_10589293 3300031733 Bacteria 632
77 Ga0316583_10027858 3300032133 Bacteria 2016
78 Ga0316585_10050321 3300032137 Bacteria 1337
79 Ga0316585_10054848 3300032137 Bacteria 1282
80 Ga0316585_10092229 3300032137 Bacteria 990
81 Ga0316580_10005312 3300032139 Bacteria 3754
82 Ga0316580_10027194 3300032139 Bacteria 1768
83 Ga0316580_10082920 3300032139 Bacteria 980
84 Ga0316593_10000085 3300032168 Bacteria 11586
85 Ga0316593_10000096 3300032168 Bacteria 11298
86 Ga0316593_10000198 3300032168 Bacteria 9333
87 Ga0316593_10001014 3300032168 Bacteria 5811
88 Ga0316593_10001228 3300032168 Bacteria 5525
89 Ga0316593_10001676 3300032168 Bacteria 4993
90 Ga0316593_10003175 3300032168 Bacteria 4037
91 Ga0316593_10004311 3300032168 Bacteria 3640
92 Ga0316593_10010076 3300032168 Bacteria 2696
93 Ga0316593_10011448 3300032168 Bacteria 2577
94 Ga0316593_10017978 3300032168 Bacteria 2165
95 Ga0316593_10018608 3300032168 Bacteria 2137
96 Ga0316593_10018739 3300032168 Bacteria 2131
97 Ga0316593_10028888 3300032168 Bacteria 1790
98 Ga0316593_10045957 3300032168 Bacteria 1464
99 Ga0316593_10049573 3300032168 Bacteria 1416
100 Ga0316593_10059468 3300032168 Bacteria 1305
101 Ga0316593_10062108 3300032168 Bacteria 1279
102 Ga0316593_10083787 3300032168 Bacteria 1116
103 Ga0316593_10118202 3300032168 Bacteria 950
104 Ga0316593_10121995 3300032168 Bacteria 936
105 Ga0316593_10130678 3300032168 Bacteria 906
106 Ga0316593_10130931 3300032168 Bacteria 905
107 Ga0316593_10142000 3300032168 Bacteria 870
108 Ga0316593_10166091 3300032168 Bacteria 808
109 Ga0316593_10169884 3300032168 Bacteria 799
110 Ga0316593_10177224 3300032168 Bacteria 783
111 Ga0316593_10188515 3300032168 Bacteria 760
112 Ga0316593_10223588 3300032168 Bacteria 700
113 Ga0316593_10229208 3300032168 Bacteria 691
114 Ga0316593_10374929 3300032168 Bacteria 547
115 Ga0316593_10405143 3300032168 Bacteria 528
116 Ga0316592_1000411 3300033524 Bacteria 5776
117 Ga0316592_1001541 3300033524 Bacteria 3743
118 Ga0316592_1001949 3300033524 Bacteria 3479
119 Ga0316592_1004425 3300033524 Bacteria 2611
120 Ga0316592_1005735 3300033524 Bacteria 2368
121 Ga0316592_1007247 3300033524 Bacteria 2162
122 Ga0316592_1016030 3300033524 Bacteria 1563
123 Ga0316592_1019696 3300033524 Bacteria 1429
124 Ga0316592_1021563 3300033524 Bacteria 1373
125 Ga0316592_1029450 3300033524 Bacteria 1191
126 Ga0316592_1050961 3300033524 Bacteria 924
127 Ga0316592_1084078 3300033524 Bacteria 725
128 Ga0316592_1120603 3300033524 Bacteria 609
129 Ga0316592_1163665 3300033524 Bacteria 528
130 Ga0316592_1169489 3300033524 Bacteria 520
131 Ga0316586_1000436 3300033527 Bacteria 4029
132 Ga0316586_1000854 3300033527 Bacteria 3198
133 Ga0316586_1028705 3300033527 Bacteria 946
134 Ga0316586_1042957 3300033527 Bacteria 798
135 Ga0316586_1048713 3300033527 Bacteria 756
136 Ga0316586_1055679 3300033527 Bacteria 713
137 Ga0316586_1065711 3300033527 Bacteria 664
138 Ga0316586_1100006 3300033527 Bacteria 554
139 Ga0316588_1004114 3300033528 Bacteria 2724
140 Ga0316588_1005516 3300033528 Bacteria 2468
141 Ga0316588_1005517 3300033528 Bacteria 2468
142 Ga0316588_1021426 3300033528 Bacteria 1471
143 Ga0316588_1067055 3300033528 Bacteria 879
144 Ga0316588_1074501 3300033528 Bacteria 836
145 Ga0316587_1000717 3300033529 Bacteria 3603
146 Ga0316587_1004944 3300033529 Bacteria 1969
147 Ga0316587_1012260 3300033529 Bacteria 1392
148 Ga0316587_1028604 3300033529 Bacteria 978
149 Ga0316596_1000644 3300033541 Bacteria 6242
150 Ga0316596_1000651 3300033541 Bacteria 6226
151 Ga0316596_1001024 3300033541 Bacteria 5392
152 Ga0316596_1009417 3300033541 Bacteria 2344
153 Ga0316596_1011220 3300033541 Bacteria 2184
154 Ga0316596_1028832 3300033541 Bacteria 1435
155 Ga0316596_1029629 3300033541 Bacteria 1417
156 Ga0316596_1031776 3300033541 Bacteria 1372
157 Ga0316596_1039156 3300033541 Bacteria 1243
158 Ga0316596_1054005 3300033541 Bacteria 1066
159 Ga0316596_1074889 3300033541 Bacteria 907
160 Ga0316596_1117278 3300033541 Bacteria 724
161 Ga0316596_1122057 3300033541 Bacteria 709
162 Ga0316596_1186585 3300033541 Bacteria 575
163 Ga0316596_1239414 3300033541 Bacteria 510
164 Ga0373939_0511219 3300035114 Bacteria 514
165 Ga0316574_0001677 3300035398 Bacteria 10684
166 Ga0316574_0004866 3300035398 Bacteria 7113
167 Ga0316574_0005612 3300035398 Bacteria 6707
168 Ga0316574_0010022 3300035398 Bacteria 5331
169 Ga0316574_0070322 3300035398 Bacteria 2210
170 Ga0316574_0084550 3300035398 Bacteria 2018
171 Ga0316574_0121459 3300035398 Bacteria 1678
172 Ga0316574_0148252 3300035398 Bacteria 1512
173 Ga0316574_0286779 3300035398 Bacteria 1048
174 Ga0316574_0504003 3300035398 Bacteria 754
175 Ga0316574_0534219 3300035398 Bacteria 729
176 Ga0316574_0625726 3300035398 Bacteria 664
177 Ga0316574_0754034 3300035398 Bacteria 594
178 Ga0316574_0971159 3300035398 Bacteria 512
179 Ga0316574_1003765 3300035398 Bacteria 502
180 Ga0316582_0001466 3300036647 Bacteria 10378
181 Ga0316582_0013137 3300036647 Bacteria 4650
182 Ga0316582_0024855 3300036647 Bacteria 3590
183 Ga0316582_0025002 3300036647 Bacteria 3580
184 Ga0316582_0092551 3300036647 Bacteria 1992
185 Ga0316582_0099996 3300036647 Bacteria 1920
186 Ga0316582_0201621 3300036647 Bacteria 1357
187 Ga0316582_0265003 3300036647 Bacteria 1178
188 Ga0316584_0015064 3300036712 Bacteria 5524
189 Ga0316584_0018774 3300036712 Bacteria 4991
190 Ga0316584_0043243 3300036712 Bacteria 3359
191 Ga0316584_0257381 3300036712 Bacteria 1273
192 Ga0316584_0270700 3300036712 Bacteria 1236
193 Ga0316584_0693677 3300036712 Bacteria 698
194 Ga0316581_0001826 3300037588 Bacteria 4942
195 Ga0400484_03424 3300038725 Bacteria 3161
196 Ga0400484_26615 3300038725 Bacteria 15410
197 Ga0400490_11910 3300038726 Bacteria 15668
198 Ga0400490_36436 3300038726 Bacteria 1207
199 Ga0400490_56705 3300038726 Bacteria 2139
200 Ga0400491_23514 3300038727 Bacteria 1725
201 Ga0400485_04211 3300038735 Bacteria 4399
202 Ga0400485_19181 3300038735 Bacteria 55141
203 Ga0400488_19341 3300038741 Bacteria 2470
204 Ga0400488_27230 3300038741 Bacteria 2642
205 Ga0400486_07075 3300038742 Bacteria 1820
206 Ga0400486_25543 3300038742 Bacteria 57720
207 Ga0400483_013695 3300039062 Bacteria 2690
208 Ga0400483_035353 3300039062 Bacteria 8181
209 Ga0400483_073836 3300039062 Bacteria 21552
210 Ga0400483_129525 3300039062 Bacteria 1208
211 Ga0400483_205660 3300039062 Bacteria 9867
212 Ga0400483_207547 3300039062 Bacteria 4051
213 Ga0400483_216854 3300039062 Bacteria 5440
214 Ga0400483_250256 3300039062 Bacteria 3733
215 Ga0400483_259833 3300039062 Bacteria 1571
216 Ga0400489_29250 3300039093 Bacteria 1610
217 Ga0400489_81426 3300039093 Bacteria 2213
218 Ga0400487_02246 3300039110 Bacteria 22294
219 Ga0400487_11286 3300039110 Bacteria 1131
220 Ga0451802_1035314 3300041460 Bacteria 616
221 Ga0453684_2536953 3300044712 Bacteria 505
222 Ga0495629_0320054 3300046459 Bacteria 1060
223 Ga0495629_0667592 3300046459 Bacteria 692
224 Ga0495582_0848069 3300046473 Bacteria 528
225 Ga0495639_0598842 3300046475 Bacteria 567
226 Ga0495594_0277548 3300046499 Bacteria 955
227 Ga0495666_0499142 3300046526 Bacteria 544
228 Ga0495640_0255111 3300046533 Bacteria 1097
229 Ga0495667_0550369 3300046559 Bacteria 721
230 Ga0495613_0087320 3300046689 Bacteria 2261
231 Ga0495676_0113110 3300047321 Bacteria 1988
232 Ga0495680_0165982 3300047322 Bacteria 1601
233 Ga0495680_0729531 3300047322 Bacteria 652
234 Ga0501264_030592 3300049761 Bacteria 617

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2648501241 2649122834 80
2 iso_pu_bacteria 2651869818 2652975766 80
3 3300032168 Ga0316593_10059468 Ga0316593_100594683 84
4 3300033528 Ga0316588_1004114 Ga0316588_10041147 84
5 3300039093 Ga0400489_29250 Ga0400489_29250_1064_1318 84
6 3300031665 Ga0316575_10229835 Ga0316575_102298352 85
7 3300031691 Ga0316579_10001358 Ga0316579_100013589 85
8 3300031691 Ga0316579_10069834 Ga0316579_100698344 85
9 3300031727 Ga0316576_10191299 Ga0316576_101912991 85
10 3300031727 Ga0316576_10294040 Ga0316576_102940401 85
11 3300031728 Ga0316578_10095665 Ga0316578_100956654 85
12 3300031728 Ga0316578_10139542 Ga0316578_101395423 85
13 3300031728 Ga0316578_10831442 Ga0316578_108314421 85
14 3300031733 Ga0316577_10018529 Ga0316577_100185294 85
15 3300031733 Ga0316577_10231956 Ga0316577_102319562 85
16 3300032133 Ga0316583_10027858 Ga0316583_100278585 85
17 3300032137 Ga0316585_10050321 Ga0316585_100503213 85
18 3300032137 Ga0316585_10092229 Ga0316585_100922292 85
19 3300032139 Ga0316580_10027194 Ga0316580_100271944 85
20 3300032168 Ga0316593_10001014 Ga0316593_100010147 85
21 3300032168 Ga0316593_10004311 Ga0316593_100043117 85
22 3300032168 Ga0316593_10011448 Ga0316593_100114485 85
23 3300032168 Ga0316593_10118202 Ga0316593_101182022 85
24 3300032168 Ga0316593_10169884 Ga0316593_101698843 85
25 3300032168 Ga0316593_10374929 Ga0316593_103749292 85
26 3300033524 Ga0316592_1007247 Ga0316592_10072475 85
27 3300033524 Ga0316592_1050961 Ga0316592_10509613 85
28 3300033527 Ga0316586_1028705 Ga0316586_10287053 85
29 3300033528 Ga0316588_1005516 Ga0316588_10055166 85
30 3300033528 Ga0316588_1005517 Ga0316588_10055176 85
31 3300033529 Ga0316587_1000717 Ga0316587_10007173 85
32 3300033529 Ga0316587_1004944 Ga0316587_10049444 85
33 3300033541 Ga0316596_1000651 Ga0316596_10006519 85
34 3300033541 Ga0316596_1031776 Ga0316596_10317762 85
35 3300033541 Ga0316596_1054005 Ga0316596_10540053 85
36 3300033541 Ga0316596_1239414 Ga0316596_12394141 85
37 3300035398 Ga0316574_0504003 Ga0316574_0504003_217_474 85
38 3300035398 Ga0316574_0754034 Ga0316574_0754034_142_399 85
39 3300035398 Ga0316574_1003765 Ga0316574_1003765_94_351 85
40 3300036647 Ga0316582_0001466 Ga0316582_0001466_4985_5245 85
41 3300036647 Ga0316582_0092551 Ga0316582_0092551_1431_1688 85
42 3300036712 Ga0316584_0015064 Ga0316584_0015064_2107_2367 85
43 3300036712 Ga0316584_0257381 Ga0316584_0257381_214_471 85
44 3300036712 Ga0316584_0693677 Ga0316584_0693677_228_485 85
45 3300031665 Ga0316575_10017921 Ga0316575_100179215 86
46 3300031665 Ga0316575_10235919 Ga0316575_102359193 86
47 3300031665 Ga0316575_10312205 Ga0316575_103122052 86
48 3300031691 Ga0316579_10003462 Ga0316579_100034623 86
49 3300031691 Ga0316579_10053887 Ga0316579_100538874 86
50 3300031727 Ga0316576_10008136 Ga0316576_100081364 86
51 3300031727 Ga0316576_10042328 Ga0316576_100423282 86
52 3300031727 Ga0316576_10138081 Ga0316576_101380814 86
53 3300031727 Ga0316576_10171769 Ga0316576_101717693 86
54 3300031727 Ga0316576_10237845 Ga0316576_102378453 86
55 3300031727 Ga0316576_11058407 Ga0316576_110584072 86
56 3300031727 Ga0316576_11280644 Ga0316576_112806441 86
57 3300031728 Ga0316578_10030344 Ga0316578_100303447 86
58 3300031728 Ga0316578_10315186 Ga0316578_103151863 86
59 3300031728 Ga0316578_10364728 Ga0316578_103647282 86
60 3300031728 Ga0316578_10415772 Ga0316578_104157723 86
61 3300031728 Ga0316578_10737737 Ga0316578_107377372 86
62 3300031733 Ga0316577_10024307 Ga0316577_100243077 86
63 3300031733 Ga0316577_10589293 Ga0316577_105892932 86
64 3300032139 Ga0316580_10082920 Ga0316580_100829203 86
65 3300032168 Ga0316593_10000085 Ga0316593_1000008512 86
66 3300032168 Ga0316593_10000096 Ga0316593_1000009612 86
67 3300032168 Ga0316593_10001228 Ga0316593_1000122811 86
68 3300032168 Ga0316593_10001676 Ga0316593_100016764 86
69 3300032168 Ga0316593_10010076 Ga0316593_100100762 86
70 3300032168 Ga0316593_10017978 Ga0316593_100179784 86
71 3300032168 Ga0316593_10018608 Ga0316593_100186084 86
72 3300032168 Ga0316593_10045957 Ga0316593_100459574 86
73 3300032168 Ga0316593_10083787 Ga0316593_100837873 86
74 3300032168 Ga0316593_10121995 Ga0316593_101219953 86
75 3300032168 Ga0316593_10130931 Ga0316593_101309312 86
76 3300032168 Ga0316593_10142000 Ga0316593_101420003 86
77 3300032168 Ga0316593_10166091 Ga0316593_101660913 86
78 3300032168 Ga0316593_10177224 Ga0316593_101772241 86
79 3300032168 Ga0316593_10188515 Ga0316593_101885153 86
80 3300032168 Ga0316593_10223588 Ga0316593_102235882 86
81 3300032168 Ga0316593_10229208 Ga0316593_102292082 86
82 3300032168 Ga0316593_10405143 Ga0316593_104051432 86
83 3300033524 Ga0316592_1004425 Ga0316592_10044252 86
84 3300033524 Ga0316592_1005735 Ga0316592_10057353 86
85 3300033524 Ga0316592_1016030 Ga0316592_10160302 86
86 3300033524 Ga0316592_1019696 Ga0316592_10196962 86
87 3300033524 Ga0316592_1021563 Ga0316592_10215632 86
88 3300033524 Ga0316592_1084078 Ga0316592_10840783 86
89 3300033524 Ga0316592_1120603 Ga0316592_11206032 86
90 3300033524 Ga0316592_1163665 Ga0316592_11636651 86
91 3300033524 Ga0316592_1169489 Ga0316592_11694891 86
92 3300033527 Ga0316586_1000436 Ga0316586_10004367 86
93 3300033527 Ga0316586_1000854 Ga0316586_10008543 86
94 3300033527 Ga0316586_1042957 Ga0316586_10429571 86
95 3300033527 Ga0316586_1048713 Ga0316586_10487133 86
96 3300033527 Ga0316586_1065711 Ga0316586_10657112 86
97 3300033527 Ga0316586_1100006 Ga0316586_11000062 86
98 3300033528 Ga0316588_1067055 Ga0316588_10670553 86
99 3300033528 Ga0316588_1074501 Ga0316588_10745012 86
100 3300033529 Ga0316587_1012260 Ga0316587_10122604 86
101 3300033541 Ga0316596_1009417 Ga0316596_10094173 86
102 3300033541 Ga0316596_1011220 Ga0316596_10112202 86
103 3300033541 Ga0316596_1028832 Ga0316596_10288324 86
104 3300033541 Ga0316596_1029629 Ga0316596_10296293 86
105 3300033541 Ga0316596_1074889 Ga0316596_10748891 86
106 3300033541 Ga0316596_1117278 Ga0316596_11172783 86
107 3300035398 Ga0316574_0001677 Ga0316574_0001677_8622_8882 86
108 3300035398 Ga0316574_0004866 Ga0316574_0004866_4800_5060 86
109 3300035398 Ga0316574_0005612 Ga0316574_0005612_1184_1444 86
110 3300035398 Ga0316574_0010022 Ga0316574_0010022_4289_4549 86
111 3300035398 Ga0316574_0070322 Ga0316574_0070322_1904_2164 86
112 3300035398 Ga0316574_0121459 Ga0316574_0121459_389_649 86
113 3300035398 Ga0316574_0148252 Ga0316574_0148252_541_801 86
114 3300035398 Ga0316574_0286779 Ga0316574_0286779_417_677 86
115 3300035398 Ga0316574_0534219 Ga0316574_0534219_203_463 86
116 3300035398 Ga0316574_0625726 Ga0316574_0625726_154_414 86
117 3300035398 Ga0316574_0971159 Ga0316574_0971159_193_456 86
118 3300036647 Ga0316582_0024855 Ga0316582_0024855_3119_3379 86
119 3300036647 Ga0316582_0099996 Ga0316582_0099996_763_1023 86
120 3300036647 Ga0316582_0265003 Ga0316582_0265003_564_824 86
121 3300036712 Ga0316584_0018774 Ga0316584_0018774_2292_2552 86
122 3300036712 Ga0316584_0270700 Ga0316584_0270700_700_960 86
123 3300038725 Ga0400484_03424 Ga0400484_03424_2106_2366 86
124 3300038725 Ga0400484_26615 Ga0400484_26615_10076_10336 86
125 3300038726 Ga0400490_11910 Ga0400490_11910_14162_14422 86
126 3300038726 Ga0400490_36436 Ga0400490_36436_132_392 86
127 3300038726 Ga0400490_56705 Ga0400490_56705_584_844 86
128 3300038727 Ga0400491_23514 Ga0400491_23514_365_625 86
129 3300038735 Ga0400485_04211 Ga0400485_04211_4019_4279 86
130 3300038735 Ga0400485_19181 Ga0400485_19181_50032_50292 86
131 3300038741 Ga0400488_19341 Ga0400488_19341_195_455 86
132 3300038741 Ga0400488_27230 Ga0400488_27230_318_578 86
133 3300038742 Ga0400486_07075 Ga0400486_07075_803_1063 86
134 3300038742 Ga0400486_25543 Ga0400486_25543_52611_52871 86
135 3300039062 Ga0400483_013695 Ga0400483_013695_1771_2031 86
136 3300039062 Ga0400483_035353 Ga0400483_035353_1991_2251 86
137 3300039062 Ga0400483_073836 Ga0400483_073836_3125_3385 86
138 3300039062 Ga0400483_129525 Ga0400483_129525_314_574 86
139 3300039062 Ga0400483_205660 Ga0400483_205660_4825_5085 86
140 3300039062 Ga0400483_207547 Ga0400483_207547_3518_3778 86
141 3300039062 Ga0400483_216854 Ga0400483_216854_2487_2747 86
142 3300039062 Ga0400483_250256 Ga0400483_250256_1084_1344 86
143 3300039062 Ga0400483_259833 Ga0400483_259833_948_1208 86
144 3300039093 Ga0400489_81426 Ga0400489_81426_225_485 86
145 3300039110 Ga0400487_02246 Ga0400487_02246_21473_21733 86
146 3300039110 Ga0400487_11286 Ga0400487_11286_27_287 86
147 3300031691 Ga0316579_10291690 Ga0316579_102916902 87
148 3300031733 Ga0316577_10029780 Ga0316577_100297802 87
149 3300032137 Ga0316585_10054848 Ga0316585_100548482 87
150 3300032168 Ga0316593_10028888 Ga0316593_100288882 87
151 3300032168 Ga0316593_10049573 Ga0316593_100495734 87
152 3300033524 Ga0316592_1001541 Ga0316592_10015419 87
153 3300033524 Ga0316592_1029450 Ga0316592_10294502 87
154 3300033527 Ga0316586_1055679 Ga0316586_10556793 87
155 3300033528 Ga0316588_1021426 Ga0316588_10214263 87
156 3300033541 Ga0316596_1001024 Ga0316596_10010244 87
157 3300033541 Ga0316596_1186585 Ga0316596_11865852 87
158 3300036647 Ga0316582_0013137 Ga0316582_0013137_3454_3717 87
159 3300036712 Ga0316584_0043243 Ga0316584_0043243_2491_2754 87
160 3300041460 Ga0451802_1035314 Ga0451802_1035314_152_415 87
161 3300044712 Ga0453684_2536953 Ga0453684_2536953_184_447 87
162 3300006353 Ga0075370_10456389 Ga0075370_104563893 88
163 3300031665 Ga0316575_10019855 Ga0316575_100198553 88
164 3300031691 Ga0316579_10132227 Ga0316579_101322272 88
165 3300031727 Ga0316576_10137292 Ga0316576_101372924 88
166 3300031728 Ga0316578_10062841 Ga0316578_100628414 88
167 3300031733 Ga0316577_10134032 Ga0316577_101340324 88
168 3300032139 Ga0316580_10005312 Ga0316580_100053129 88
169 3300032168 Ga0316593_10000198 Ga0316593_1000019811 88
170 3300032168 Ga0316593_10018739 Ga0316593_100187394 88
171 3300032168 Ga0316593_10062108 Ga0316593_100621083 88
172 3300033524 Ga0316592_1001949 Ga0316592_10019492 88
173 3300033529 Ga0316587_1028604 Ga0316587_10286043 88
174 3300033541 Ga0316596_1039156 Ga0316596_10391562 88
175 3300033541 Ga0316596_1122057 Ga0316596_11220573 88
176 3300035398 Ga0316574_0084550 Ga0316574_0084550_850_1116 88
177 3300036647 Ga0316582_0025002 Ga0316582_0025002_2161_2427 88
178 3300049761 Ga0501264_030592 Ga0501264_030592_252_521 89
179 3300005356 Ga0070674_100990442 Ga0070674_1009904422 90
180 3300005440 Ga0070705_101419357 Ga0070705_1014193571 90
181 3300009177 Ga0105248_10182010 Ga0105248_101820104 90
182 3300013306 Ga0163162_10962972 Ga0163162_109629722 90
183 3300025941 Ga0207711_10950589 Ga0207711_109505892 90
184 3300032168 Ga0316593_10130678 Ga0316593_101306783 90
185 3300046459 Ga0495629_0667592 Ga0495629_0667592_81_353 90
186 3300046473 Ga0495582_0848069 Ga0495582_0848069_21_293 90
187 3300046526 Ga0495666_0499142 Ga0495666_0499142_238_510 90
188 3300046689 Ga0495613_0087320 Ga0495613_0087320_1700_1972 90
189 3300047322 Ga0495680_0165982 Ga0495680_0165982_190_462 90
190 3300047322 Ga0495680_0729531 Ga0495680_0729531_361_633 90
191 3300014968 Ga0157379_10635942 Ga0157379_106359423 91
192 3300032168 Ga0316593_10003175 Ga0316593_100031758 91
193 3300033524 Ga0316592_1000411 Ga0316592_100041112 91
194 3300033541 Ga0316596_1000644 Ga0316596_10006444 91
195 3300036647 Ga0316582_0201621 Ga0316582_0201621_641_919 91
196 3300037588 Ga0316581_0001826 Ga0316581_0001826_4157_4435 91
197 3300005295 Ga0065707_10175884 Ga0065707_101758843 92
198 3300005328 Ga0070676_10747938 Ga0070676_107479382 92
199 3300005331 Ga0070670_100287219 Ga0070670_1002872191 92
200 3300005338 Ga0068868_100564894 Ga0068868_1005648941 92
201 3300005340 Ga0070689_101214173 Ga0070689_1012141732 92
202 3300005354 Ga0070675_101302212 Ga0070675_1013022122 92
203 3300005364 Ga0070673_101652293 Ga0070673_1016522931 92
204 3300005367 Ga0070667_100513791 Ga0070667_1005137912 92
205 3300005455 Ga0070663_100704860 Ga0070663_1007048602 92
206 3300005459 Ga0068867_100287201 Ga0068867_1002872012 92
207 3300005543 Ga0070672_101176248 Ga0070672_1011762481 92
208 3300005548 Ga0070665_100598287 Ga0070665_1005982872 92
209 3300005577 Ga0068857_101002556 Ga0068857_1010025562 92
210 3300005617 Ga0068859_100406184 Ga0068859_1004061844 92
211 3300005618 Ga0068864_100419719 Ga0068864_1004197194 92
212 3300005841 Ga0068863_100036803 Ga0068863_10003680311 92
213 3300005843 Ga0068860_100406402 Ga0068860_1004064023 92
214 3300005844 Ga0068862_100038406 Ga0068862_1000384069 92
215 3300006931 Ga0097620_100406189 Ga0097620_1004061892 92
216 3300009553 Ga0105249_10478945 Ga0105249_104789454 92
217 3300010375 Ga0105239_12330566 Ga0105239_123305662 92
218 3300011119 Ga0105246_11624561 Ga0105246_116245612 92
219 3300014325 Ga0163163_10074299 Ga0163163_100742994 92
220 3300014326 Ga0157380_11414454 Ga0157380_114144542 92
221 3300025925 Ga0207650_10846496 Ga0207650_108464962 92
222 3300025940 Ga0207691_10994625 Ga0207691_109946252 92
223 3300025986 Ga0207658_10447421 Ga0207658_104474214 92
224 3300026088 Ga0207641_10745529 Ga0207641_107455292 92
225 3300026089 Ga0207648_10235994 Ga0207648_102359942 92
226 3300026095 Ga0207676_10128448 Ga0207676_101284484 92
227 3300026116 Ga0207674_10384869 Ga0207674_103848692 92
228 3300028379 Ga0268266_10461343 Ga0268266_104613433 92
229 3300028381 Ga0268264_10212458 Ga0268264_102124584 92
230 3300035114 Ga0373939_0511219 Ga0373939_0511219_71_349 92
231 3300046459 Ga0495629_0320054 Ga0495629_0320054_751_1029 92
232 3300046475 Ga0495639_0598842 Ga0495639_0598842_81_359 92
233 3300046499 Ga0495594_0277548 Ga0495594_0277548_475_753 92
234 3300046533 Ga0495640_0255111 Ga0495640_0255111_808_1086 92
235 3300046559 Ga0495667_0550369 Ga0495667_0550369_35_313 92
236 3300047321 Ga0495676_0113110 Ga0495676_0113110_93_371 92

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00366

Ribosomal_S17

Ribosomal protein S17

19

86

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v8c-assembly1.cif.gz_CT crystal structure analysis of ribosomal decoding (near-cognate trna-leu complex with paromomycin). 0.9752 11 88
4v4w-assembly1.cif.gz_AQ structure of a secm-stalled e. coli ribosome complex obtained by fitting atomic models for rna and protein components into cryo-em map emd-1143 0.9739 12 89
6spc-assembly1.cif.gz_q pseudomonas aeruginosa 30s ribosome from an aminoglycoside resistant clinical isolate 0.9725 12 87
1i96-assembly1.cif.gz_Q crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain) 0.969 11 89
8fmw-assembly1.cif.gz_Q the structure of a hibernating ribosome in the lyme disease pathogen 0.9685 10 89
ID Description Score Start End Superfamily
af_C6T0V9_1_79_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9781 12 89 2.40.50.140
af_Q2FW15_6_86_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9728 10 89 2.40.50.140
af_Q03246_1_107_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9719 11 87 2.40.50.140
3ms0Q00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9711 11 86 2.40.50.140
5xyuQ00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9657 11 88 2.40.50.140
ID Description Score Start End GO Terms
AF-Q2JFG7-F1-model_v4 Small ribosomal subunit protein uS17 (30S ribosomal protein S17) 0.9936 11 89 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A2E7DDU0-F1-model_v4 Small ribosomal subunit protein uS17 0.9935 11 84 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A533YG11-F1-model_v4 Small ribosomal subunit protein uS17 0.9926 10 89 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A3C0FE03-F1-model_v4 Small ribosomal subunit protein uS17 0.9924 11 89 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A1L8D0I5-F1-model_v4 Small ribosomal subunit protein uS17 0.9913 11 91 GO:0003735
GO:0006412
GO:0019843
GO:0022627

Feature Viewer

pLDDT pTM Quality
83.62 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map