F349231

General Info

Members Datasets Scaffolds Average Seq Length
236 198 472 282

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100330194|Ga0307409_1003301941
Length 305
Sequence MSLVPTMAHGDHVASEDRVPEVIGGRRSGAARFFRRLPVRILILAVLVIEIYPLIWLVIGSFKTQSEFLNDPFWSLPSSLQWSNYSEAWTTGNIALYMRNSVVAVLPALAFTIIFGTAAGFALQVMVWKGRGFVLLLFLAGIMIPGQMILLPLFTIYFQIGLTGTLWPLIITYTASALPLTVFMMATYFRAVPRAVFEAAAIDGASVLRSFVSIGFPMVRNAVFTVALVQFFFMWNDLLVALTFTNSTDKRTIQVGLLNFTGEFGATQYGPLFAAICINVFLLLGIYLVLNKRIMTGLAGGAVKG

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
50 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
87 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
88 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
125 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
144 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
145 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
169 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
170 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 2517572101 Frankia sp. DC12 Isolate Nodule
174 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
175 2643221548 Streptomyces sp. Root55 Isolate Unclassified
176 2643221549 Agromyces sp. Root1464 Isolate Unclassified
177 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
178 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
179 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
180 2687453737 Frankia sp. BMG5.36 Isolate Nodule
181 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
182 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
183 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
184 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
185 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
186 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
187 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
188 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
189 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
190 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
191 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
192 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
193 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
194 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
195 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
196 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
197 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
198 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.98
Metatranscriptomes 0
Isolates 11.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.05
Nodule 0.85
Rhizoplane 9.75
Rhizosphere 70.76
Stem 0
Stem Tuber 0
Unclassified 1.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100330194 3300031995 Bacteria 1431
2 rootH1_10017399 3300003316 Bacteria 2264
3 rootH1_10009377 3300003323 Bacteria 10825
4 JGI25404J52841_10004358 3300003659 Bacteria 2862
5 Ga0065714_10094587 3300005288 Bacteria 1804
6 Ga0070658_10000261 3300005327 Bacteria 46322
7 Ga0070660_100233174 3300005339 Bacteria 1498
8 Ga0070668_100059387 3300005347 Bacteria 2960
9 Ga0070667_100357000 3300005367 Bacteria 1324
10 Ga0070709_10005655 3300005434 Bacteria 6773
11 Ga0070714_100115525 3300005435 Bacteria 2382
12 Ga0070713_100031810 3300005436 Bacteria 4207
13 Ga0070713_100362573 3300005436 Bacteria 1347
14 Ga0070700_100215317 3300005441 Bacteria 1358
15 Ga0070681_10288618 3300005458 Bacteria 1551
16 Ga0068867_100255152 3300005459 Bacteria 1427
17 Ga0070679_100035022 3300005530 Bacteria 4978
18 Ga0068853_100220151 3300005539 Bacteria 1733
19 Ga0070693_100155406 3300005547 Bacteria 1452
20 Ga0070665_100166460 3300005548 Bacteria 2207
21 Ga0068855_100004213 3300005563 Bacteria 17552
22 Ga0068854_100152607 3300005578 Bacteria 1782
23 Ga0068854_100159961 3300005578 Bacteria 1743
24 Ga0068852_100301810 3300005616 Bacteria 1550
25 Ga0068861_100187464 3300005719 Bacteria 1726
26 Ga0081540_1001917 3300005983 Bacteria 17426
27 Ga0070717_10194432 3300006028 Bacteria 1774
28 Ga0075365_10026153 3300006038 Bacteria 3702
29 Ga0075368_10008453 3300006042 Bacteria 3668
30 Ga0075363_100019596 3300006048 Bacteria 3383
31 Ga0075364_10020361 3300006051 Bacteria 4172
32 Ga0075364_10206528 3300006051 Bacteria 1332
33 Ga0070716_100051078 3300006173 Unclassified 2349
34 Ga0070712_100020380 3300006175 Bacteria 4340
35 Ga0075367_10000147 3300006178 Bacteria 21561
36 Ga0075369_10008207 3300006186 Bacteria 4010
37 Ga0068871_100626299 3300006358 Bacteria 980
38 Ga0075428_100565078 3300006844 Bacteria 1216
39 Ga0111539_10029081 3300009094 Bacteria 6738
40 Ga0105245_10008999 3300009098 Bacteria 8708
41 Ga0105239_10088685 3300010375 Bacteria 3411
42 Ga0105239_10287623 3300010375 Bacteria 1851
43 Ga0157370_10016928 3300013104 Bacteria 7370
44 Ga0157370_10123605 3300013104 Bacteria 2416
45 Ga0157370_10287205 3300013104 Bacteria 1520
46 Ga0157369_10001286 3300013105 Bacteria 31196
47 Ga0157369_10036489 3300013105 Bacteria 5384
48 Ga0157369_10124866 3300013105 Bacteria 2730
49 Ga0157378_10122325 3300013297 Bacteria 2400
50 Ga0163162_10063343 3300013306 Bacteria 3740
51 Ga0163162_10944907 3300013306 Bacteria 973
52 Ga0157372_10289667 3300013307 Bacteria 1904
53 Ga0157372_10302746 3300013307 Bacteria 1860
54 Ga0157375_10426966 3300013308 Bacteria 1491
55 Ga0157380_10192768 3300014326 Bacteria 1801
56 Ga0213873_10036259 3300021358 Bacteria 1251
57 Ga0213872_10003570 3300021361 Bacteria 8564
58 Ga0213872_10084895 3300021361 Bacteria 1420
59 Ga0213876_10182087 3300021384 Bacteria 1117
60 Ga0213871_10029663 3300021441 Bacteria 1419
61 Ga0209455_1000512 3300025272 Bacteria 27655
62 Ga0207699_10251438 3300025906 Bacteria 1218
63 Ga0207705_10000001 3300025909 Bacteria 2061880
64 Ga0207707_10080215 3300025912 Bacteria 2849
65 Ga0207693_10047828 3300025915 Bacteria 3360
66 Ga0207660_10400478 3300025917 Bacteria 1105
67 Ga0207652_10021304 3300025921 Bacteria 5350
68 Ga0207687_10014228 3300025927 Bacteria 5204
69 Ga0207664_10299668 3300025929 Bacteria 1414
70 Ga0207644_10039294 3300025931 Bacteria 3340
71 Ga0207665_10066115 3300025939 Unclassified 2460
72 Ga0207711_10391395 3300025941 Bacteria 1291
73 Ga0207667_10005914 3300025949 Bacteria 14898
74 Ga0207668_10298213 3300025972 Bacteria 1329
75 Ga0207640_10235789 3300025981 Bacteria 1411
76 Ga0207658_10109261 3300025986 Bacteria 2183
77 Ga0207639_10198932 3300026041 Bacteria 1717
78 Ga0207708_10150019 3300026075 Bacteria 1834
79 Ga0207648_10038001 3300026089 Bacteria 4237
80 Ga0207428_10079672 3300027907 Unclassified 2560
81 Ga0268266_10646348 3300028379 Bacteria 1018
82 Ga0268264_10521192 3300028381 Bacteria 1162
83 Ga0307508_10005249 3300031616 Bacteria 12361
84 Ga0307516_10171718 3300031730 Bacteria 1908
85 Ga0307405_10042881 3300031731 Bacteria 2756
86 Ga0307406_10001024 3300031901 Bacteria 15549
87 Ga0307412_10002790 3300031911 Bacteria 9704
88 Ga0307409_100008386 3300031995 Bacteria 6268
89 Ga0307416_100006053 3300032002 Bacteria 7532
90 Ga0307414_10111776 3300032004 Bacteria 2081
91 Ga0373962_0003105 3300035242 Bacteria 3981
92 Ga0373937_0058640 3300036401 Bacteria 3537
93 Ga0395899_0000566 3300037312 Bacteria 39550
94 Ga0395898_0325923 3300037466 Bacteria 1465
95 Ga0436365_1120677 3300039437 Bacteria 33011
96 Ga0436360_0259525 3300039438 Bacteria 3178
97 Ga0436360_0465881 3300039438 Bacteria 1697
98 Ga0436360_0990381 3300039438 Unclassified 2088
99 Ga0436361_0689078 3300039447 Bacteria 5678
100 Ga0436361_0954506 3300039447 Bacteria 1617
101 Ga0436361_1152141 3300039447 Bacteria 1239
102 Ga0436362_0273953 3300039453 Bacteria 2388
103 Ga0436362_1027317 3300039453 Bacteria 1489
104 Ga0451853_0241921 3300041512 Bacteria 1114
105 Ga0466969_0016400 3300044656 Bacteria 3875
106 Ga0466969_0017437 3300044656 Bacteria 3748
107 Ga0466965_0042057 3300044683 Bacteria 2252
108 Ga0466961_0006985 3300044693 Bacteria 7181
109 Ga0466961_0039258 3300044693 Bacteria 3035
110 Ga0466971_0040372 3300044719 Bacteria 2096
111 Ga0466971_0081439 3300044719 Bacteria 1476
112 Ga0466970_0080535 3300044765 Bacteria 1760
113 Ga0466957_0041954 3300044842 Bacteria 2767
114 Ga0466957_0240362 3300044842 Bacteria 1201
115 Ga0466960_0010904 3300044901 Bacteria 3785
116 Ga0466959_0039930 3300045049 Bacteria 3468
117 Ga0466959_0084520 3300045049 Bacteria 2284
118 Ga0466967_0025895 3300045976 Bacteria 4845
119 Ga0466967_0179053 3300045976 Bacteria 1998
120 Ga0495592_0027449 3300046454 Bacteria 4317
121 Ga0495603_0073233 3300046455 Bacteria 2012
122 Ga0495629_0009183 3300046459 Bacteria 7240
123 Ga0495651_0000202 3300046462 Bacteria 45262
124 Ga0495605_0003883 3300046474 Bacteria 8854
125 Ga0495594_0035178 3300046499 Bacteria 2727
126 Ga0495607_0031817 3300046501 Bacteria 3227
127 Ga0495606_0002438 3300046507 Bacteria 21620
128 Ga0495608_0165184 3300046511 Bacteria 1406
129 Ga0495620_0006242 3300046515 Bacteria 6564
130 Ga0495628_0025178 3300046516 Bacteria 4862
131 Ga0495631_0013084 3300046518 Bacteria 4035
132 Ga0495666_0002060 3300046526 Bacteria 9955
133 Ga0495652_0010683 3300046529 Bacteria 8318
134 Ga0495652_0220167 3300046529 Bacteria 1427
135 Ga0495587_0069658 3300046536 Bacteria 2048
136 Ga0495597_0045512 3300046542 Bacteria 1947
137 Ga0495622_0025427 3300046557 Bacteria 2765
138 Ga0495656_0006372 3300046615 Bacteria 4138
139 Ga0495668_0006590 3300046616 Bacteria 7576
140 Ga0495611_0015482 3300046648 Bacteria 3260
141 Ga0495588_0028594 3300046674 Bacteria 2791
142 Ga0495623_0012184 3300046679 Bacteria 5571
143 Ga0495613_0007803 3300046689 Bacteria 7964
144 Ga0495613_0051135 3300046689 Bacteria 3046
145 Ga0495624_0139865 3300046690 Bacteria 1483
146 Ga0495589_0010348 3300046794 Bacteria 4844
147 Ga0495600_0001751 3300046809 Bacteria 12137
148 Ga0495604_0000371 3300047317 Bacteria 40473
149 Ga0495683_0029121 3300047323 Bacteria 2822
150 Ga0495687_028492 3300047443 Bacteria 2598
151 Ga0495675_0004720 3300047444 Bacteria 8276
152 Ga0495685_048992 3300047447 Bacteria 1436
153 Ga0495684_0006267 3300047471 Bacteria 9244
154 Ga0495602_0059437 3300048088 Bacteria 3337
155 Ga0496100_0007220 3300048903 Bacteria 6111
156 Ga0496100_0260636 3300048903 Bacteria 1285
157 Ga0496101_0002956 3300048904 Bacteria 10458
158 Ga0496101_0051407 3300048904 Bacteria 2969
159 Ga0496102_0022442 3300048905 Bacteria 5592
160 Ga0496102_0044641 3300048905 Bacteria 4023
161 Ga0496104_0021993 3300048907 Bacteria 5859
162 Ga0496105_0087292 3300048908 Bacteria 2577
163 Ga0496106_0000722 3300048909 Bacteria 23829
164 Ga0496106_0015711 3300048909 Bacteria 5601
165 Ga0496107_0006548 3300048910 Bacteria 8013
166 Ga0496107_0158373 3300048910 Bacteria 1677
167 Ga0496108_0008340 3300048911 Bacteria 8404
168 Ga0496108_0359530 3300048911 Bacteria 1271
169 Ga0496110_0016685 3300048913 Bacteria 6134
170 Ga0496110_0216734 3300048913 Bacteria 1741
171 Ga0496112_0019360 3300048915 Bacteria 6423
172 Ga0496113_0055038 3300048916 Bacteria 2981
173 Ga0496114_0021764 3300048917 Bacteria 5218
174 Ga0496114_0023167 3300048917 Bacteria 5065
175 Ga0496114_0169276 3300048917 Bacteria 1903
176 Ga0496114_0255435 3300048917 Bacteria 1542
177 Ga0496115_0109931 3300048918 Bacteria 2264
178 Ga0496117_0000178 3300048920 Bacteria 131062
179 Ga0496118_0047322 3300048921 Bacteria 3334
180 Ga0496119_0001567 3300048922 Bacteria 27191
181 Ga0496124_0435572 3300048927 Bacteria 899
182 Ga0496125_0015106 3300048928 Bacteria 7488
183 Ga0496126_0012974 3300048929 Bacteria 8507
184 Ga0496126_0039440 3300048929 Bacteria 4382
185 Ga0501031_0412834 3300049568 Bacteria 873
186 Ga0501033_0002302 3300049570 Bacteria 16295
187 Ga0501034_0007337 3300049571 Bacteria 11744
188 Ga0501036_0001207 3300049572 Bacteria 19727
189 Ga0501037_0088161 3300049573 Bacteria 2246
190 Ga0501038_0024125 3300049574 Bacteria 5429
191 Ga0501043_0001796 3300049579 Bacteria 18428
192 Ga0501047_0002461 3300049581 Bacteria 17669
193 Ga0501067_0057125 3300049583 Bacteria 2162
194 Ga0501068_0283850 3300049584 Bacteria 1058
195 Ga0501035_0003708 3300049822 Bacteria 14569
196 Ga0501044_0004857 3300049823 Bacteria 15027
197 nmdc:mga03n38_8641_c1 3300050490 Bacteria 3665
198 nmdc:mga00v17_16831_c1 3300050491 Bacteria 4127
199 nmdc:mga0yw44_4349_c2 3300050492 Bacteria 4150
200 nmdc:mga06z11_768_c1 3300050494 Bacteria 11697
201 nmdc:mga07m45_86023_c1 3300050496 Bacteria 1798
202 nmdc:mga05p37_417977_c1 3300050507 Bacteria 1561
203 nmdc:mga08y16_142162_c1 3300050511 Bacteria 2495
204 nmdc:mga0sz30_1902_c1 3300050516 Bacteria 7450
205 nmdc:mga0sz30_31928_c1 3300050516 Bacteria 2181
206 Ga0500583_0068218 3300053092 Bacteria 1696
207 Ga0500573_0009081 3300053140 Bacteria 5500
208 Ga0500573_0054447 3300053140 Bacteria 2296
209 Ga0500616_0169041 3300053153 Bacteria 995
210 Ga0466962_0011092 3300061719 Bacteria 4337
211 2517763065 2517572101 Bacteria 6884336
212 2585321478 2582581314 Bacteria 11452267
213 2643761226 2643221548 Bacteria 8053412
214 2643767725 2643221549 Bacteria 4042819
215 2644383116 2643221669 Bacteria 3611286
216 2644459369 2643221682 Bacteria 6743283
217 2644679010 2643221724 Bacteria 3593515
218 2689958057 2687453737 Bacteria 11203906
219 2723642250 2721755702 Bacteria 4373124
220 2731907434 2731639228 Bacteria 4187555
221 2785366431 2784746768 Bacteria 10036182
222 2810365210 2808606700 Bacteria 3482157
223 2812324555 2811994872 Bacteria 4121241
224 2819696473 2818991463 Bacteria 7948711
225 2819745036 2818991472 Bacteria 10089953
226 2821268788 2821268502 Bacteria 3750023
227 2844854175 2844852863 Bacteria 3849151
228 2857727076 2857723135 Bacteria 4217853
229 2868094000 2868088558 Bacteria 7609351
230 2877684102 2877676314 Bacteria 9512378
231 2895660260 2895660088 Bacteria 3782833
232 2905930594 2905926851 Bacteria 4423176
233 2919443846 2919443155 Bacteria 4072969
234 2935412937 2935409751 Bacteria 4179611
235 2939659808 2939657138 Bacteria 3740283
236 8056040006 8056037122 Bacteria 3854319
237 Ga0307409_100330194
238 rootH1_10017399
239 rootH1_10009377
240 JGI25404J52841_10004358
241 Ga0065714_10094587
242 Ga0070658_10000261
243 Ga0070660_100233174
244 Ga0070668_100059387
245 Ga0070667_100357000
246 Ga0070709_10005655
247 Ga0070714_100115525
248 Ga0070713_100031810
249 Ga0070713_100362573
250 Ga0070700_100215317
251 Ga0070681_10288618
252 Ga0068867_100255152
253 Ga0070679_100035022
254 Ga0068853_100220151
255 Ga0070693_100155406
256 Ga0070665_100166460
257 Ga0068855_100004213
258 Ga0068854_100152607
259 Ga0068854_100159961
260 Ga0068852_100301810
261 Ga0068861_100187464
262 Ga0081540_1001917
263 Ga0070717_10194432
264 Ga0075365_10026153
265 Ga0075368_10008453
266 Ga0075363_100019596
267 Ga0075364_10020361
268 Ga0075364_10206528
269 Ga0070716_100051078
270 Ga0070712_100020380
271 Ga0075367_10000147
272 Ga0075369_10008207
273 Ga0068871_100626299
274 Ga0075428_100565078
275 Ga0111539_10029081
276 Ga0105245_10008999
277 Ga0105239_10088685
278 Ga0105239_10287623
279 Ga0157370_10016928
280 Ga0157370_10123605
281 Ga0157370_10287205
282 Ga0157369_10001286
283 Ga0157369_10036489
284 Ga0157369_10124866
285 Ga0157378_10122325
286 Ga0163162_10063343
287 Ga0163162_10944907
288 Ga0157372_10289667
289 Ga0157372_10302746
290 Ga0157375_10426966
291 Ga0157380_10192768
292 Ga0213873_10036259
293 Ga0213872_10003570
294 Ga0213872_10084895
295 Ga0213876_10182087
296 Ga0213871_10029663
297 Ga0209455_1000512
298 Ga0207699_10251438
299 Ga0207705_10000001
300 Ga0207707_10080215
301 Ga0207693_10047828
302 Ga0207660_10400478
303 Ga0207652_10021304
304 Ga0207687_10014228
305 Ga0207664_10299668
306 Ga0207644_10039294
307 Ga0207665_10066115
308 Ga0207711_10391395
309 Ga0207667_10005914
310 Ga0207668_10298213
311 Ga0207640_10235789
312 Ga0207658_10109261
313 Ga0207639_10198932
314 Ga0207708_10150019
315 Ga0207648_10038001
316 Ga0207428_10079672
317 Ga0268266_10646348
318 Ga0268264_10521192
319 Ga0307508_10005249
320 Ga0307516_10171718
321 Ga0307405_10042881
322 Ga0307406_10001024
323 Ga0307412_10002790
324 Ga0307409_100008386
325 Ga0307416_100006053
326 Ga0307414_10111776
327 Ga0373962_0003105
328 Ga0373937_0058640
329 Ga0395899_0000566
330 Ga0395898_0325923
331 Ga0436365_1120677
332 Ga0436360_0259525
333 Ga0436360_0465881
334 Ga0436360_0990381
335 Ga0436361_0689078
336 Ga0436361_0954506
337 Ga0436361_1152141
338 Ga0436362_0273953
339 Ga0436362_1027317
340 Ga0451853_0241921
341 Ga0466969_0016400
342 Ga0466969_0017437
343 Ga0466965_0042057
344 Ga0466961_0006985
345 Ga0466961_0039258
346 Ga0466971_0040372
347 Ga0466971_0081439
348 Ga0466970_0080535
349 Ga0466957_0041954
350 Ga0466957_0240362
351 Ga0466960_0010904
352 Ga0466959_0039930
353 Ga0466959_0084520
354 Ga0466967_0025895
355 Ga0466967_0179053
356 Ga0495592_0027449
357 Ga0495603_0073233
358 Ga0495629_0009183
359 Ga0495651_0000202
360 Ga0495605_0003883
361 Ga0495594_0035178
362 Ga0495607_0031817
363 Ga0495606_0002438
364 Ga0495608_0165184
365 Ga0495620_0006242
366 Ga0495628_0025178
367 Ga0495631_0013084
368 Ga0495666_0002060
369 Ga0495652_0010683
370 Ga0495652_0220167
371 Ga0495587_0069658
372 Ga0495597_0045512
373 Ga0495622_0025427
374 Ga0495656_0006372
375 Ga0495668_0006590
376 Ga0495611_0015482
377 Ga0495588_0028594
378 Ga0495623_0012184
379 Ga0495613_0007803
380 Ga0495613_0051135
381 Ga0495624_0139865
382 Ga0495589_0010348
383 Ga0495600_0001751
384 Ga0495604_0000371
385 Ga0495683_0029121
386 Ga0495687_028492
387 Ga0495675_0004720
388 Ga0495685_048992
389 Ga0495684_0006267
390 Ga0495602_0059437
391 Ga0496100_0007220
392 Ga0496100_0260636
393 Ga0496101_0002956
394 Ga0496101_0051407
395 Ga0496102_0022442
396 Ga0496102_0044641
397 Ga0496104_0021993
398 Ga0496105_0087292
399 Ga0496106_0000722
400 Ga0496106_0015711
401 Ga0496107_0006548
402 Ga0496107_0158373
403 Ga0496108_0008340
404 Ga0496108_0359530
405 Ga0496110_0016685
406 Ga0496110_0216734
407 Ga0496112_0019360
408 Ga0496113_0055038
409 Ga0496114_0021764
410 Ga0496114_0023167
411 Ga0496114_0169276
412 Ga0496114_0255435
413 Ga0496115_0109931
414 Ga0496117_0000178
415 Ga0496118_0047322
416 Ga0496119_0001567
417 Ga0496124_0435572
418 Ga0496125_0015106
419 Ga0496126_0012974
420 Ga0496126_0039440
421 Ga0501031_0412834
422 Ga0501033_0002302
423 Ga0501034_0007337
424 Ga0501036_0001207
425 Ga0501037_0088161
426 Ga0501038_0024125
427 Ga0501043_0001796
428 Ga0501047_0002461
429 Ga0501067_0057125
430 Ga0501068_0283850
431 Ga0501035_0003708
432 Ga0501044_0004857
433 nmdc:mga03n38_8641_c1
434 nmdc:mga00v17_16831_c1
435 nmdc:mga0yw44_4349_c2
436 nmdc:mga06z11_768_c1
437 nmdc:mga07m45_86023_c1
438 nmdc:mga05p37_417977_c1
439 nmdc:mga08y16_142162_c1
440 nmdc:mga0sz30_1902_c1
441 nmdc:mga0sz30_31928_c1
442 Ga0500583_0068218
443 Ga0500573_0009081
444 Ga0500573_0054447
445 Ga0500616_0169041
446 Ga0466962_0011092
447 2517763065
448 2585321478
449 2643761226
450 2643767725
451 2644383116
452 2644459369
453 2644679010
454 2689958057
455 2723642250
456 2731907434
457 2785366431
458 2810365210
459 2812324555
460 2819696473
461 2819745036
462 2821268788
463 2844854175
464 2857727076
465 2868094000
466 2877684102
467 2895660260
468 2905930594
469 2919443846
470 2935412937
471 2939659808
472 8056040006

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

112

295

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8709 27 286
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.8672 27 290
8ja7-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8622 28 294
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.8612 27 290
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.8564 27 298
ID Description Score Start End Superfamily
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9476 24 288 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9401 20 282 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9399 21 288 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9372 24 288 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9297 21 288 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A415FU59-F1-model_v4 deleted 0.9703 34 298
AF-A0A1V5MJP6-F1-model_v4 deleted 0.9668 26 294
AF-A0A5M3Y1S6-F1-model_v4 Sugar ABC transporter permease 0.966 25 297 GO:0005886
GO:0055085
AF-A0A842I346-F1-model_v4 Carbohydrate ABC transporter permease 0.9658 28 297 GO:0005886
GO:0055085
AF-S0DFG2-F1-model_v4 Putative ATPbinding transport protein 0.9636 26 298 GO:0005886
GO:0055085

Map