F349227

General Info

Members Datasets Scaffolds Average Seq Length
236 174 472 108

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10781357|Ga0307410_107813572
Length 129
Sequence LDFVDSDEQSDSAPLRIVVAKPGLDGHDRGAKVVARALRGLSVLSGAHMTLFARLIELLHEANADDIVVFGGGIIPDADRQALAEMGVAEVFTPGATMSEIVSWVRANVGAARRDEGASIGTPIPDGAC

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
87 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
90 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
91 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
92 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
103 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
104 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
105 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
106 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
107 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
170 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 2.54
Rhizosphere 94.49
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10781357 3300031852 Bacteria 811
2 Ga0065707_10206968 3300005295 Bacteria 1283
3 Ga0070676_10056134 3300005328 Bacteria 2326
4 Ga0068868_100365978 3300005338 Bacteria 1238
5 Ga0068868_100795102 3300005338 Bacteria 853
6 Ga0070692_10303096 3300005345 Bacteria 976
7 Ga0070669_101027962 3300005353 Bacteria 708
8 Ga0070688_100057068 3300005365 Bacteria 2453
9 Ga0070709_10006828 3300005434 Bacteria 6231
10 Ga0070714_100003219 3300005435 Bacteria 12152
11 Ga0070714_100005675 3300005435 Bacteria 9552
12 Ga0070714_100299593 3300005435 Bacteria 1498
13 Ga0070714_101209238 3300005435 Bacteria 737
14 Ga0070713_100024149 3300005436 Bacteria 4731
15 Ga0070713_100046934 3300005436 Bacteria 3547
16 Ga0070713_100147171 3300005436 Bacteria 2092
17 Ga0070713_100185991 3300005436 Bacteria 1869
18 Ga0070710_10007818 3300005437 Bacteria 5189
19 Ga0070701_10235805 3300005438 Bacteria 1098
20 Ga0070711_100016725 3300005439 Bacteria 4660
21 Ga0070705_100272014 3300005440 Bacteria 1200
22 Ga0070694_100057737 3300005444 Bacteria 2639
23 Ga0070708_100098568 3300005445 Bacteria 2672
24 Ga0068867_100330519 3300005459 Bacteria 1266
25 Ga0070706_100007075 3300005467 Bacteria 10563
26 Ga0070707_100000256 3300005468 Bacteria 53538
27 Ga0070707_100085971 3300005468 Bacteria 3041
28 Ga0070707_100170434 3300005468 Bacteria 2121
29 Ga0070698_100000333 3300005471 Bacteria 48484
30 Ga0070698_100649056 3300005471 Bacteria 996
31 Ga0070698_101362077 3300005471 Bacteria 660
32 Ga0070699_100481789 3300005518 Bacteria 1126
33 Ga0070697_100692270 3300005536 Bacteria 899
34 Ga0070686_100478245 3300005544 Bacteria 963
35 Ga0070695_100129380 3300005545 Bacteria 1738
36 Ga0070695_100265998 3300005545 Bacteria 1254
37 Ga0070693_100047570 3300005547 Bacteria 2441
38 Ga0070704_100001713 3300005549 Bacteria 11957
39 Ga0068856_100976447 3300005614 Bacteria 865
40 Ga0068856_101395083 3300005614 Bacteria 715
41 Ga0068852_100160597 3300005616 Bacteria 2098
42 Ga0068859_101101132 3300005617 Bacteria 874
43 Ga0068858_100168632 3300005842 Bacteria 2064
44 Ga0068858_100504066 3300005842 Bacteria 1170
45 Ga0081455_10000602 3300005937 Bacteria 46523
46 Ga0081455_10018393 3300005937 Bacteria 6659
47 Ga0070717_10143211 3300006028 Bacteria 2063
48 Ga0075432_10000006 3300006058 Bacteria 41437
49 Ga0070715_10069513 3300006163 Bacteria 1569
50 Ga0070716_100014789 3300006173 Bacteria 4003
51 Ga0070716_100024251 3300006173 Bacteria 3227
52 Ga0070712_100000258 3300006175 Bacteria 29603
53 Ga0070712_100067279 3300006175 Bacteria 2549
54 Ga0070712_100162486 3300006175 Bacteria 1726
55 Ga0070712_100396526 3300006175 Bacteria 1139
56 Ga0075366_11029699 3300006195 Bacteria 514
57 Ga0097621_100797849 3300006237 Bacteria 875
58 Ga0097621_101367657 3300006237 Bacteria 670
59 Ga0068871_101809228 3300006358 Bacteria 580
60 Ga0075428_100055578 3300006844 Bacteria 4337
61 Ga0075433_10001010 3300006852 Bacteria 20028
62 Ga0075434_100000181 3300006871 Bacteria 40986
63 Ga0068865_100849993 3300006881 Bacteria 790
64 Ga0075436_100003025 3300006914 Bacteria 11522
65 Ga0075436_100798071 3300006914 Bacteria 703
66 Ga0097620_101101166 3300006931 Bacteria 874
67 Ga0075435_100013087 3300007076 Bacteria 6162
68 Ga0075435_101085646 3300007076 Bacteria 699
69 Ga0099795_10083147 3300007788 Bacteria 1229
70 Ga0111539_10000095 3300009094 Bacteria 93635
71 Ga0105245_10258520 3300009098 Bacteria 1694
72 Ga0105245_11950584 3300009098 Bacteria 640
73 Ga0105242_10439327 3300009176 Bacteria 1227
74 Ga0105242_10605042 3300009176 Bacteria 1059
75 Ga0105248_10684323 3300009177 Bacteria 1157
76 Ga0105248_10700365 3300009177 Bacteria 1143
77 Ga0105237_10574730 3300009545 Bacteria 1134
78 Ga0105238_10889469 3300009551 Bacteria 909
79 Ga0105238_12675370 3300009551 Bacteria 535
80 Ga0105239_10301332 3300010375 Bacteria 1805
81 Ga0157374_10346331 3300013296 Bacteria 1476
82 Ga0157378_10940202 3300013297 Bacteria 897
83 Ga0157378_12729753 3300013297 Bacteria 546
84 Ga0163162_10397220 3300013306 Bacteria 1511
85 Ga0157375_10214712 3300013308 Bacteria 2081
86 Ga0157375_10985900 3300013308 Bacteria 983
87 Ga0163163_10505131 3300014325 Bacteria 1271
88 Ga0157380_10865420 3300014326 Bacteria 927
89 Ga0157380_11846616 3300014326 Bacteria 664
90 Ga0157379_11280136 3300014968 Bacteria 707
91 Ga0157376_11183123 3300014969 Bacteria 792
92 Ga0207692_10003083 3300025898 Bacteria 6471
93 Ga0207692_10304492 3300025898 Bacteria 971
94 Ga0207692_10800386 3300025898 Bacteria 616
95 Ga0207642_10193997 3300025899 Bacteria 1117
96 Ga0207680_11319641 3300025903 Bacteria 513
97 Ga0207699_10019799 3300025906 Bacteria 3596
98 Ga0207645_10339651 3300025907 Bacteria 1004
99 Ga0207684_10003863 3300025910 Bacteria 14398
100 Ga0207684_10061441 3300025910 Bacteria 3190
101 Ga0207671_11237404 3300025914 Bacteria 583
102 Ga0207693_10000728 3300025915 Bacteria 29655
103 Ga0207693_10036679 3300025915 Bacteria 3864
104 Ga0207693_10078168 3300025915 Bacteria 2590
105 Ga0207693_10450080 3300025915 Bacteria 1006
106 Ga0207663_10561549 3300025916 Bacteria 893
107 Ga0207663_10657416 3300025916 Bacteria 828
108 Ga0207646_10002655 3300025922 Bacteria 20967
109 Ga0207646_10047517 3300025922 Bacteria 3849
110 Ga0207646_10209730 3300025922 Bacteria 1759
111 Ga0207700_10002031 3300025928 Bacteria 11563
112 Ga0207700_10006105 3300025928 Bacteria 7257
113 Ga0207700_10207428 3300025928 Bacteria 1655
114 Ga0207664_10001389 3300025929 Bacteria 15905
115 Ga0207664_10009636 3300025929 Bacteria 6787
116 Ga0207686_11147866 3300025934 Bacteria 635
117 Ga0207686_11210735 3300025934 Bacteria 618
118 Ga0207665_10018128 3300025939 Bacteria 4625
119 Ga0207711_10574979 3300025941 Bacteria 1051
120 Ga0207703_10365256 3300026035 Bacteria 1332
121 Ga0207641_10585722 3300026088 Bacteria 1091
122 Ga0207648_10366123 3300026089 Bacteria 1301
123 Ga0207648_10493504 3300026089 Bacteria 1120
124 Ga0207675_100005692 3300026118 Bacteria 11926
125 Ga0207675_100332501 3300026118 Bacteria 1485
126 Ga0207683_10161640 3300026121 Bacteria 2025
127 Ga0207683_10787721 3300026121 Bacteria 882
128 Ga0207428_10000102 3300027907 Bacteria 118940
129 Ga0268265_10650311 3300028380 Bacteria 1013
130 Ga0265316_10024583 3300031344 Bacteria 5042
131 Ga0316579_10027922 3300031691 Bacteria 2566
132 Ga0316577_10225457 3300031733 Bacteria 1060
133 Ga0307416_102727333 3300032002 Bacteria 590
134 Ga0307507_10321629 3300033179 Bacteria 931
135 Ga0307510_10039787 3300033180 Bacteria 5173
136 Ga0373926_0227635 3300035083 Bacteria 720
137 Ga0373923_0203432 3300035111 Bacteria 916
138 Ga0373939_0003752 3300035114 Bacteria 3580
139 Ga0373955_0630733 3300035172 Bacteria 657
140 Ga0373933_0098342 3300035724 Bacteria 1813
141 Ga0373947_0047868 3300035725 Bacteria 2564
142 Ga0373937_0004551 3300036401 Bacteria 11770
143 Ga0373925_0066117 3300037068 Bacteria 2725
144 Ga0373925_0391935 3300037068 Bacteria 1132
145 Ga0436364_1020996 3300037853 Bacteria 760
146 Ga0436363_0203336 3300039450 Bacteria 1743
147 Ga0436362_0528299 3300039453 Bacteria 32664
148 Ga0439448_0104060 3300042005 Bacteria 967
149 Ga0439463_006540 3300042016 Bacteria 2888
150 Ga0450900_077081 3300042136 Bacteria 533
151 Ga0439435_0006294 3300042436 Bacteria 2661
152 Ga0439444_0024369 3300042437 Bacteria 1093
153 Ga0439464_0038724 3300042439 Bacteria 1354
154 Ga0451577_1551979 3300042876 Bacteria 585
155 Ga0439440_0002992 3300042993 Bacteria 3220
156 Ga0466972_0462095 3300044658 Bacteria 596
157 Ga0466965_0262647 3300044683 Bacteria 928
158 Ga0466966_0020808 3300044684 Bacteria 4313
159 Ga0466966_0039539 3300044684 Bacteria 3038
160 Ga0466961_0017965 3300044693 Bacteria 4547
161 Ga0466963_0404094 3300044694 Bacteria 963
162 Ga0453684_1055997 3300044712 Bacteria 861
163 Ga0466968_0228649 3300044735 Bacteria 878
164 Ga0466968_0246797 3300044735 Bacteria 847
165 Ga0466959_0029467 3300045049 Bacteria 4066
166 Ga0466959_0108484 3300045049 Bacteria 1983
167 Ga0466958_1166438 3300045836 Bacteria 503
168 Ga0466967_0000595 3300045976 Bacteria 17954
169 Ga0495603_0006202 3300046455 Bacteria 7151
170 Ga0495603_0119936 3300046455 Bacteria 1533
171 Ga0495629_0076409 3300046459 Bacteria 2338
172 Ga0495651_0001955 3300046462 Bacteria 15926
173 Ga0495580_0005906 3300046472 Bacteria 10040
174 Ga0495580_0105284 3300046472 Bacteria 1960
175 Ga0495664_0057393 3300046477 Bacteria 2316
176 Ga0495594_0070901 3300046499 Bacteria 1937
177 Ga0495606_0001404 3300046507 Bacteria 32385
178 Ga0495628_0001240 3300046516 Bacteria 23338
179 Ga0495652_0002342 3300046529 Bacteria 19650
180 Ga0495652_0602922 3300046529 Bacteria 749
181 Ga0495656_0472304 3300046615 Bacteria 663
182 Ga0495668_0000802 3300046616 Bacteria 36169
183 Ga0495625_0011408 3300046660 Bacteria 7251
184 Ga0495659_0016900 3300046664 Bacteria 2412
185 Ga0495588_0052726 3300046674 Bacteria 2097
186 Ga0495658_0386070 3300046683 Bacteria 892
187 Ga0495658_0419662 3300046683 Bacteria 853
188 Ga0495658_0555251 3300046683 Bacteria 735
189 Ga0495600_0154346 3300046809 Bacteria 1485
190 Ga0495674_0064331 3300047319 Bacteria 3189
191 Ga0495676_0026084 3300047321 Bacteria 5035
192 Ga0495676_0232496 3300047321 Bacteria 1266
193 Ga0495676_0859713 3300047321 Bacteria 582
194 Ga0495680_0726221 3300047322 Bacteria 654
195 Ga0495626_0002123 3300048091 Bacteria 14364
196 Ga0496100_1437779 3300048903 Bacteria 544
197 Ga0496104_0747918 3300048907 Bacteria 885
198 Ga0496108_1003454 3300048911 Bacteria 713
199 Ga0496114_1256286 3300048917 Bacteria 627
200 Ga0496115_0587825 3300048918 Bacteria 886
201 Ga0496115_1255219 3300048918 Bacteria 554
202 Ga0501033_0414878 3300049570 Bacteria 938
203 Ga0501037_0244814 3300049573 Bacteria 1256
204 Ga0501038_0150507 3300049574 Bacteria 1898
205 Ga0501039_0458449 3300049575 Bacteria 1001
206 Ga0501040_1273833 3300049576 Bacteria 533
207 Ga0501041_0005442 3300049577 Bacteria 7456
208 Ga0501042_0045778 3300049578 Bacteria 3119
209 Ga0501043_0234030 3300049579 Bacteria 1418
210 Ga0501046_0117070 3300049580 Bacteria 2030
211 Ga0501048_0305871 3300049582 Bacteria 1131
212 Ga0501068_0096866 3300049584 Bacteria 1825
213 Ga0501073_0176580 3300049589 Bacteria 1478
214 Ga0501073_0746122 3300049589 Bacteria 675
215 Ga0501075_0074158 3300049591 Bacteria 2574
216 Ga0501077_0084319 3300049593 Bacteria 2014
217 Ga0501080_0469044 3300049742 Bacteria 1127
218 Ga0501081_0298589 3300049743 Bacteria 1181
219 Ga0501045_0005887 3300049824 Bacteria 8484
220 nmdc:mga06r32_844272_c1 3300050510 Bacteria 875
221 nmdc:mga08y16_2528_c1 3300050511 Bacteria 18802
222 nmdc:mga0n895_2013895_c1 3300050512 Bacteria 535
223 nmdc:mga0n895_33485_c1 3300050512 Bacteria 4940
224 nmdc:mga0rr50_1430879_c1 3300050513 Bacteria 585
225 nmdc:mga0rr50_41200_c1 3300050513 Bacteria 3363
226 nmdc:mga08x19_108804_c1 3300050514 Bacteria 1847
227 nmdc:mga08x19_558360_c1 3300050514 Bacteria 810
228 nmdc:mga08x19_896325_c1 3300050514 Bacteria 630
229 nmdc:mga0a205_512_c1 3300050515 Bacteria 17645
230 Ga0495601_0093883 3300053077 Bacteria 1933
231 Ga0500559_0024553 3300053136 Bacteria 2565
232 Ga0500568_0003363 3300053139 Bacteria 8945
233 Ga0501084_0007592 3300054114 Bacteria 8943
234 Ga0590074_019133 3300059423 Bacteria 1174
235 Ga0587080_060592 3300059503 Unclassified 736
236 Ga0530510_0383367 3300061734 Bacteria 1058
237 Ga0307410_10781357
238 Ga0065707_10206968
239 Ga0070676_10056134
240 Ga0068868_100365978
241 Ga0068868_100795102
242 Ga0070692_10303096
243 Ga0070669_101027962
244 Ga0070688_100057068
245 Ga0070709_10006828
246 Ga0070714_100003219
247 Ga0070714_100005675
248 Ga0070714_100299593
249 Ga0070714_101209238
250 Ga0070713_100024149
251 Ga0070713_100046934
252 Ga0070713_100147171
253 Ga0070713_100185991
254 Ga0070710_10007818
255 Ga0070701_10235805
256 Ga0070711_100016725
257 Ga0070705_100272014
258 Ga0070694_100057737
259 Ga0070708_100098568
260 Ga0068867_100330519
261 Ga0070706_100007075
262 Ga0070707_100000256
263 Ga0070707_100085971
264 Ga0070707_100170434
265 Ga0070698_100000333
266 Ga0070698_100649056
267 Ga0070698_101362077
268 Ga0070699_100481789
269 Ga0070697_100692270
270 Ga0070686_100478245
271 Ga0070695_100129380
272 Ga0070695_100265998
273 Ga0070693_100047570
274 Ga0070704_100001713
275 Ga0068856_100976447
276 Ga0068856_101395083
277 Ga0068852_100160597
278 Ga0068859_101101132
279 Ga0068858_100168632
280 Ga0068858_100504066
281 Ga0081455_10000602
282 Ga0081455_10018393
283 Ga0070717_10143211
284 Ga0075432_10000006
285 Ga0070715_10069513
286 Ga0070716_100014789
287 Ga0070716_100024251
288 Ga0070712_100000258
289 Ga0070712_100067279
290 Ga0070712_100162486
291 Ga0070712_100396526
292 Ga0075366_11029699
293 Ga0097621_100797849
294 Ga0097621_101367657
295 Ga0068871_101809228
296 Ga0075428_100055578
297 Ga0075433_10001010
298 Ga0075434_100000181
299 Ga0068865_100849993
300 Ga0075436_100003025
301 Ga0075436_100798071
302 Ga0097620_101101166
303 Ga0075435_100013087
304 Ga0075435_101085646
305 Ga0099795_10083147
306 Ga0111539_10000095
307 Ga0105245_10258520
308 Ga0105245_11950584
309 Ga0105242_10439327
310 Ga0105242_10605042
311 Ga0105248_10684323
312 Ga0105248_10700365
313 Ga0105237_10574730
314 Ga0105238_10889469
315 Ga0105238_12675370
316 Ga0105239_10301332
317 Ga0157374_10346331
318 Ga0157378_10940202
319 Ga0157378_12729753
320 Ga0163162_10397220
321 Ga0157375_10214712
322 Ga0157375_10985900
323 Ga0163163_10505131
324 Ga0157380_10865420
325 Ga0157380_11846616
326 Ga0157379_11280136
327 Ga0157376_11183123
328 Ga0207692_10003083
329 Ga0207692_10304492
330 Ga0207692_10800386
331 Ga0207642_10193997
332 Ga0207680_11319641
333 Ga0207699_10019799
334 Ga0207645_10339651
335 Ga0207684_10003863
336 Ga0207684_10061441
337 Ga0207671_11237404
338 Ga0207693_10000728
339 Ga0207693_10036679
340 Ga0207693_10078168
341 Ga0207693_10450080
342 Ga0207663_10561549
343 Ga0207663_10657416
344 Ga0207646_10002655
345 Ga0207646_10047517
346 Ga0207646_10209730
347 Ga0207700_10002031
348 Ga0207700_10006105
349 Ga0207700_10207428
350 Ga0207664_10001389
351 Ga0207664_10009636
352 Ga0207686_11147866
353 Ga0207686_11210735
354 Ga0207665_10018128
355 Ga0207711_10574979
356 Ga0207703_10365256
357 Ga0207641_10585722
358 Ga0207648_10366123
359 Ga0207648_10493504
360 Ga0207675_100005692
361 Ga0207675_100332501
362 Ga0207683_10161640
363 Ga0207683_10787721
364 Ga0207428_10000102
365 Ga0268265_10650311
366 Ga0265316_10024583
367 Ga0316579_10027922
368 Ga0316577_10225457
369 Ga0307416_102727333
370 Ga0307507_10321629
371 Ga0307510_10039787
372 Ga0373926_0227635
373 Ga0373923_0203432
374 Ga0373939_0003752
375 Ga0373955_0630733
376 Ga0373933_0098342
377 Ga0373947_0047868
378 Ga0373937_0004551
379 Ga0373925_0066117
380 Ga0373925_0391935
381 Ga0436364_1020996
382 Ga0436363_0203336
383 Ga0436362_0528299
384 Ga0439448_0104060
385 Ga0439463_006540
386 Ga0450900_077081
387 Ga0439435_0006294
388 Ga0439444_0024369
389 Ga0439464_0038724
390 Ga0451577_1551979
391 Ga0439440_0002992
392 Ga0466972_0462095
393 Ga0466965_0262647
394 Ga0466966_0020808
395 Ga0466966_0039539
396 Ga0466961_0017965
397 Ga0466963_0404094
398 Ga0453684_1055997
399 Ga0466968_0228649
400 Ga0466968_0246797
401 Ga0466959_0029467
402 Ga0466959_0108484
403 Ga0466958_1166438
404 Ga0466967_0000595
405 Ga0495603_0006202
406 Ga0495603_0119936
407 Ga0495629_0076409
408 Ga0495651_0001955
409 Ga0495580_0005906
410 Ga0495580_0105284
411 Ga0495664_0057393
412 Ga0495594_0070901
413 Ga0495606_0001404
414 Ga0495628_0001240
415 Ga0495652_0002342
416 Ga0495652_0602922
417 Ga0495656_0472304
418 Ga0495668_0000802
419 Ga0495625_0011408
420 Ga0495659_0016900
421 Ga0495588_0052726
422 Ga0495658_0386070
423 Ga0495658_0419662
424 Ga0495658_0555251
425 Ga0495600_0154346
426 Ga0495674_0064331
427 Ga0495676_0026084
428 Ga0495676_0232496
429 Ga0495676_0859713
430 Ga0495680_0726221
431 Ga0495626_0002123
432 Ga0496100_1437779
433 Ga0496104_0747918
434 Ga0496108_1003454
435 Ga0496114_1256286
436 Ga0496115_0587825
437 Ga0496115_1255219
438 Ga0501033_0414878
439 Ga0501037_0244814
440 Ga0501038_0150507
441 Ga0501039_0458449
442 Ga0501040_1273833
443 Ga0501041_0005442
444 Ga0501042_0045778
445 Ga0501043_0234030
446 Ga0501046_0117070
447 Ga0501048_0305871
448 Ga0501068_0096866
449 Ga0501073_0176580
450 Ga0501073_0746122
451 Ga0501075_0074158
452 Ga0501077_0084319
453 Ga0501080_0469044
454 Ga0501081_0298589
455 Ga0501045_0005887
456 nmdc:mga06r32_844272_c1
457 nmdc:mga08y16_2528_c1
458 nmdc:mga0n895_2013895_c1
459 nmdc:mga0n895_33485_c1
460 nmdc:mga0rr50_1430879_c1
461 nmdc:mga0rr50_41200_c1
462 nmdc:mga08x19_108804_c1
463 nmdc:mga08x19_558360_c1
464 nmdc:mga08x19_896325_c1
465 nmdc:mga0a205_512_c1
466 Ga0495601_0093883
467 Ga0500559_0024553
468 Ga0500568_0003363
469 Ga0501084_0007592
470 Ga0590074_019133
471 Ga0587080_060592
472 Ga0530510_0383367

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l85-assembly1.cif.gz_A crystal structure of receiver domain of kdpe d52a mutant from e. coli 0.7926 43 99
3cfy-assembly1.cif.gz_A crystal structure of signal receiver domain of putative luxo repressor protein from vibrio parahaemolyticus 0.7894 44 98
1u8t-assembly2.cif.gz_B crystal structure of chey d13k y106w alone and in complex with a flim peptide 0.7816 43 98
2fmk-assembly1.cif.gz_A crystal structure of mg2+ and bef3- bound chey in complex with chez 200-214 solved from a p2(1)2(1)2 crystal grown in mes (ph 6.0) 0.7769 45 98
4l85-assembly2.cif.gz_C-2 crystal structure of receiver domain of kdpe d52a mutant from e. coli 0.7751 43 98
ID Description Score Start End Superfamily
3cfyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7894 44 98 3.40.50.2300
1zy2B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7732 43 97 3.40.50.2300
4d6yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7718 44 98 3.40.50.2300
2v0nA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.771 40 98 3.40.50.2300
af_P0AFU4_2_125_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7703 44 98 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A538JYZ7-F1-model_v4 Methylmalonyl-CoA mutase 0.9741 46 100 GO:0016853
GO:0031419
GO:0046872
AF-X1E800-F1-model_v4 B12-binding domain-containing protein 0.9662 36 97 GO:0016853
GO:0031419
GO:0046872
AF-A0A3D3BMR0-F1-model_v4 B12-binding domain-containing protein 0.9657 41 98 GO:0004494
GO:0005737
GO:0019678
GO:0031419
GO:0046872
AF-A0A397C3I3-F1-model_v4 B12-binding domain-containing protein 0.9626 37 98 GO:0004494
GO:0005739
GO:0019678
GO:0031419
GO:0046872
AF-A0A2M7JWZ6-F1-model_v4 Methylmalonyl-CoA mutase 0.9594 36 100 GO:0016853
GO:0031419
GO:0046872

Map