F349078
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 236 | 157 | 227 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300013102|Ga0157371_10005704|Ga0157371_100057048 |
| Length | 176 |
| Sequence | MTPLHQIFDRPVFRREIILHYPHDVTESVEVLLLGDTVPAYSHPGDAGADLTAAEAVILEPGRRATVGTGLSIALPDGYVAFVVPRSGLAASHGITIVNSPGTVDAGYRGEIRVTLLNTDSSVPYSVAVGDRIAQLIVMPVSRAKFIPVETLPGSHRGSGGFGSTGYRDTKQGDRQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 2 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 3 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 4 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 5 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 6 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 7 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 8 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 9 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 10 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 13 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 33 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 34 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 35 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 36 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 49 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 50 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 51 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 52 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 53 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 54 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 55 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 56 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 81 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 82 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 83 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 84 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 85 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 86 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 87 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 88 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 89 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 90 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 91 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 92 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 93 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 94 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 95 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 96 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 97 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 98 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 99 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 100 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 101 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 102 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 103 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 104 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 113 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 114 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 115 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 116 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 117 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 118 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 119 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 120 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 121 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 122 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 145 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 146 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 147 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 148 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 149 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 150 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 151 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 152 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 153 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 154 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 155 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 157 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.95 |
| Metatranscriptomes | 4.24 |
| Isolates | 3.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.25 |
| Nodule | 0 |
| Rhizoplane | 3.39 |
| Rhizosphere | 72.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10006767 | 3300001979 | Bacteria | 4712 |
| 2 | JGI24739J22299_10041193 | 3300001989 | Bacteria | 1538 |
| 3 | JGI24737J22298_10021425 | 3300001990 | Bacteria | 2060 |
| 4 | JGI24735J21928_10002575 | 3300002067 | Bacteria | 6274 |
| 5 | Ga0006562J51391_1012007 | 3300003578 | Bacteria | 2021 |
| 6 | Ga0006562J51391_1012008 | 3300003578 | Bacteria | 1820 |
| 7 | Ga0055539_1000008 | 3300003752 | Bacteria | 537665 |
| 8 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 9 | Ga0055525_1000540 | 3300003759 | Bacteria | 17989 |
| 10 | Ga0055529_1011448 | 3300003763 | Bacteria | 1141 |
| 11 | Ga0055541_1014290 | 3300003841 | Bacteria | 1083 |
| 12 | Ga0070658_10000357 | 3300005327 | Bacteria | 39707 |
| 13 | Ga0070658_10037649 | 3300005327 | Bacteria | 3900 |
| 14 | Ga0070658_10842791 | 3300005327 | Bacteria | 797 |
| 15 | Ga0070658_10856448 | 3300005327 | Bacteria | 790 |
| 16 | Ga0070682_100453839 | 3300005337 | Bacteria | 982 |
| 17 | Ga0068868_100022656 | 3300005338 | Bacteria | 4745 |
| 18 | Ga0070659_100028959 | 3300005366 | Bacteria | 4278 |
| 19 | Ga0070667_100048971 | 3300005367 | Bacteria | 3558 |
| 20 | Ga0070714_100113848 | 3300005435 | Bacteria | 2399 |
| 21 | Ga0070701_10201030 | 3300005438 | Bacteria | 1178 |
| 22 | Ga0070663_100162894 | 3300005455 | Bacteria | 1718 |
| 23 | Ga0070663_100216253 | 3300005455 | Bacteria | 1503 |
| 24 | Ga0070663_100676241 | 3300005455 | Bacteria | 875 |
| 25 | Ga0070662_100660100 | 3300005457 | Bacteria | 883 |
| 26 | Ga0068853_100480482 | 3300005539 | Unclassified | 1171 |
| 27 | Ga0068855_100168691 | 3300005563 | Bacteria | 2479 |
| 28 | Ga0068857_100576793 | 3300005577 | Bacteria | 1061 |
| 29 | Ga0068856_100157842 | 3300005614 | Bacteria | 2278 |
| 30 | Ga0068870_10013914 | 3300005840 | Bacteria | 3790 |
| 31 | Ga0075365_10057042 | 3300006038 | Bacteria | 2598 |
| 32 | Ga0075365_10589651 | 3300006038 | Bacteria | 786 |
| 33 | Ga0075364_10065689 | 3300006051 | Bacteria | 2382 |
| 34 | Ga0075370_10079816 | 3300006353 | Bacteria | 1880 |
| 35 | Ga0111539_10220874 | 3300009094 | Bacteria | 2207 |
| 36 | Ga0114129_10200773 | 3300009147 | Bacteria | 2701 |
| 37 | Ga0105243_10103794 | 3300009148 | Bacteria | 2365 |
| 38 | Ga0105239_12884330 | 3300010375 | Bacteria | 561 |
| 39 | Ga0105239_12944873 | 3300010375 | Bacteria | 555 |
| 40 | Ga0105246_10636056 | 3300011119 | Bacteria | 927 |
| 41 | Ga0105246_11512897 | 3300011119 | Bacteria | 631 |
| 42 | Ga0157371_10005704 | 3300013102 | Bacteria | 10437 |
| 43 | Ga0157371_10492309 | 3300013102 | Bacteria | 905 |
| 44 | Ga0157370_10001218 | 3300013104 | Bacteria | 32238 |
| 45 | Ga0157369_10033100 | 3300013105 | Bacteria | 5682 |
| 46 | Ga0157369_10195088 | 3300013105 | Bacteria | 2127 |
| 47 | Ga0157372_10982926 | 3300013307 | Bacteria | 978 |
| 48 | Ga0157380_10027697 | 3300014326 | Bacteria | 4312 |
| 49 | Ga0157379_10057343 | 3300014968 | Bacteria | 3481 |
| 50 | Ga0163161_11041420 | 3300017792 | Bacteria | 700 |
| 51 | Ga0197907_11398818 | 3300020069 | Bacteria | 2745 |
| 52 | Ga0206356_10393866 | 3300020070 | Bacteria | 2422 |
| 53 | Ga0206355_1066417 | 3300020076 | Bacteria | 1780 |
| 54 | Ga0206351_10570854 | 3300020077 | Bacteria | 1417 |
| 55 | Ga0206352_10157244 | 3300020078 | Bacteria | 818 |
| 56 | Ga0206354_10519915 | 3300020081 | Bacteria | 2916 |
| 57 | Ga0206353_10477024 | 3300020082 | Bacteria | 10918 |
| 58 | Ga0224712_10068573 | 3300022467 | Bacteria | 1434 |
| 59 | Ga0209566_100149 | 3300025225 | Bacteria | 81626 |
| 60 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 61 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 62 | Ga0209563_101058 | 3300025230 | Bacteria | 7957 |
| 63 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 64 | Ga0209677_101706 | 3300025253 | Bacteria | 9142 |
| 65 | Ga0209455_1007291 | 3300025272 | Bacteria | 3142 |
| 66 | Ga0207647_10155684 | 3300025904 | Bacteria | 1334 |
| 67 | Ga0207645_10527061 | 3300025907 | Bacteria | 801 |
| 68 | Ga0207705_10000006 | 3300025909 | Bacteria | 657147 |
| 69 | Ga0207705_10020182 | 3300025909 | Bacteria | 4767 |
| 70 | Ga0207705_10915233 | 3300025909 | Bacteria | 679 |
| 71 | Ga0207657_10011960 | 3300025919 | Bacteria | 8588 |
| 72 | Ga0207657_10220068 | 3300025919 | Bacteria | 1521 |
| 73 | Ga0207694_10131794 | 3300025924 | Bacteria | 2004 |
| 74 | Ga0207664_10675291 | 3300025929 | Bacteria | 929 |
| 75 | Ga0207690_10009072 | 3300025932 | Bacteria | 5903 |
| 76 | Ga0207706_10467641 | 3300025933 | Bacteria | 1090 |
| 77 | Ga0207709_10239355 | 3300025935 | Bacteria | 1319 |
| 78 | Ga0207667_10035112 | 3300025949 | Bacteria | 5380 |
| 79 | Ga0207668_10064433 | 3300025972 | Bacteria | 2590 |
| 80 | Ga0207658_10145759 | 3300025986 | Bacteria | 1922 |
| 81 | Ga0207677_10013148 | 3300026023 | Bacteria | 4786 |
| 82 | Ga0207678_10166457 | 3300026067 | Bacteria | 1882 |
| 83 | Ga0207708_10282529 | 3300026075 | Bacteria | 1345 |
| 84 | Ga0207702_10263586 | 3300026078 | Bacteria | 1623 |
| 85 | Ga0207674_10371322 | 3300026116 | Bacteria | 1383 |
| 86 | Ga0207675_100309403 | 3300026118 | Bacteria | 1540 |
| 87 | Ga0207698_10176453 | 3300026142 | Bacteria | 1887 |
| 88 | Ga0307515_10333865 | 3300028794 | Bacteria | 1173 |
| 89 | Ga0307408_100577358 | 3300031548 | Bacteria | 996 |
| 90 | Ga0307514_10003426 | 3300031649 | Bacteria | 15254 |
| 91 | Ga0307407_10131546 | 3300031903 | Bacteria | 1602 |
| 92 | Ga0316574_0142605 | 3300035398 | Bacteria | 1544 |
| 93 | Ga0395899_0006790 | 3300037312 | Bacteria | 8869 |
| 94 | Ga0395900_0457767 | 3300037418 | Bacteria | 1231 |
| 95 | Ga0395898_0268266 | 3300037466 | Bacteria | 1628 |
| 96 | Ga0395901_0773546 | 3300038443 | Bacteria | 951 |
| 97 | Ga0451787_166805 | 3300041441 | Bacteria | 1051 |
| 98 | Ga0451787_305493 | 3300041441 | Bacteria | 819 |
| 99 | Ga0451793_0277642 | 3300041452 | Bacteria | 714 |
| 100 | Ga0451793_0374260 | 3300041452 | Bacteria | 1010 |
| 101 | Ga0451793_0463249 | 3300041452 | Bacteria | 1166 |
| 102 | Ga0466972_0011422 | 3300044658 | Bacteria | 4458 |
| 103 | Ga0466972_0108177 | 3300044658 | Bacteria | 1314 |
| 104 | Ga0466972_0181501 | 3300044658 | Bacteria | 987 |
| 105 | Ga0466965_0049077 | 3300044683 | Bacteria | 2092 |
| 106 | Ga0466966_0089644 | 3300044684 | Bacteria | 1910 |
| 107 | Ga0466961_0023766 | 3300044693 | Bacteria | 3944 |
| 108 | Ga0466961_0238433 | 3300044693 | Bacteria | 1118 |
| 109 | Ga0466961_0249937 | 3300044693 | Bacteria | 1089 |
| 110 | Ga0466964_0114059 | 3300044706 | Bacteria | 1209 |
| 111 | Ga0466971_0042670 | 3300044719 | Bacteria | 2038 |
| 112 | Ga0466971_0163513 | 3300044719 | Bacteria | 1042 |
| 113 | Ga0466968_0031361 | 3300044735 | Bacteria | 2205 |
| 114 | Ga0466970_0015577 | 3300044765 | Bacteria | 3913 |
| 115 | Ga0466970_0065694 | 3300044765 | Bacteria | 1947 |
| 116 | Ga0466970_0201068 | 3300044765 | Bacteria | 1108 |
| 117 | Ga0466957_0034826 | 3300044842 | Bacteria | 3020 |
| 118 | Ga0466957_0410106 | 3300044842 | Bacteria | 928 |
| 119 | Ga0466960_0022183 | 3300044901 | Bacteria | 2835 |
| 120 | Ga0466959_0086827 | 3300045049 | Bacteria | 2250 |
| 121 | Ga0466958_0146080 | 3300045836 | Bacteria | 1490 |
| 122 | Ga0466967_2588165 | 3300045976 | Bacteria | 502 |
| 123 | Ga0495638_0070715 | 3300046460 | Bacteria | 2136 |
| 124 | Ga0495650_0003791 | 3300046471 | Bacteria | 10772 |
| 125 | Ga0495606_0505035 | 3300046507 | Bacteria | 610 |
| 126 | Ga0495644_0043531 | 3300046523 | Bacteria | 1689 |
| 127 | Ga0495656_0279847 | 3300046615 | Bacteria | 850 |
| 128 | Ga0495668_0807403 | 3300046616 | Bacteria | 520 |
| 129 | Ga0495672_0004830 | 3300047320 | Bacteria | 10862 |
| 130 | Ga0495686_0113121 | 3300047472 | Bacteria | 1625 |
| 131 | Ga0495686_0176768 | 3300047472 | Bacteria | 1239 |
| 132 | Ga0496103_0486921 | 3300048906 | Bacteria | 790 |
| 133 | Ga0496113_0235358 | 3300048916 | Bacteria | 1461 |
| 134 | Ga0496114_0943216 | 3300048917 | Bacteria | 745 |
| 135 | Ga0496117_0043480 | 3300048920 | Bacteria | 3265 |
| 136 | Ga0496119_0288090 | 3300048922 | Bacteria | 814 |
| 137 | Ga0496121_0000076 | 3300048924 | Bacteria | 239775 |
| 138 | Ga0496121_0097701 | 3300048924 | Bacteria | 2275 |
| 139 | Ga0496121_0170228 | 3300048924 | Bacteria | 1583 |
| 140 | Ga0496121_0501623 | 3300048924 | Bacteria | 770 |
| 141 | Ga0496122_0001724 | 3300048925 | Bacteria | 33920 |
| 142 | Ga0496122_0017756 | 3300048925 | Bacteria | 6623 |
| 143 | Ga0496123_0005747 | 3300048926 | Bacteria | 12346 |
| 144 | Ga0496123_0301073 | 3300048926 | Bacteria | 765 |
| 145 | Ga0496124_0268850 | 3300048927 | Bacteria | 1250 |
| 146 | Ga0496125_0083890 | 3300048928 | Bacteria | 2422 |
| 147 | Ga0496125_0355753 | 3300048928 | Bacteria | 873 |
| 148 | Ga0501031_0883108 | 3300049568 | Bacteria | 572 |
| 149 | Ga0501032_0088995 | 3300049569 | Bacteria | 2050 |
| 150 | Ga0501032_0303533 | 3300049569 | Bacteria | 1032 |
| 151 | Ga0501033_0007694 | 3300049570 | Bacteria | 8360 |
| 152 | Ga0501033_0187696 | 3300049570 | Bacteria | 1480 |
| 153 | Ga0501034_0004595 | 3300049571 | Bacteria | 15293 |
| 154 | Ga0501034_0064451 | 3300049571 | Bacteria | 3678 |
| 155 | Ga0501034_0141868 | 3300049571 | Bacteria | 2381 |
| 156 | Ga0501034_0145720 | 3300049571 | Bacteria | 2345 |
| 157 | Ga0501034_0299039 | 3300049571 | Bacteria | 1546 |
| 158 | Ga0501034_0345938 | 3300049571 | Bacteria | 1416 |
| 159 | Ga0501034_0363094 | 3300049571 | Bacteria | 1375 |
| 160 | Ga0501034_0455636 | 3300049571 | Bacteria | 1196 |
| 161 | Ga0501034_0521176 | 3300049571 | Bacteria | 1100 |
| 162 | Ga0501034_0787171 | 3300049571 | Bacteria | 844 |
| 163 | Ga0501036_0183690 | 3300049572 | Bacteria | 1760 |
| 164 | Ga0501036_0848391 | 3300049572 | Bacteria | 751 |
| 165 | Ga0501036_1342449 | 3300049572 | Bacteria | 580 |
| 166 | Ga0501037_0005372 | 3300049573 | Bacteria | 9324 |
| 167 | Ga0501037_0060557 | 3300049573 | Bacteria | 2761 |
| 168 | Ga0501037_0132826 | 3300049573 | Bacteria | 1784 |
| 169 | Ga0501037_0279039 | 3300049573 | Bacteria | 1164 |
| 170 | Ga0501038_0032754 | 3300049574 | Bacteria | 4582 |
| 171 | Ga0501038_0065017 | 3300049574 | Bacteria | 3109 |
| 172 | Ga0501038_1278288 | 3300049574 | Bacteria | 530 |
| 173 | Ga0501039_0910722 | 3300049575 | Bacteria | 684 |
| 174 | Ga0501043_0071612 | 3300049579 | Bacteria | 2722 |
| 175 | Ga0501043_0218436 | 3300049579 | Bacteria | 1475 |
| 176 | Ga0501043_0482484 | 3300049579 | Bacteria | 928 |
| 177 | Ga0501043_0639072 | 3300049579 | Bacteria | 782 |
| 178 | Ga0501043_1144056 | 3300049579 | Bacteria | 548 |
| 179 | Ga0501047_0003353 | 3300049581 | Bacteria | 15171 |
| 180 | Ga0501047_0146426 | 3300049581 | Bacteria | 2238 |
| 181 | Ga0501047_0153127 | 3300049581 | Bacteria | 2180 |
| 182 | Ga0501067_0045424 | 3300049583 | Bacteria | 2439 |
| 183 | Ga0501067_0257590 | 3300049583 | Bacteria | 971 |
| 184 | Ga0501068_0858486 | 3300049584 | Bacteria | 596 |
| 185 | Ga0501069_0311344 | 3300049585 | Bacteria | 924 |
| 186 | Ga0501070_0168702 | 3300049586 | Bacteria | 1803 |
| 187 | Ga0501070_0619877 | 3300049586 | Bacteria | 861 |
| 188 | Ga0501071_0000694 | 3300049587 | Bacteria | 17628 |
| 189 | Ga0501072_0025369 | 3300049588 | Bacteria | 4618 |
| 190 | Ga0501073_0025509 | 3300049589 | Bacteria | 4238 |
| 191 | Ga0501074_0221260 | 3300049590 | Bacteria | 1348 |
| 192 | Ga0501074_0279724 | 3300049590 | Bacteria | 1186 |
| 193 | Ga0501079_0321344 | 3300049741 | Bacteria | 1212 |
| 194 | Ga0501079_0759368 | 3300049741 | Bacteria | 763 |
| 195 | Ga0501080_0056517 | 3300049742 | Bacteria | 3654 |
| 196 | Ga0501080_0278594 | 3300049742 | Bacteria | 1521 |
| 197 | Ga0501080_0999844 | 3300049742 | Bacteria | 725 |
| 198 | Ga0501035_0007821 | 3300049822 | Bacteria | 9989 |
| 199 | Ga0501035_0025716 | 3300049822 | Bacteria | 5395 |
| 200 | Ga0501035_0315906 | 3300049822 | Bacteria | 1313 |
| 201 | Ga0501044_0008083 | 3300049823 | Bacteria | 11549 |
| 202 | Ga0501044_0036446 | 3300049823 | Bacteria | 5146 |
| 203 | Ga0501044_0120597 | 3300049823 | Bacteria | 2624 |
| 204 | Ga0501044_0136145 | 3300049823 | Bacteria | 2447 |
| 205 | Ga0501044_0540696 | 3300049823 | Bacteria | 1063 |
| 206 | nmdc:mga0yw44_807114_c1 | 3300050492 | Bacteria | 637 |
| 207 | nmdc:mga0yw44_97073_c1 | 3300050492 | Bacteria | 1871 |
| 208 | nmdc:mga07m45_128964_c1 | 3300050496 | Bacteria | 1463 |
| 209 | Ga0500650_0007175 | 3300053098 | Bacteria | 4319 |
| 210 | Ga0500556_0000001 | 3300053104 | Bacteria | 1135060 |
| 211 | Ga0500626_233275 | 3300053128 | Bacteria | 699 |
| 212 | Ga0500652_234453 | 3300053131 | Bacteria | 733 |
| 213 | Ga0500559_0192421 | 3300053136 | Bacteria | 961 |
| 214 | Ga0500568_0000006 | 3300053139 | Bacteria | 522235 |
| 215 | Ga0500568_0000158 | 3300053139 | Bacteria | 58729 |
| 216 | Ga0500568_0009401 | 3300053139 | Bacteria | 4649 |
| 217 | Ga0500573_0000013 | 3300053140 | Bacteria | 196637 |
| 218 | Ga0500573_0000719 | 3300053140 | Bacteria | 14727 |
| 219 | Ga0500573_0033318 | 3300053140 | Bacteria | 2973 |
| 220 | Ga0500573_0042039 | 3300053140 | Bacteria | 2640 |
| 221 | Ga0500573_0122146 | 3300053140 | Bacteria | 1449 |
| 222 | Ga0500577_0030771 | 3300053142 | Bacteria | 1871 |
| 223 | Ga0500577_0062855 | 3300053142 | Bacteria | 1433 |
| 224 | Ga0500577_0312004 | 3300053142 | Bacteria | 687 |
| 225 | Ga0500616_0000021 | 3300053153 | Bacteria | 484527 |
| 226 | Ga0501084_0345582 | 3300054114 | Bacteria | 1257 |
| 227 | Ga0466962_0013877 | 3300061719 | Bacteria | 3880 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_10200773 | Ga0114129_102007734 | 137 |
| 2 | 3300041452 | Ga0451793_0374260 | Ga0451793_0374260_256_687 | 141 |
| 3 | 3300035398 | Ga0316574_0142605 | Ga0316574_0142605_61_504 | 142 |
| 4 | 3300053098 | Ga0500650_0007175 | Ga0500650_0007175_487_927 | 145 |
| 5 | 3300053142 | Ga0500577_0030771 | Ga0500577_0030771_825_1265 | 145 |
| 6 | 3300053142 | Ga0500577_0062855 | Ga0500577_0062855_429_869 | 145 |
| 7 | 3300041441 | Ga0451787_305493 | Ga0451787_305493_80_529 | 146 |
| 8 | 3300044658 | Ga0466972_0181501 | Ga0466972_0181501_162_605 | 146 |
| 9 | 3300044693 | Ga0466961_0249937 | Ga0466961_0249937_228_671 | 146 |
| 10 | 3300044719 | Ga0466971_0163513 | Ga0466971_0163513_115_558 | 146 |
| 11 | 3300044765 | Ga0466970_0065694 | Ga0466970_0065694_470_913 | 146 |
| 12 | 3300044842 | Ga0466957_0410106 | Ga0466957_0410106_351_794 | 146 |
| 13 | 3300006051 | Ga0075364_10065689 | Ga0075364_100656894 | 147 |
| 14 | 3300013307 | Ga0157372_10982926 | Ga0157372_109829262 | 147 |
| 15 | 3300047320 | Ga0495672_0004830 | Ga0495672_0004830_10240_10746 | 147 |
| 16 | 3300048906 | Ga0496103_0486921 | Ga0496103_0486921_267_716 | 147 |
| 17 | 3300053128 | Ga0500626_233275 | Ga0500626_233275_134_586 | 147 |
| 18 | 3300053131 | Ga0500652_234453 | Ga0500652_234453_215_667 | 147 |
| 19 | iso_pu_bacteria | 2643221572 | 2643875033 | 147 |
| 20 | iso_pu_bacteria | 2643221669 | 2644382089 | 147 |
| 21 | iso_pu_bacteria | 2808606372 | 2808901883 | 147 |
| 22 | iso_pu_bacteria | 2844841374 | 2844842670 | 147 |
| 23 | iso_pu_bacteria | 2895660088 | 2895661159 | 147 |
| 24 | iso_pu_bacteria | 2919055335 | 2919058355 | 147 |
| 25 | iso_pu_bacteria | 2919523602 | 2919524746 | 147 |
| 26 | iso_pu_bacteria | 2928153084 | 2928156331 | 147 |
| 27 | iso_pu_bacteria | 8057345674 | 8057348816 | 147 |
| 28 | 3300049571 | Ga0501034_0787171 | Ga0501034_0787171_235_681 | 148 |
| 29 | 3300006038 | Ga0075365_10589651 | Ga0075365_105896511 | 149 |
| 30 | 3300048917 | Ga0496114_0943216 | Ga0496114_0943216_89_562 | 149 |
| 31 | 3300048924 | Ga0496121_0097701 | Ga0496121_0097701_782_1231 | 149 |
| 32 | 3300049571 | Ga0501034_0004595 | Ga0501034_0004595_6574_7023 | 149 |
| 33 | 3300049583 | Ga0501067_0045424 | Ga0501067_0045424_1813_2262 | 149 |
| 34 | 3300049584 | Ga0501068_0858486 | Ga0501068_0858486_125_574 | 149 |
| 35 | 3300049588 | Ga0501072_0025369 | Ga0501072_0025369_2230_2679 | 149 |
| 36 | 3300049741 | Ga0501079_0759368 | Ga0501079_0759368_141_590 | 149 |
| 37 | 3300049742 | Ga0501080_0278594 | Ga0501080_0278594_44_493 | 149 |
| 38 | 3300053139 | Ga0500568_0009401 | Ga0500568_0009401_3610_4065 | 149 |
| 39 | 3300041441 | Ga0451787_166805 | Ga0451787_166805_287_739 | 150 |
| 40 | 3300044683 | Ga0466965_0049077 | Ga0466965_0049077_1386_1838 | 150 |
| 41 | 3300047472 | Ga0495686_0113121 | Ga0495686_0113121_501_953 | 150 |
| 42 | 3300048924 | Ga0496121_0000076 | Ga0496121_0000076_59416_59871 | 150 |
| 43 | 3300048924 | Ga0496121_0170228 | Ga0496121_0170228_387_839 | 150 |
| 44 | 3300048927 | Ga0496124_0268850 | Ga0496124_0268850_660_1112 | 150 |
| 45 | 3300048928 | Ga0496125_0083890 | Ga0496125_0083890_1630_2082 | 150 |
| 46 | 3300049569 | Ga0501032_0088995 | Ga0501032_0088995_678_1130 | 150 |
| 47 | 3300049569 | Ga0501032_0303533 | Ga0501032_0303533_390_860 | 150 |
| 48 | 3300049570 | Ga0501033_0187696 | Ga0501033_0187696_473_925 | 150 |
| 49 | 3300049571 | Ga0501034_0141868 | Ga0501034_0141868_1274_1744 | 150 |
| 50 | 3300049571 | Ga0501034_0145720 | Ga0501034_0145720_1823_2293 | 150 |
| 51 | 3300049571 | Ga0501034_0299039 | Ga0501034_0299039_677_1129 | 150 |
| 52 | 3300049571 | Ga0501034_0345938 | Ga0501034_0345938_635_1105 | 150 |
| 53 | 3300049571 | Ga0501034_0363094 | Ga0501034_0363094_50_502 | 150 |
| 54 | 3300049572 | Ga0501036_0183690 | Ga0501036_0183690_1131_1601 | 150 |
| 55 | 3300049573 | Ga0501037_0005372 | Ga0501037_0005372_3194_3646 | 150 |
| 56 | 3300049573 | Ga0501037_0060557 | Ga0501037_0060557_98_568 | 150 |
| 57 | 3300049573 | Ga0501037_0279039 | Ga0501037_0279039_322_774 | 150 |
| 58 | 3300049574 | Ga0501038_0032754 | Ga0501038_0032754_1946_2398 | 150 |
| 59 | 3300049574 | Ga0501038_0065017 | Ga0501038_0065017_2588_3058 | 150 |
| 60 | 3300049575 | Ga0501039_0910722 | Ga0501039_0910722_14_484 | 150 |
| 61 | 3300049579 | Ga0501043_0071612 | Ga0501043_0071612_590_1060 | 150 |
| 62 | 3300049581 | Ga0501047_0003353 | Ga0501047_0003353_9400_9852 | 150 |
| 63 | 3300049583 | Ga0501067_0257590 | Ga0501067_0257590_243_695 | 150 |
| 64 | 3300049586 | Ga0501070_0619877 | Ga0501070_0619877_94_564 | 150 |
| 65 | 3300049822 | Ga0501035_0007821 | Ga0501035_0007821_7503_7955 | 150 |
| 66 | 3300049823 | Ga0501044_0008083 | Ga0501044_0008083_8259_8711 | 150 |
| 67 | 3300049823 | Ga0501044_0120597 | Ga0501044_0120597_1964_2434 | 150 |
| 68 | 3300049823 | Ga0501044_0540696 | Ga0501044_0540696_307_777 | 150 |
| 69 | 3300053104 | Ga0500556_0000001 | Ga0500556_0000001_361745_362197 | 150 |
| 70 | 3300053139 | Ga0500568_0000006 | Ga0500568_0000006_360929_361381 | 150 |
| 71 | 3300053139 | Ga0500568_0000158 | Ga0500568_0000158_4761_5213 | 150 |
| 72 | 3300001979 | JGI24740J21852_10006767 | JGI24740J21852_100067674 | 151 |
| 73 | 3300001989 | JGI24739J22299_10041193 | JGI24739J22299_100411932 | 151 |
| 74 | 3300001990 | JGI24737J22298_10021425 | JGI24737J22298_100214252 | 151 |
| 75 | 3300002067 | JGI24735J21928_10002575 | JGI24735J21928_100025755 | 151 |
| 76 | 3300003578 | Ga0006562J51391_1012007 | Ga0006562J51391_10120073 | 151 |
| 77 | 3300003578 | Ga0006562J51391_1012008 | Ga0006562J51391_10120082 | 151 |
| 78 | 3300003752 | Ga0055539_1000008 | Ga0055539_100000872 | 151 |
| 79 | 3300003756 | Ga0055533_1000001 | Ga0055533_1000001998 | 151 |
| 80 | 3300003759 | Ga0055525_1000540 | Ga0055525_10005405 | 151 |
| 81 | 3300003763 | Ga0055529_1011448 | Ga0055529_10114482 | 151 |
| 82 | 3300003841 | Ga0055541_1014290 | Ga0055541_10142902 | 151 |
| 83 | 3300005327 | Ga0070658_10000357 | Ga0070658_1000035729 | 151 |
| 84 | 3300005327 | Ga0070658_10037649 | Ga0070658_100376493 | 151 |
| 85 | 3300005327 | Ga0070658_10842791 | Ga0070658_108427912 | 151 |
| 86 | 3300005327 | Ga0070658_10856448 | Ga0070658_108564481 | 151 |
| 87 | 3300005337 | Ga0070682_100453839 | Ga0070682_1004538392 | 151 |
| 88 | 3300005338 | Ga0068868_100022656 | Ga0068868_1000226564 | 151 |
| 89 | 3300005366 | Ga0070659_100028959 | Ga0070659_1000289594 | 151 |
| 90 | 3300005367 | Ga0070667_100048971 | Ga0070667_1000489713 | 151 |
| 91 | 3300005435 | Ga0070714_100113848 | Ga0070714_1001138481 | 151 |
| 92 | 3300005438 | Ga0070701_10201030 | Ga0070701_102010302 | 151 |
| 93 | 3300005455 | Ga0070663_100162894 | Ga0070663_1001628943 | 151 |
| 94 | 3300005455 | Ga0070663_100216253 | Ga0070663_1002162533 | 151 |
| 95 | 3300005455 | Ga0070663_100676241 | Ga0070663_1006762412 | 151 |
| 96 | 3300005457 | Ga0070662_100660100 | Ga0070662_1006601001 | 151 |
| 97 | 3300005539 | Ga0068853_100480482 | Ga0068853_1004804822 | 151 |
| 98 | 3300005563 | Ga0068855_100168691 | Ga0068855_1001686913 | 151 |
| 99 | 3300005577 | Ga0068857_100576793 | Ga0068857_1005767931 | 151 |
| 100 | 3300005614 | Ga0068856_100157842 | Ga0068856_1001578422 | 151 |
| 101 | 3300005840 | Ga0068870_10013914 | Ga0068870_100139144 | 151 |
| 102 | 3300006038 | Ga0075365_10057042 | Ga0075365_100570424 | 151 |
| 103 | 3300006353 | Ga0075370_10079816 | Ga0075370_100798164 | 151 |
| 104 | 3300009094 | Ga0111539_10220874 | Ga0111539_102208744 | 151 |
| 105 | 3300009148 | Ga0105243_10103794 | Ga0105243_101037942 | 151 |
| 106 | 3300010375 | Ga0105239_12884330 | Ga0105239_128843301 | 151 |
| 107 | 3300010375 | Ga0105239_12944873 | Ga0105239_129448731 | 151 |
| 108 | 3300011119 | Ga0105246_10636056 | Ga0105246_106360562 | 151 |
| 109 | 3300011119 | Ga0105246_11512897 | Ga0105246_115128972 | 151 |
| 110 | 3300013102 | Ga0157371_10005704 | Ga0157371_100057048 | 151 |
| 111 | 3300013102 | Ga0157371_10492309 | Ga0157371_104923091 | 151 |
| 112 | 3300013104 | Ga0157370_10001218 | Ga0157370_1000121813 | 151 |
| 113 | 3300013105 | Ga0157369_10033100 | Ga0157369_100331004 | 151 |
| 114 | 3300013105 | Ga0157369_10195088 | Ga0157369_101950883 | 151 |
| 115 | 3300014326 | Ga0157380_10027697 | Ga0157380_100276976 | 151 |
| 116 | 3300014968 | Ga0157379_10057343 | Ga0157379_100573435 | 151 |
| 117 | 3300017792 | Ga0163161_11041420 | Ga0163161_110414202 | 151 |
| 118 | 3300020069 | Ga0197907_11398818 | Ga0197907_113988184 | 151 |
| 119 | 3300020070 | Ga0206356_10393866 | Ga0206356_103938663 | 151 |
| 120 | 3300020076 | Ga0206355_1066417 | Ga0206355_10664173 | 151 |
| 121 | 3300020077 | Ga0206351_10570854 | Ga0206351_105708541 | 151 |
| 122 | 3300020078 | Ga0206352_10157244 | Ga0206352_101572441 | 151 |
| 123 | 3300020081 | Ga0206354_10519915 | Ga0206354_105199153 | 151 |
| 124 | 3300020082 | Ga0206353_10477024 | Ga0206353_104770246 | 151 |
| 125 | 3300022467 | Ga0224712_10068573 | Ga0224712_100685731 | 151 |
| 126 | 3300025225 | Ga0209566_100149 | Ga0209566_10014965 | 151 |
| 127 | 3300025226 | Ga0209674_100001 | Ga0209674_100001998 | 151 |
| 128 | 3300025230 | Ga0209563_100001 | Ga0209563_100001998 | 151 |
| 129 | 3300025230 | Ga0209563_101058 | Ga0209563_1010582 | 151 |
| 130 | 3300025253 | Ga0209677_100001 | Ga0209677_100001998 | 151 |
| 131 | 3300025253 | Ga0209677_101706 | Ga0209677_1017068 | 151 |
| 132 | 3300025272 | Ga0209455_1007291 | Ga0209455_10072914 | 151 |
| 133 | 3300025904 | Ga0207647_10155684 | Ga0207647_101556843 | 151 |
| 134 | 3300025907 | Ga0207645_10527061 | Ga0207645_105270611 | 151 |
| 135 | 3300025909 | Ga0207705_10000006 | Ga0207705_10000006310 | 151 |
| 136 | 3300025909 | Ga0207705_10020182 | Ga0207705_100201824 | 151 |
| 137 | 3300025909 | Ga0207705_10915233 | Ga0207705_109152332 | 151 |
| 138 | 3300025919 | Ga0207657_10011960 | Ga0207657_100119603 | 151 |
| 139 | 3300025919 | Ga0207657_10220068 | Ga0207657_102200682 | 151 |
| 140 | 3300025924 | Ga0207694_10131794 | Ga0207694_101317944 | 151 |
| 141 | 3300025929 | Ga0207664_10675291 | Ga0207664_106752911 | 151 |
| 142 | 3300025932 | Ga0207690_10009072 | Ga0207690_100090724 | 151 |
| 143 | 3300025933 | Ga0207706_10467641 | Ga0207706_104676412 | 151 |
| 144 | 3300025935 | Ga0207709_10239355 | Ga0207709_102393552 | 151 |
| 145 | 3300025949 | Ga0207667_10035112 | Ga0207667_100351126 | 151 |
| 146 | 3300025972 | Ga0207668_10064433 | Ga0207668_100644333 | 151 |
| 147 | 3300025986 | Ga0207658_10145759 | Ga0207658_101457593 | 151 |
| 148 | 3300026023 | Ga0207677_10013148 | Ga0207677_100131483 | 151 |
| 149 | 3300026067 | Ga0207678_10166457 | Ga0207678_101664572 | 151 |
| 150 | 3300026075 | Ga0207708_10282529 | Ga0207708_102825292 | 151 |
| 151 | 3300026078 | Ga0207702_10263586 | Ga0207702_102635863 | 151 |
| 152 | 3300026116 | Ga0207674_10371322 | Ga0207674_103713223 | 151 |
| 153 | 3300026118 | Ga0207675_100309403 | Ga0207675_1003094033 | 151 |
| 154 | 3300026142 | Ga0207698_10176453 | Ga0207698_101764531 | 151 |
| 155 | 3300028794 | Ga0307515_10333865 | Ga0307515_103338651 | 151 |
| 156 | 3300031548 | Ga0307408_100577358 | Ga0307408_1005773582 | 151 |
| 157 | 3300031649 | Ga0307514_10003426 | Ga0307514_100034264 | 151 |
| 158 | 3300031903 | Ga0307407_10131546 | Ga0307407_101315462 | 151 |
| 159 | 3300037312 | Ga0395899_0006790 | Ga0395899_0006790_6055_6513 | 151 |
| 160 | 3300037418 | Ga0395900_0457767 | Ga0395900_0457767_663_1121 | 151 |
| 161 | 3300037466 | Ga0395898_0268266 | Ga0395898_0268266_541_999 | 151 |
| 162 | 3300038443 | Ga0395901_0773546 | Ga0395901_0773546_253_711 | 151 |
| 163 | 3300041452 | Ga0451793_0277642 | Ga0451793_0277642_50_535 | 151 |
| 164 | 3300041452 | Ga0451793_0463249 | Ga0451793_0463249_34_510 | 151 |
| 165 | 3300044658 | Ga0466972_0011422 | Ga0466972_0011422_3473_3931 | 151 |
| 166 | 3300044658 | Ga0466972_0108177 | Ga0466972_0108177_695_1153 | 151 |
| 167 | 3300044684 | Ga0466966_0089644 | Ga0466966_0089644_11_469 | 151 |
| 168 | 3300044693 | Ga0466961_0023766 | Ga0466961_0023766_1335_1793 | 151 |
| 169 | 3300044693 | Ga0466961_0238433 | Ga0466961_0238433_469_927 | 151 |
| 170 | 3300044706 | Ga0466964_0114059 | Ga0466964_0114059_34_492 | 151 |
| 171 | 3300044719 | Ga0466971_0042670 | Ga0466971_0042670_1486_1944 | 151 |
| 172 | 3300044735 | Ga0466968_0031361 | Ga0466968_0031361_1365_1823 | 151 |
| 173 | 3300044765 | Ga0466970_0015577 | Ga0466970_0015577_2296_2754 | 151 |
| 174 | 3300044765 | Ga0466970_0201068 | Ga0466970_0201068_95_553 | 151 |
| 175 | 3300044842 | Ga0466957_0034826 | Ga0466957_0034826_226_684 | 151 |
| 176 | 3300044901 | Ga0466960_0022183 | Ga0466960_0022183_514_972 | 151 |
| 177 | 3300045049 | Ga0466959_0086827 | Ga0466959_0086827_1406_1864 | 151 |
| 178 | 3300045836 | Ga0466958_0146080 | Ga0466958_0146080_1013_1471 | 151 |
| 179 | 3300045976 | Ga0466967_2588165 | Ga0466967_2588165_22_480 | 151 |
| 180 | 3300046460 | Ga0495638_0070715 | Ga0495638_0070715_279_737 | 151 |
| 181 | 3300046471 | Ga0495650_0003791 | Ga0495650_0003791_9913_10383 | 151 |
| 182 | 3300046507 | Ga0495606_0505035 | Ga0495606_0505035_30_488 | 151 |
| 183 | 3300046523 | Ga0495644_0043531 | Ga0495644_0043531_542_1039 | 151 |
| 184 | 3300046615 | Ga0495656_0279847 | Ga0495656_0279847_252_710 | 151 |
| 185 | 3300046616 | Ga0495668_0807403 | Ga0495668_0807403_39_497 | 151 |
| 186 | 3300047472 | Ga0495686_0176768 | Ga0495686_0176768_257_715 | 151 |
| 187 | 3300048916 | Ga0496113_0235358 | Ga0496113_0235358_390_848 | 151 |
| 188 | 3300048920 | Ga0496117_0043480 | Ga0496117_0043480_2790_3248 | 151 |
| 189 | 3300048922 | Ga0496119_0288090 | Ga0496119_0288090_193_651 | 151 |
| 190 | 3300048924 | Ga0496121_0501623 | Ga0496121_0501623_137_607 | 151 |
| 191 | 3300048925 | Ga0496122_0001724 | Ga0496122_0001724_22481_22951 | 151 |
| 192 | 3300048925 | Ga0496122_0017756 | Ga0496122_0017756_3806_4264 | 151 |
| 193 | 3300048926 | Ga0496123_0005747 | Ga0496123_0005747_4887_5357 | 151 |
| 194 | 3300048926 | Ga0496123_0301073 | Ga0496123_0301073_148_606 | 151 |
| 195 | 3300048928 | Ga0496125_0355753 | Ga0496125_0355753_88_546 | 151 |
| 196 | 3300049568 | Ga0501031_0883108 | Ga0501031_0883108_59_517 | 151 |
| 197 | 3300049570 | Ga0501033_0007694 | Ga0501033_0007694_7816_8274 | 151 |
| 198 | 3300049571 | Ga0501034_0064451 | Ga0501034_0064451_1626_2099 | 151 |
| 199 | 3300049571 | Ga0501034_0455636 | Ga0501034_0455636_96_554 | 151 |
| 200 | 3300049571 | Ga0501034_0521176 | Ga0501034_0521176_590_1048 | 151 |
| 201 | 3300049572 | Ga0501036_0848391 | Ga0501036_0848391_62_520 | 151 |
| 202 | 3300049572 | Ga0501036_1342449 | Ga0501036_1342449_35_493 | 151 |
| 203 | 3300049573 | Ga0501037_0132826 | Ga0501037_0132826_87_545 | 151 |
| 204 | 3300049574 | Ga0501038_1278288 | Ga0501038_1278288_59_517 | 151 |
| 205 | 3300049579 | Ga0501043_0218436 | Ga0501043_0218436_105_563 | 151 |
| 206 | 3300049579 | Ga0501043_0482484 | Ga0501043_0482484_114_587 | 151 |
| 207 | 3300049579 | Ga0501043_0639072 | Ga0501043_0639072_265_723 | 151 |
| 208 | 3300049579 | Ga0501043_1144056 | Ga0501043_1144056_60_518 | 151 |
| 209 | 3300049581 | Ga0501047_0146426 | Ga0501047_0146426_79_537 | 151 |
| 210 | 3300049581 | Ga0501047_0153127 | Ga0501047_0153127_115_573 | 151 |
| 211 | 3300049585 | Ga0501069_0311344 | Ga0501069_0311344_264_722 | 151 |
| 212 | 3300049586 | Ga0501070_0168702 | Ga0501070_0168702_1173_1646 | 151 |
| 213 | 3300049587 | Ga0501071_0000694 | Ga0501071_0000694_16077_16550 | 151 |
| 214 | 3300049589 | Ga0501073_0025509 | Ga0501073_0025509_2586_3044 | 151 |
| 215 | 3300049590 | Ga0501074_0221260 | Ga0501074_0221260_671_1144 | 151 |
| 216 | 3300049590 | Ga0501074_0279724 | Ga0501074_0279724_519_977 | 151 |
| 217 | 3300049741 | Ga0501079_0321344 | Ga0501079_0321344_458_916 | 151 |
| 218 | 3300049742 | Ga0501080_0056517 | Ga0501080_0056517_735_1193 | 151 |
| 219 | 3300049742 | Ga0501080_0999844 | Ga0501080_0999844_30_488 | 151 |
| 220 | 3300049822 | Ga0501035_0025716 | Ga0501035_0025716_4830_5288 | 151 |
| 221 | 3300049822 | Ga0501035_0315906 | Ga0501035_0315906_60_518 | 151 |
| 222 | 3300049823 | Ga0501044_0036446 | Ga0501044_0036446_2805_3263 | 151 |
| 223 | 3300049823 | Ga0501044_0136145 | Ga0501044_0136145_60_518 | 151 |
| 224 | 3300050492 | nmdc:mga0yw44_807114_c1 | nmdc:mga0yw44_807114_c1_17_487 | 151 |
| 225 | 3300050492 | nmdc:mga0yw44_97073_c1 | nmdc:mga0yw44_97073_c1_1118_1573 | 151 |
| 226 | 3300050496 | nmdc:mga07m45_128964_c1 | nmdc:mga07m45_128964_c1_782_1237 | 151 |
| 227 | 3300053136 | Ga0500559_0192421 | Ga0500559_0192421_401_859 | 151 |
| 228 | 3300053140 | Ga0500573_0000013 | Ga0500573_0000013_151450_151962 | 151 |
| 229 | 3300053140 | Ga0500573_0000719 | Ga0500573_0000719_4047_4526 | 151 |
| 230 | 3300053140 | Ga0500573_0033318 | Ga0500573_0033318_1707_2165 | 151 |
| 231 | 3300053140 | Ga0500573_0042039 | Ga0500573_0042039_1295_1753 | 151 |
| 232 | 3300053140 | Ga0500573_0122146 | Ga0500573_0122146_177_635 | 151 |
| 233 | 3300053142 | Ga0500577_0312004 | Ga0500577_0312004_57_572 | 151 |
| 234 | 3300053153 | Ga0500616_0000021 | Ga0500616_0000021_427220_427678 | 151 |
| 235 | 3300054114 | Ga0501084_0345582 | Ga0501084_0345582_569_1042 | 151 |
| 236 | 3300061719 | Ga0466962_0013877 | Ga0466962_0013877_2814_3272 | 151 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1sm8-assembly1.cif.gz_C | m. tuberculosis dutpase complexed with chromium and dutp | 0.9552 | 4 | 128 |
| 1slh-assembly1.cif.gz_B | mycobacterium tuberculosis dutpase complexed with magnesium and dudp | 0.9497 | 5 | 127 |
| 3i93-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis dutpase stop138t mutant | 0.939 | 1 | 127 |
| 3h6d-assembly1.cif.gz_A | structure of the mycobacterium tuberculosis dutpase d28n mutant | 0.9314 | 2 | 131 |
| 5edd-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis dutpase r140k, h145w mutant | 0.9275 | 2 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1snfC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9531 | 4 | 128 | 2.70.40.10 |
| 1sjnC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9285 | 4 | 137 | 2.70.40.10 |
| 5y5qC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9186 | 4 | 120 | 2.70.40.10 |
| 1snfC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9175 | 4 | 128 | 2.70.40.10 |
| 3mbqA00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9149 | 4 | 128 | 2.70.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W4TF36-F1-model_v4 | deleted | 0.9765 | 2 | 122 |
|
| AF-A0A0R2QXH6-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9621 | 2 | 128 |
GO:0000287
GO:0004170 GO:0006226 GO:0016020 GO:0046081 |
| AF-A0A7V9BGE2-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.958 | 10 | 119 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A838HTA3-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9577 | 5 | 130 |
GO:0000287
GO:0004170 GO:0006226 GO:0016747 GO:0046081 |
| AF-A0A059WW43-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.956 | 4 | 125 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar