F349209

General Info

Members Datasets Scaffolds Average Seq Length
236 139 208 183

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100101214|Ga0307408_1001012143
Length 210
Sequence MARNTLSRSLHDLGLAAWFGGTLANAVALNPAASEATTPSDVGAVTNTGWDRWTPVNAVAIGMHLAGSVGQLRGNTARIASQRGVGTMVAVKTGLTVAALAATAYSRVLGRKVSANRNVPIESGTEPAPALTPDDVASAQRQLAVLQWGVPVLTGALVVVSAFAGEQQRAREVSQGLLDRLTGSGVLTSGAGLAASVVAARNALRQVGGR

Samples

Sample ID Description Type Environment
1 2643221679 Angustibacter sp. Root456 Isolate Unclassified
2 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
3 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
4 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
5 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
6 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
7 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
8 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
9 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
10 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
11 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
12 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
13 2858882152 Micromonospora noduli MED15 Isolate Nodule
14 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
15 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
16 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
17 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
18 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
19 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
20 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
21 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
22 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
23 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
24 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
25 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
26 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
79 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
80 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
81 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
82 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
83 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
84 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
85 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
86 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
101 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
102 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
103 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
104 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
105 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
115 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
116 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
138 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
139 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.29
Metatranscriptomes 0.85
Isolates 11.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.12
Nodule 1.69
Rhizoplane 5.08
Rhizosphere 78.39
Stem 0
Stem Tuber 0
Unclassified 12.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10012998 3300003373 Bacteria 2137
2 JGI25407J50210_10018608 3300003373 Unclassified 1806
3 JGI25407J50210_10044808 3300003373 Bacteria 1129
4 JGI25407J50210_10045692 3300003373 Bacteria 1116
5 Ga0070682_100787425 3300005337 Bacteria 771
6 Ga0070675_101120119 3300005354 Bacteria 724
7 Ga0070674_101095363 3300005356 Bacteria 703
8 Ga0070673_100953354 3300005364 Bacteria 797
9 Ga0070673_101536991 3300005364 Bacteria 628
10 Ga0070678_101303206 3300005456 Unclassified 676
11 Ga0070685_10223437 3300005466 Bacteria 1235
12 Ga0070679_100146036 3300005530 Bacteria 2343
13 Ga0070696_100406896 3300005546 Unclassified 1066
14 Ga0070665_100471951 3300005548 Bacteria 1265
15 Ga0068856_100931360 3300005614 Bacteria 887
16 Ga0068856_101327766 3300005614 Bacteria 734
17 Ga0081538_10008357 3300005981 Bacteria 8807
18 Ga0081538_10008425 3300005981 Bacteria 8753
19 Ga0081539_10142400 3300005985 Bacteria 1163
20 Ga0075365_10244157 3300006038 Bacteria 1261
21 Ga0075364_10179612 3300006051 Bacteria 1432
22 Ga0068865_100126119 3300006881 Bacteria 1911
23 Ga0105245_10700713 3300009098 Bacteria 1046
24 Ga0114129_10318775 3300009147 Bacteria 2067
25 Ga0105248_10372441 3300009177 Bacteria 1608
26 Ga0105248_11497787 3300009177 Bacteria 764
27 Ga0105238_10525655 3300009551 Bacteria 1186
28 Ga0105239_10818526 3300010375 Bacteria 1067
29 Ga0163162_10479302 3300013306 Bacteria 1375
30 Ga0157372_10324402 3300013307 Bacteria 1793
31 Ga0157372_10648729 3300013307 Unclassified 1229
32 Ga0157375_10362329 3300013308 Bacteria 1616
33 Ga0163163_10903504 3300014325 Bacteria 946
34 Ga0157380_10609141 3300014326 Bacteria 1082
35 Ga0213875_10146764 3300021388 Bacteria 1105
36 Ga0224712_10009667 3300022467 Bacteria 2917
37 Ga0207642_10421843 3300025899 Unclassified 803
38 Ga0207688_10731092 3300025901 Bacteria 626
39 Ga0207687_10892338 3300025927 Unclassified 761
40 Ga0207669_10588353 3300025937 Bacteria 903
41 Ga0207702_10311953 3300026078 Bacteria 1496
42 Ga0207683_11669274 3300026121 Bacteria 586
43 Ga0307408_100101214 3300031548 Bacteria 2196
44 Ga0307408_100183863 3300031548 Bacteria 1678
45 Ga0307405_10008961 3300031731 Bacteria 5108
46 Ga0307405_10107477 3300031731 Bacteria 1883
47 Ga0307405_10118422 3300031731 Bacteria 1808
48 Ga0307405_10389969 3300031731 Bacteria 1087
49 Ga0307413_10028065 3300031824 Bacteria 3128
50 Ga0307413_10110184 3300031824 Bacteria 1841
51 Ga0307413_10242497 3300031824 Bacteria 1332
52 Ga0307413_10420409 3300031824 Bacteria 1052
53 Ga0307410_10014034 3300031852 Bacteria 4697
54 Ga0307410_10037548 3300031852 Bacteria 3165
55 Ga0307410_10093642 3300031852 Bacteria 2138
56 Ga0307410_10198063 3300031852 Bacteria 1532
57 Ga0307410_10504017 3300031852 Bacteria 996
58 Ga0307410_10521478 3300031852 Bacteria 981
59 Ga0307410_10840547 3300031852 Bacteria 783
60 Ga0326468_10002486 3300031889 Bacteria 1539
61 Ga0307406_10023086 3300031901 Bacteria 3698
62 Ga0307406_10038470 3300031901 Unclassified 2961
63 Ga0307406_10174807 3300031901 Bacteria 1558
64 Ga0307406_10326759 3300031901 Bacteria 1189
65 Ga0307406_10858145 3300031901 Bacteria 770
66 Ga0307407_10005476 3300031903 Bacteria 5513
67 Ga0307407_10016356 3300031903 Bacteria 3693
68 Ga0307407_10039666 3300031903 Bacteria 2620
69 Ga0307407_10064692 3300031903 Bacteria 2150
70 Ga0307407_10136861 3300031903 Bacteria 1575
71 Ga0307407_10155344 3300031903 Bacteria 1491
72 Ga0307407_10375627 3300031903 Bacteria 1013
73 Ga0307412_10005471 3300031911 Bacteria 7131
74 Ga0307412_10124033 3300031911 Bacteria 1865
75 Ga0307412_10441887 3300031911 Bacteria 1069
76 Ga0307412_11057662 3300031911 Bacteria 720
77 Ga0307412_11344388 3300031911 Bacteria 645
78 Ga0307409_100005251 3300031995 Bacteria 7424
79 Ga0307409_100011866 3300031995 Bacteria 5518
80 Ga0307409_100021121 3300031995 Bacteria 4456
81 Ga0307409_100148091 3300031995 Bacteria 2033
82 Ga0307409_100272146 3300031995 Bacteria 1560
83 Ga0307409_100347290 3300031995 Bacteria 1399
84 Ga0307409_100424721 3300031995 Bacteria 1276
85 Ga0307409_100436154 3300031995 Bacteria 1261
86 Ga0307409_100589033 3300031995 Bacteria 1097
87 Ga0307409_100795842 3300031995 Bacteria 953
88 Ga0307409_101786720 3300031995 Bacteria 644
89 Ga0307409_102126833 3300031995 Unclassified 591
90 Ga0307416_100038628 3300032002 Bacteria 3685
91 Ga0307416_100069395 3300032002 Bacteria 2916
92 Ga0307416_100072658 3300032002 Bacteria 2864
93 Ga0307416_100261809 3300032002 Bacteria 1691
94 Ga0307416_100557979 3300032002 Bacteria 1220
95 Ga0307416_100869254 3300032002 Bacteria 1000
96 Ga0307416_100964118 3300032002 Bacteria 955
97 Ga0307416_101228848 3300032002 Bacteria 855
98 Ga0307414_10096272 3300032004 Unclassified 2214
99 Ga0307414_10254702 3300032004 Bacteria 1461
100 Ga0307414_10405695 3300032004 Bacteria 1185
101 Ga0307414_10456289 3300032004 Bacteria 1122
102 Ga0307411_10033888 3300032005 Bacteria 3172
103 Ga0307411_10121231 3300032005 Bacteria 1892
104 Ga0307411_10618628 3300032005 Bacteria 933
105 Ga0307411_11413978 3300032005 Bacteria 637
106 Ga0307415_100003031 3300032126 Bacteria 8465
107 Ga0307415_100045839 3300032126 Bacteria 2934
108 Ga0307415_100045866 3300032126 Bacteria 2933
109 Ga0307415_100057792 3300032126 Bacteria 2667
110 Ga0307415_100104528 3300032126 Bacteria 2086
111 Ga0307415_100168270 3300032126 Bacteria 1706
112 Ga0307415_100223795 3300032126 Bacteria 1510
113 Ga0307415_100243058 3300032126 Bacteria 1457
114 Ga0307415_100602917 3300032126 Bacteria 978
115 Ga0307415_100715278 3300032126 Bacteria 905
116 Ga0307415_100870761 3300032126 Bacteria 828
117 Ga0395900_0262165 3300037418 Bacteria 1725
118 Ga0395898_0046758 3300037466 Bacteria 4250
119 Ga0436364_0389643 3300037853 Bacteria 8513
120 Ga0395901_0056268 3300038443 Bacteria 4091
121 Ga0436365_0437444 3300039437 Bacteria 1293
122 Ga0436365_1287118 3300039437 Bacteria 1681
123 Ga0451793_0700169 3300041452 Bacteria 1549
124 Ga0451795_0375606 3300041456 Bacteria 6723
125 Ga0451845_0550013 3300041501 Bacteria 1891
126 Ga0451843_0789120 3300041509 Unclassified 615
127 Ga0439450_080885 3300042008 Bacteria 808
128 Ga0439454_048725 3300042011 Unclassified 711
129 Ga0439463_070019 3300042016 Unclassified 899
130 Ga0439460_0162326 3300042461 Unclassified 750
131 Ga0466972_0086952 3300044658 Bacteria 1485
132 Ga0466965_0236160 3300044683 Bacteria 978
133 Ga0466966_0048914 3300044684 Bacteria 2693
134 Ga0466966_0529792 3300044684 Bacteria 709
135 Ga0466961_0081976 3300044693 Bacteria 2041
136 Ga0466961_0245544 3300044693 Bacteria 1100
137 Ga0466961_0368267 3300044693 Bacteria 873
138 Ga0466961_0560300 3300044693 Bacteria 688
139 Ga0466963_0039576 3300044694 Bacteria 3088
140 Ga0466963_0044460 3300044694 Bacteria 2924
141 Ga0466963_0076887 3300044694 Bacteria 2254
142 Ga0466963_0300308 3300044694 Bacteria 1129
143 Ga0466964_0076308 3300044706 Bacteria 1429
144 Ga0466971_0042831 3300044719 Bacteria 2035
145 Ga0466968_0207330 3300044735 Bacteria 920
146 Ga0466970_0030594 3300044765 Bacteria 2839
147 Ga0466970_0139686 3300044765 Bacteria 1334
148 Ga0466970_0189261 3300044765 Bacteria 1143
149 Ga0466970_0206516 3300044765 Bacteria 1094
150 Ga0466970_0233486 3300044765 Bacteria 1028
151 Ga0466970_0263131 3300044765 Unclassified 968
152 Ga0466970_0273386 3300044765 Bacteria 949
153 Ga0466957_0218801 3300044842 Bacteria 1257
154 Ga0466960_0113367 3300044901 Bacteria 1411
155 Ga0466960_0246637 3300044901 Bacteria 991
156 Ga0466960_0302174 3300044901 Bacteria 902
157 Ga0466960_0319710 3300044901 Bacteria 879
158 Ga0466960_0357379 3300044901 Bacteria 834
159 Ga0466959_0030135 3300045049 Bacteria 4018
160 Ga0466959_0203095 3300045049 Bacteria 1379
161 Ga0466958_0241214 3300045836 Bacteria 1155
162 Ga0466967_0047432 3300045976 Bacteria 3745
163 Ga0466967_0193966 3300045976 Bacteria 1921
164 Ga0466967_0348292 3300045976 Bacteria 1433
165 Ga0466967_0417557 3300045976 Bacteria 1307
166 Ga0495584_0100393 3300046491 Bacteria 1463
167 Ga0495620_0120548 3300046515 Bacteria 1034
168 Ga0495620_0131564 3300046515 Bacteria 982
169 Ga0495644_0235285 3300046523 Bacteria 710
170 Ga0495621_0026128 3300046539 Bacteria 1967
171 Ga0495611_0271195 3300046648 Bacteria 785
172 Ga0495661_0237064 3300046665 Bacteria 938
173 Ga0495604_0303402 3300047317 Bacteria 1072
174 Ga0495680_0956815 3300047322 Bacteria 550
175 Ga0496101_0656983 3300048904 Bacteria 828
176 Ga0496101_0907437 3300048904 Bacteria 694
177 Ga0496106_0149498 3300048909 Bacteria 1842
178 Ga0496107_0837778 3300048910 Bacteria 672
179 Ga0496109_0958026 3300048912 Bacteria 794
180 Ga0496110_0772926 3300048913 Bacteria 864
181 Ga0496114_0273982 3300048917 Bacteria 1487
182 Ga0496114_0298651 3300048917 Bacteria 1422
183 Ga0496114_0636298 3300048917 Bacteria 939
184 Ga0496114_0793892 3300048917 Bacteria 825
185 Ga0496122_0046009 3300048925 Bacteria 3385
186 Ga0496124_0102723 3300048927 Bacteria 2313
187 Ga0501311_031483 3300049527 Bacteria 770
188 Ga0501034_0003821 3300049571 Bacteria 16974
189 Ga0501067_0000245 3300049583 Bacteria 29979
190 Ga0501068_0009414 3300049584 Bacteria 5465
191 Ga0501069_0343240 3300049585 Bacteria 879
192 Ga0501070_0002662 3300049586 Bacteria 15585
193 Ga0501071_0048331 3300049587 Bacteria 3059
194 Ga0501072_0041267 3300049588 Bacteria 3624
195 Ga0501073_0009613 3300049589 Bacteria 7131
196 Ga0501074_0010693 3300049590 Bacteria 6663
197 Ga0501076_0568087 3300049592 Bacteria 935
198 Ga0501077_0050682 3300049593 Bacteria 2638
199 Ga0501079_0033916 3300049741 Bacteria 3927
200 Ga0501080_0000318 3300049742 Bacteria 36727
201 Ga0501083_0042658 3300049744 Bacteria 3074
202 Ga0501044_0162129 3300049823 Bacteria 2212
203 nmdc:mga00v17_554408_c1 3300050491 Bacteria 743
204 nmdc:mga00v17_62120_c1 3300050491 Bacteria 1830
205 nmdc:mga0yw44_309189_c1 3300050492 Bacteria 1060
206 Ga0495655_0004427 3300053083 Bacteria 2401
207 Ga0501084_0003551 3300054114 Bacteria 12667
208 Ga0501082_0001727 3300060353 Bacteria 19282

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031731 Ga0307405_10107477 Ga0307405_101074772 142
2 3300031824 Ga0307413_10110184 Ga0307413_101101842 142
3 3300031911 Ga0307412_10005471 Ga0307412_100054715 142
4 3300032005 Ga0307411_10121231 Ga0307411_101212312 142
5 3300031548 Ga0307408_100183863 Ga0307408_1001838632 144
6 3300047322 Ga0495680_0956815 Ga0495680_0956815_37_507 156
7 3300031852 Ga0307410_10521478 Ga0307410_105214782 159
8 3300044901 Ga0466960_0246637 Ga0466960_0246637_192_773 159
9 3300032002 Ga0307416_100557979 Ga0307416_1005579791 162
10 3300041509 Ga0451843_0789120 Ga0451843_0789120_29_517 162
11 3300031824 Ga0307413_10242497 Ga0307413_102424972 168
12 3300031852 Ga0307410_10198063 Ga0307410_101980631 168
13 3300031901 Ga0307406_10858145 Ga0307406_108581451 168
14 3300031911 Ga0307412_11057662 Ga0307412_110576621 168
15 3300031995 Ga0307409_100589033 Ga0307409_1005890331 168
16 3300032002 Ga0307416_101228848 Ga0307416_1012288481 168
17 3300032004 Ga0307414_10254702 Ga0307414_102547023 168
18 3300032126 Ga0307415_100223795 Ga0307415_1002237952 168
19 3300032126 Ga0307415_100243058 Ga0307415_1002430583 168
20 3300005364 Ga0070673_101536991 Ga0070673_1015369911 169
21 3300031852 Ga0307410_10093642 Ga0307410_100936423 169
22 3300032126 Ga0307415_100168270 Ga0307415_1001682702 169
23 3300049571 Ga0501034_0003821 Ga0501034_0003821_15146_15694 170
24 3300049583 Ga0501067_0000245 Ga0501067_0000245_7667_8215 170
25 3300049584 Ga0501068_0009414 Ga0501068_0009414_3116_3664 170
26 3300049585 Ga0501069_0343240 Ga0501069_0343240_303_851 170
27 3300049586 Ga0501070_0002662 Ga0501070_0002662_12032_12580 170
28 3300049587 Ga0501071_0048331 Ga0501071_0048331_1248_1796 170
29 3300049588 Ga0501072_0041267 Ga0501072_0041267_1180_1728 170
30 3300049589 Ga0501073_0009613 Ga0501073_0009613_5201_5749 170
31 3300049590 Ga0501074_0010693 Ga0501074_0010693_4122_4670 170
32 3300049592 Ga0501076_0568087 Ga0501076_0568087_248_796 170
33 3300049593 Ga0501077_0050682 Ga0501077_0050682_760_1308 170
34 3300049741 Ga0501079_0033916 Ga0501079_0033916_1998_2546 170
35 3300049742 Ga0501080_0000318 Ga0501080_0000318_32076_32624 170
36 3300049744 Ga0501083_0042658 Ga0501083_0042658_620_1168 170
37 3300049823 Ga0501044_0162129 Ga0501044_0162129_961_1509 170
38 3300054114 Ga0501084_0003551 Ga0501084_0003551_8005_8553 170
39 3300060353 Ga0501082_0001727 Ga0501082_0001727_18180_18728 170
40 3300044694 Ga0466963_0039576 Ga0466963_0039576_2223_2777 171
41 3300048925 Ga0496122_0046009 Ga0496122_0046009_2723_3310 171
42 3300044693 Ga0466961_0081976 Ga0466961_0081976_933_1487 172
43 3300044901 Ga0466960_0319710 Ga0466960_0319710_153_692 172
44 3300032126 Ga0307415_100602917 Ga0307415_1006029172 173
45 3300041452 Ga0451793_0700169 Ga0451793_0700169_877_1398 173
46 3300041456 Ga0451795_0375606 Ga0451795_0375606_1383_1904 173
47 3300041501 Ga0451845_0550013 Ga0451845_0550013_177_698 173
48 3300042011 Ga0439454_048725 Ga0439454_048725_12_533 173
49 3300045976 Ga0466967_0348292 Ga0466967_0348292_14_535 173
50 3300031995 Ga0307409_102126833 Ga0307409_1021268331 174
51 3300044658 Ga0466972_0086952 Ga0466972_0086952_906_1430 174
52 3300044765 Ga0466970_0030594 Ga0466970_0030594_607_1131 174
53 3300044901 Ga0466960_0357379 Ga0466960_0357379_21_545 174
54 3300045976 Ga0466967_0417557 Ga0466967_0417557_705_1229 174
55 3300048917 Ga0496114_0273982 Ga0496114_0273982_794_1345 175
56 3300031995 Ga0307409_100795842 Ga0307409_1007958422 176
57 3300046665 Ga0495661_0237064 Ga0495661_0237064_18_722 176
58 iso_pu_bacteria 2643221961 2645720046 178
59 iso_pu_bacteria 2643221962 2645726908 178
60 iso_pu_bacteria 2857481737 2857484857 178
61 iso_pu_bacteria 2902837492 2902843465 178
62 iso_pu_bacteria 2929212328 2929217556 178
63 iso_pu_bacteria 2974315732 2974320037 178
64 3300031824 Ga0307413_10028065 Ga0307413_100280651 179
65 3300031852 Ga0307410_10504017 Ga0307410_105040172 179
66 3300031901 Ga0307406_10023086 Ga0307406_100230864 179
67 3300031903 Ga0307407_10005476 Ga0307407_100054764 179
68 3300031903 Ga0307407_10064692 Ga0307407_100646921 179
69 3300031903 Ga0307407_10155344 Ga0307407_101553443 179
70 3300031995 Ga0307409_100148091 Ga0307409_1001480913 179
71 3300032002 Ga0307416_100069395 Ga0307416_1000693954 179
72 3300032002 Ga0307416_100869254 Ga0307416_1008692541 179
73 3300032004 Ga0307414_10456289 Ga0307414_104562891 179
74 3300032126 Ga0307415_100057792 Ga0307415_1000577921 179
75 3300032126 Ga0307415_100715278 Ga0307415_1007152782 179
76 3300044684 Ga0466966_0048914 Ga0466966_0048914_955_1494 179
77 3300044693 Ga0466961_0368267 Ga0466961_0368267_283_822 179
78 3300044694 Ga0466963_0076887 Ga0466963_0076887_1700_2239 179
79 3300044694 Ga0466963_0300308 Ga0466963_0300308_558_1097 179
80 3300044706 Ga0466964_0076308 Ga0466964_0076308_859_1398 179
81 3300044735 Ga0466968_0207330 Ga0466968_0207330_230_769 179
82 3300044765 Ga0466970_0273386 Ga0466970_0273386_345_884 179
83 3300044901 Ga0466960_0113367 Ga0466960_0113367_53_592 179
84 3300044901 Ga0466960_0302174 Ga0466960_0302174_351_890 179
85 3300045049 Ga0466959_0030135 Ga0466959_0030135_2065_2604 179
86 3300045049 Ga0466959_0203095 Ga0466959_0203095_51_590 179
87 3300045836 Ga0466958_0241214 Ga0466958_0241214_537_1076 179
88 3300045976 Ga0466967_0047432 Ga0466967_0047432_1525_2064 179
89 iso_pu_bacteria 2643221679 2644446648 179
90 iso_pu_bacteria 2643221697 2644538724 179
91 iso_pu_bacteria 2799112218 2799184618 180
92 iso_pu_bacteria 2915358134 2915364410 180
93 3300005466 Ga0070685_10223437 Ga0070685_102234371 181
94 3300025901 Ga0207688_10731092 Ga0207688_107310921 181
95 3300026121 Ga0207683_11669274 Ga0207683_116692741 181
96 3300048917 Ga0496114_0298651 Ga0496114_0298651_765_1310 181
97 3300048917 Ga0496114_0636298 Ga0496114_0636298_218_763 181
98 iso_pu_bacteria 2772190715 2772644560 181
99 iso_pu_bacteria 2831935698 2831940120 181
100 iso_pu_bacteria 2855670206 2855674555 181
101 iso_pu_bacteria 2855676851 2855678259 181
102 iso_pu_bacteria 2857288857 2857291763 181
103 iso_pu_bacteria 2858848962 2858855071 181
104 iso_pu_bacteria 2858882152 2858886016 181
105 iso_pu_bacteria 2858888857 2858889319 181
106 iso_pu_bacteria 2858895516 2858900530 181
107 iso_pu_bacteria 2869048445 2869054209 181
108 iso_pu_bacteria 2869061728 2869067654 181
109 iso_pu_bacteria 2869068681 2869073633 181
110 iso_pu_bacteria 2880489317 2880492407 181
111 iso_pu_bacteria 2880495981 2880499895 181
112 iso_pu_bacteria 2929226422 2929228458 181
113 iso_pu_bacteria 8003830390 8003831876 181
114 iso_pu_bacteria 8054704163 8054707327 181
115 iso_pu_bacteria 8054734606 8054738475 181
116 3300005354 Ga0070675_101120119 Ga0070675_1011201191 182
117 3300005456 Ga0070678_101303206 Ga0070678_1013032061 182
118 3300005546 Ga0070696_100406896 Ga0070696_1004068961 182
119 3300005614 Ga0068856_100931360 Ga0068856_1009313601 182
120 3300005614 Ga0068856_101327766 Ga0068856_1013277661 182
121 3300006881 Ga0068865_100126119 Ga0068865_1001261193 182
122 3300009177 Ga0105248_10372441 Ga0105248_103724412 182
123 3300013306 Ga0163162_10479302 Ga0163162_104793021 182
124 3300013307 Ga0157372_10324402 Ga0157372_103244021 182
125 3300013308 Ga0157375_10362329 Ga0157375_103623292 182
126 3300021388 Ga0213875_10146764 Ga0213875_101467642 182
127 3300025899 Ga0207642_10421843 Ga0207642_104218431 182
128 3300026078 Ga0207702_10311953 Ga0207702_103119532 182
129 3300031731 Ga0307405_10118422 Ga0307405_101184222 182
130 3300031731 Ga0307405_10389969 Ga0307405_103899692 182
131 3300031824 Ga0307413_10420409 Ga0307413_104204091 182
132 3300031901 Ga0307406_10174807 Ga0307406_101748072 182
133 3300031901 Ga0307406_10326759 Ga0307406_103267592 182
134 3300031903 Ga0307407_10016356 Ga0307407_100163564 182
135 3300031903 Ga0307407_10136861 Ga0307407_101368612 182
136 3300031911 Ga0307412_10124033 Ga0307412_101240332 182
137 3300031911 Ga0307412_10441887 Ga0307412_104418871 182
138 3300031911 Ga0307412_11344388 Ga0307412_113443882 182
139 3300031995 Ga0307409_100005251 Ga0307409_1000052511 182
140 3300031995 Ga0307409_100272146 Ga0307409_1002721462 182
141 3300031995 Ga0307409_100347290 Ga0307409_1003472902 182
142 3300031995 Ga0307409_100436154 Ga0307409_1004361541 182
143 3300032002 Ga0307416_100038628 Ga0307416_1000386284 182
144 3300032002 Ga0307416_100072658 Ga0307416_1000726583 182
145 3300032004 Ga0307414_10405695 Ga0307414_104056952 182
146 3300032005 Ga0307411_10033888 Ga0307411_100338882 182
147 3300032005 Ga0307411_11413978 Ga0307411_114139781 182
148 3300032126 Ga0307415_100003031 Ga0307415_1000030317 182
149 3300032126 Ga0307415_100104528 Ga0307415_1001045283 182
150 3300037853 Ga0436364_0389643 Ga0436364_0389643_7879_8427 182
151 3300039437 Ga0436365_0437444 Ga0436365_0437444_602_1150 182
152 3300044683 Ga0466965_0236160 Ga0466965_0236160_364_912 182
153 3300044693 Ga0466961_0560300 Ga0466961_0560300_85_633 182
154 3300044765 Ga0466970_0189261 Ga0466970_0189261_436_984 182
155 3300044765 Ga0466970_0206516 Ga0466970_0206516_136_684 182
156 3300044765 Ga0466970_0233486 Ga0466970_0233486_36_584 182
157 3300044765 Ga0466970_0263131 Ga0466970_0263131_76_624 182
158 3300044842 Ga0466957_0218801 Ga0466957_0218801_282_830 182
159 3300045976 Ga0466967_0193966 Ga0466967_0193966_946_1494 182
160 3300046515 Ga0495620_0120548 Ga0495620_0120548_210_758 182
161 3300046539 Ga0495621_0026128 Ga0495621_0026128_589_1137 182
162 3300047317 Ga0495604_0303402 Ga0495604_0303402_62_610 182
163 3300048904 Ga0496101_0656983 Ga0496101_0656983_42_590 182
164 3300048904 Ga0496101_0907437 Ga0496101_0907437_103_651 182
165 3300048909 Ga0496106_0149498 Ga0496106_0149498_785_1333 182
166 3300048910 Ga0496107_0837778 Ga0496107_0837778_54_602 182
167 3300048913 Ga0496110_0772926 Ga0496110_0772926_62_610 182
168 3300048917 Ga0496114_0793892 Ga0496114_0793892_215_763 182
169 3300048927 Ga0496124_0102723 Ga0496124_0102723_1378_1926 182
170 3300006038 Ga0075365_10244157 Ga0075365_102441571 183
171 3300006051 Ga0075364_10179612 Ga0075364_101796122 183
172 3300031852 Ga0307410_10840547 Ga0307410_108405472 183
173 3300032002 Ga0307416_100261809 Ga0307416_1002618092 183
174 3300032126 Ga0307415_100045839 Ga0307415_1000458394 183
175 3300050491 nmdc:mga00v17_62120_c1 nmdc:mga00v17_62120_c1_730_1281 183
176 3300050492 nmdc:mga0yw44_309189_c1 nmdc:mga0yw44_309189_c1_342_893 183
177 3300005530 Ga0070679_100146036 Ga0070679_1001460363 184
178 3300005548 Ga0070665_100471951 Ga0070665_1004719512 184
179 3300009147 Ga0114129_10318775 Ga0114129_103187751 184
180 3300014325 Ga0163163_10903504 Ga0163163_109035041 184
181 3300022467 Ga0224712_10009667 Ga0224712_100096672 184
182 3300031548 Ga0307408_100101214 Ga0307408_1001012143 184
183 3300031731 Ga0307405_10008961 Ga0307405_100089614 184
184 3300031852 Ga0307410_10014034 Ga0307410_100140344 184
185 3300031852 Ga0307410_10037548 Ga0307410_100375483 184
186 3300031901 Ga0307406_10038470 Ga0307406_100384702 184
187 3300031903 Ga0307407_10039666 Ga0307407_100396663 184
188 3300031903 Ga0307407_10375627 Ga0307407_103756271 184
189 3300031995 Ga0307409_100011866 Ga0307409_1000118663 184
190 3300031995 Ga0307409_100021121 Ga0307409_1000211213 184
191 3300031995 Ga0307409_100424721 Ga0307409_1004247212 184
192 3300031995 Ga0307409_101786720 Ga0307409_1017867201 184
193 3300032002 Ga0307416_100964118 Ga0307416_1009641181 184
194 3300032004 Ga0307414_10096272 Ga0307414_100962721 184
195 3300032005 Ga0307411_10618628 Ga0307411_106186281 184
196 3300032126 Ga0307415_100870761 Ga0307415_1008707611 184
197 3300039437 Ga0436365_1287118 Ga0436365_1287118_846_1400 184
198 3300042008 Ga0439450_080885 Ga0439450_080885_67_624 184
199 3300042016 Ga0439463_070019 Ga0439463_070019_19_576 184
200 3300042461 Ga0439460_0162326 Ga0439460_0162326_19_576 184
201 3300044684 Ga0466966_0529792 Ga0466966_0529792_111_686 184
202 3300044693 Ga0466961_0245544 Ga0466961_0245544_281_856 184
203 3300044694 Ga0466963_0044460 Ga0466963_0044460_34_609 184
204 3300044719 Ga0466971_0042831 Ga0466971_0042831_504_1079 184
205 3300044765 Ga0466970_0139686 Ga0466970_0139686_143_697 184
206 3300046515 Ga0495620_0131564 Ga0495620_0131564_335_940 184
207 3300046523 Ga0495644_0235285 Ga0495644_0235285_23_580 184
208 3300046648 Ga0495611_0271195 Ga0495611_0271195_59_616 184
209 3300049527 Ga0501311_031483 Ga0501311_031483_26_583 184
210 3300053083 Ga0495655_0004427 Ga0495655_0004427_91_663 184
211 3300003373 JGI25407J50210_10044808 JGI25407J50210_100448081 185
212 3300003373 JGI25407J50210_10045692 JGI25407J50210_100456922 185
213 3300005337 Ga0070682_100787425 Ga0070682_1007874251 185
214 3300005356 Ga0070674_101095363 Ga0070674_1010953631 185
215 3300005364 Ga0070673_100953354 Ga0070673_1009533541 185
216 3300005985 Ga0081539_10142400 Ga0081539_101424002 185
217 3300009098 Ga0105245_10700713 Ga0105245_107007132 185
218 3300009177 Ga0105248_11497787 Ga0105248_114977871 185
219 3300009551 Ga0105238_10525655 Ga0105238_105256552 185
220 3300010375 Ga0105239_10818526 Ga0105239_108185261 185
221 3300013307 Ga0157372_10648729 Ga0157372_106487291 185
222 3300025927 Ga0207687_10892338 Ga0207687_108923381 185
223 3300025937 Ga0207669_10588353 Ga0207669_105883532 185
224 3300031889 Ga0326468_10002486 Ga0326468_100024862 185
225 3300046491 Ga0495584_0100393 Ga0495584_0100393_519_1079 185
226 3300048912 Ga0496109_0958026 Ga0496109_0958026_164_721 185
227 3300050491 nmdc:mga00v17_554408_c1 nmdc:mga00v17_554408_c1_40_669 185
228 3300003373 JGI25407J50210_10012998 JGI25407J50210_100129982 186
229 3300003373 JGI25407J50210_10018608 JGI25407J50210_100186083 186
230 3300005981 Ga0081538_10008357 Ga0081538_100083578 186
231 3300005981 Ga0081538_10008425 Ga0081538_1000842511 186
232 3300014326 Ga0157380_10609141 Ga0157380_106091412 186
233 3300032126 Ga0307415_100045866 Ga0307415_1000458664 186
234 3300037418 Ga0395900_0262165 Ga0395900_0262165_445_1059 186
235 3300037466 Ga0395898_0046758 Ga0395898_0046758_3575_4189 186
236 3300038443 Ga0395901_0056268 Ga0395901_0056268_3024_3638 186

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xra-assembly1.cif.gz_A crystal structure of the hk20 fab in complex with a gp41 mimetic 5- helix 0.709 42 168
4lws-assembly3.cif.gz_A esxa : esxb (semet) hetero-dimer from thermomonospora curvata 0.6696 90 179
4xev-assembly1.cif.gz_A fusion of pyk2-fat domain with leupaxin ld1 motif, complexed with leupaxin ld4 peptide 0.6404 14 164
3gm2-assembly1.cif.gz_A crystal structure of the focal adhesion targeting (fat) domain of pyk2 0.6295 17 164
6egc-assembly1.cif.gz_A single-chain version of 2l4hc2_23 (pdb 5j0k) 0.6163 7 167
ID Description Score Start End Superfamily
1fs0G02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain 0.7256 89 168 1.10.287.80
af_I1JRZ9_200_386_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6999 7 182 1.20.120.1770
1fs0G02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain 0.6508 89 168 1.10.287.80
4xevA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.6404 14 164 1.20.120.330
af_A0A1D6E7A2_231_412_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6391 1 182 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A561SVQ3-F1-model_v4 Uncharacterized protein 0.9862 2 173 GO:0016020
AF-A0A259SRI7-F1-model_v4 Uncharacterized protein 0.9734 3 105 GO:0016020
AF-A0A838KIQ4-F1-model_v4 DUF4235 domain-containing protein 0.9705 6 149
AF-A0A7G6Z0X8-F1-model_v4 DUF2269 family protein 0.9683 13 172
AF-A0A853D7N5-F1-model_v4 Uncharacterized protein 0.9656 26 173

Feature Viewer

pLDDT pTM Quality
88.34 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map