F349078

General Info

Members Datasets Scaffolds Average Seq Length
236 157 227 153

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10005704|Ga0157371_100057048
Length 176
Sequence MTPLHQIFDRPVFRREIILHYPHDVTESVEVLLLGDTVPAYSHPGDAGADLTAAEAVILEPGRRATVGTGLSIALPDGYVAFVVPRSGLAASHGITIVNSPGTVDAGYRGEIRVTLLNTDSSVPYSVAVGDRIAQLIVMPVSRAKFIPVETLPGSHRGSGGFGSTGYRDTKQGDRQ

Samples

Sample ID Description Type Environment
1 2643221572 Leifsonia sp. Root60 Isolate Unclassified
2 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
3 2808606372 Agromyces sp. 23-23 Isolate Unclassified
4 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
5 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
6 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
7 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
8 2928153084 Leifsonia sp. 563 Isolate Unclassified
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
51 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
90 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
108 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
116 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
119 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
120 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
121 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
146 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
147 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
148 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
149 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
150 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
151 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
152 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
153 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
157 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.95
Metatranscriptomes 4.24
Isolates 3.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.25
Nodule 0
Rhizoplane 3.39
Rhizosphere 72.03
Stem 0
Stem Tuber 0
Unclassified 9.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006767 3300001979 Bacteria 4712
2 JGI24739J22299_10041193 3300001989 Bacteria 1538
3 JGI24737J22298_10021425 3300001990 Bacteria 2060
4 JGI24735J21928_10002575 3300002067 Bacteria 6274
5 Ga0006562J51391_1012007 3300003578 Bacteria 2021
6 Ga0006562J51391_1012008 3300003578 Bacteria 1820
7 Ga0055539_1000008 3300003752 Bacteria 537665
8 Ga0055533_1000001 3300003756 Bacteria 1863437
9 Ga0055525_1000540 3300003759 Bacteria 17989
10 Ga0055529_1011448 3300003763 Bacteria 1141
11 Ga0055541_1014290 3300003841 Bacteria 1083
12 Ga0070658_10000357 3300005327 Bacteria 39707
13 Ga0070658_10037649 3300005327 Bacteria 3900
14 Ga0070658_10842791 3300005327 Bacteria 797
15 Ga0070658_10856448 3300005327 Bacteria 790
16 Ga0070682_100453839 3300005337 Bacteria 982
17 Ga0068868_100022656 3300005338 Bacteria 4745
18 Ga0070659_100028959 3300005366 Bacteria 4278
19 Ga0070667_100048971 3300005367 Bacteria 3558
20 Ga0070714_100113848 3300005435 Bacteria 2399
21 Ga0070701_10201030 3300005438 Bacteria 1178
22 Ga0070663_100162894 3300005455 Bacteria 1718
23 Ga0070663_100216253 3300005455 Bacteria 1503
24 Ga0070663_100676241 3300005455 Bacteria 875
25 Ga0070662_100660100 3300005457 Bacteria 883
26 Ga0068853_100480482 3300005539 Unclassified 1171
27 Ga0068855_100168691 3300005563 Bacteria 2479
28 Ga0068857_100576793 3300005577 Bacteria 1061
29 Ga0068856_100157842 3300005614 Bacteria 2278
30 Ga0068870_10013914 3300005840 Bacteria 3790
31 Ga0075365_10057042 3300006038 Bacteria 2598
32 Ga0075365_10589651 3300006038 Bacteria 786
33 Ga0075364_10065689 3300006051 Bacteria 2382
34 Ga0075370_10079816 3300006353 Bacteria 1880
35 Ga0111539_10220874 3300009094 Bacteria 2207
36 Ga0114129_10200773 3300009147 Bacteria 2701
37 Ga0105243_10103794 3300009148 Bacteria 2365
38 Ga0105239_12884330 3300010375 Bacteria 561
39 Ga0105239_12944873 3300010375 Bacteria 555
40 Ga0105246_10636056 3300011119 Bacteria 927
41 Ga0105246_11512897 3300011119 Bacteria 631
42 Ga0157371_10005704 3300013102 Bacteria 10437
43 Ga0157371_10492309 3300013102 Bacteria 905
44 Ga0157370_10001218 3300013104 Bacteria 32238
45 Ga0157369_10033100 3300013105 Bacteria 5682
46 Ga0157369_10195088 3300013105 Bacteria 2127
47 Ga0157372_10982926 3300013307 Bacteria 978
48 Ga0157380_10027697 3300014326 Bacteria 4312
49 Ga0157379_10057343 3300014968 Bacteria 3481
50 Ga0163161_11041420 3300017792 Bacteria 700
51 Ga0197907_11398818 3300020069 Bacteria 2745
52 Ga0206356_10393866 3300020070 Bacteria 2422
53 Ga0206355_1066417 3300020076 Bacteria 1780
54 Ga0206351_10570854 3300020077 Bacteria 1417
55 Ga0206352_10157244 3300020078 Bacteria 818
56 Ga0206354_10519915 3300020081 Bacteria 2916
57 Ga0206353_10477024 3300020082 Bacteria 10918
58 Ga0224712_10068573 3300022467 Bacteria 1434
59 Ga0209566_100149 3300025225 Bacteria 81626
60 Ga0209674_100001 3300025226 Bacteria 4013750
61 Ga0209563_100001 3300025230 Bacteria 4013775
62 Ga0209563_101058 3300025230 Bacteria 7957
63 Ga0209677_100001 3300025253 Bacteria 4013787
64 Ga0209677_101706 3300025253 Bacteria 9142
65 Ga0209455_1007291 3300025272 Bacteria 3142
66 Ga0207647_10155684 3300025904 Bacteria 1334
67 Ga0207645_10527061 3300025907 Bacteria 801
68 Ga0207705_10000006 3300025909 Bacteria 657147
69 Ga0207705_10020182 3300025909 Bacteria 4767
70 Ga0207705_10915233 3300025909 Bacteria 679
71 Ga0207657_10011960 3300025919 Bacteria 8588
72 Ga0207657_10220068 3300025919 Bacteria 1521
73 Ga0207694_10131794 3300025924 Bacteria 2004
74 Ga0207664_10675291 3300025929 Bacteria 929
75 Ga0207690_10009072 3300025932 Bacteria 5903
76 Ga0207706_10467641 3300025933 Bacteria 1090
77 Ga0207709_10239355 3300025935 Bacteria 1319
78 Ga0207667_10035112 3300025949 Bacteria 5380
79 Ga0207668_10064433 3300025972 Bacteria 2590
80 Ga0207658_10145759 3300025986 Bacteria 1922
81 Ga0207677_10013148 3300026023 Bacteria 4786
82 Ga0207678_10166457 3300026067 Bacteria 1882
83 Ga0207708_10282529 3300026075 Bacteria 1345
84 Ga0207702_10263586 3300026078 Bacteria 1623
85 Ga0207674_10371322 3300026116 Bacteria 1383
86 Ga0207675_100309403 3300026118 Bacteria 1540
87 Ga0207698_10176453 3300026142 Bacteria 1887
88 Ga0307515_10333865 3300028794 Bacteria 1173
89 Ga0307408_100577358 3300031548 Bacteria 996
90 Ga0307514_10003426 3300031649 Bacteria 15254
91 Ga0307407_10131546 3300031903 Bacteria 1602
92 Ga0316574_0142605 3300035398 Bacteria 1544
93 Ga0395899_0006790 3300037312 Bacteria 8869
94 Ga0395900_0457767 3300037418 Bacteria 1231
95 Ga0395898_0268266 3300037466 Bacteria 1628
96 Ga0395901_0773546 3300038443 Bacteria 951
97 Ga0451787_166805 3300041441 Bacteria 1051
98 Ga0451787_305493 3300041441 Bacteria 819
99 Ga0451793_0277642 3300041452 Bacteria 714
100 Ga0451793_0374260 3300041452 Bacteria 1010
101 Ga0451793_0463249 3300041452 Bacteria 1166
102 Ga0466972_0011422 3300044658 Bacteria 4458
103 Ga0466972_0108177 3300044658 Bacteria 1314
104 Ga0466972_0181501 3300044658 Bacteria 987
105 Ga0466965_0049077 3300044683 Bacteria 2092
106 Ga0466966_0089644 3300044684 Bacteria 1910
107 Ga0466961_0023766 3300044693 Bacteria 3944
108 Ga0466961_0238433 3300044693 Bacteria 1118
109 Ga0466961_0249937 3300044693 Bacteria 1089
110 Ga0466964_0114059 3300044706 Bacteria 1209
111 Ga0466971_0042670 3300044719 Bacteria 2038
112 Ga0466971_0163513 3300044719 Bacteria 1042
113 Ga0466968_0031361 3300044735 Bacteria 2205
114 Ga0466970_0015577 3300044765 Bacteria 3913
115 Ga0466970_0065694 3300044765 Bacteria 1947
116 Ga0466970_0201068 3300044765 Bacteria 1108
117 Ga0466957_0034826 3300044842 Bacteria 3020
118 Ga0466957_0410106 3300044842 Bacteria 928
119 Ga0466960_0022183 3300044901 Bacteria 2835
120 Ga0466959_0086827 3300045049 Bacteria 2250
121 Ga0466958_0146080 3300045836 Bacteria 1490
122 Ga0466967_2588165 3300045976 Bacteria 502
123 Ga0495638_0070715 3300046460 Bacteria 2136
124 Ga0495650_0003791 3300046471 Bacteria 10772
125 Ga0495606_0505035 3300046507 Bacteria 610
126 Ga0495644_0043531 3300046523 Bacteria 1689
127 Ga0495656_0279847 3300046615 Bacteria 850
128 Ga0495668_0807403 3300046616 Bacteria 520
129 Ga0495672_0004830 3300047320 Bacteria 10862
130 Ga0495686_0113121 3300047472 Bacteria 1625
131 Ga0495686_0176768 3300047472 Bacteria 1239
132 Ga0496103_0486921 3300048906 Bacteria 790
133 Ga0496113_0235358 3300048916 Bacteria 1461
134 Ga0496114_0943216 3300048917 Bacteria 745
135 Ga0496117_0043480 3300048920 Bacteria 3265
136 Ga0496119_0288090 3300048922 Bacteria 814
137 Ga0496121_0000076 3300048924 Bacteria 239775
138 Ga0496121_0097701 3300048924 Bacteria 2275
139 Ga0496121_0170228 3300048924 Bacteria 1583
140 Ga0496121_0501623 3300048924 Bacteria 770
141 Ga0496122_0001724 3300048925 Bacteria 33920
142 Ga0496122_0017756 3300048925 Bacteria 6623
143 Ga0496123_0005747 3300048926 Bacteria 12346
144 Ga0496123_0301073 3300048926 Bacteria 765
145 Ga0496124_0268850 3300048927 Bacteria 1250
146 Ga0496125_0083890 3300048928 Bacteria 2422
147 Ga0496125_0355753 3300048928 Bacteria 873
148 Ga0501031_0883108 3300049568 Bacteria 572
149 Ga0501032_0088995 3300049569 Bacteria 2050
150 Ga0501032_0303533 3300049569 Bacteria 1032
151 Ga0501033_0007694 3300049570 Bacteria 8360
152 Ga0501033_0187696 3300049570 Bacteria 1480
153 Ga0501034_0004595 3300049571 Bacteria 15293
154 Ga0501034_0064451 3300049571 Bacteria 3678
155 Ga0501034_0141868 3300049571 Bacteria 2381
156 Ga0501034_0145720 3300049571 Bacteria 2345
157 Ga0501034_0299039 3300049571 Bacteria 1546
158 Ga0501034_0345938 3300049571 Bacteria 1416
159 Ga0501034_0363094 3300049571 Bacteria 1375
160 Ga0501034_0455636 3300049571 Bacteria 1196
161 Ga0501034_0521176 3300049571 Bacteria 1100
162 Ga0501034_0787171 3300049571 Bacteria 844
163 Ga0501036_0183690 3300049572 Bacteria 1760
164 Ga0501036_0848391 3300049572 Bacteria 751
165 Ga0501036_1342449 3300049572 Bacteria 580
166 Ga0501037_0005372 3300049573 Bacteria 9324
167 Ga0501037_0060557 3300049573 Bacteria 2761
168 Ga0501037_0132826 3300049573 Bacteria 1784
169 Ga0501037_0279039 3300049573 Bacteria 1164
170 Ga0501038_0032754 3300049574 Bacteria 4582
171 Ga0501038_0065017 3300049574 Bacteria 3109
172 Ga0501038_1278288 3300049574 Bacteria 530
173 Ga0501039_0910722 3300049575 Bacteria 684
174 Ga0501043_0071612 3300049579 Bacteria 2722
175 Ga0501043_0218436 3300049579 Bacteria 1475
176 Ga0501043_0482484 3300049579 Bacteria 928
177 Ga0501043_0639072 3300049579 Bacteria 782
178 Ga0501043_1144056 3300049579 Bacteria 548
179 Ga0501047_0003353 3300049581 Bacteria 15171
180 Ga0501047_0146426 3300049581 Bacteria 2238
181 Ga0501047_0153127 3300049581 Bacteria 2180
182 Ga0501067_0045424 3300049583 Bacteria 2439
183 Ga0501067_0257590 3300049583 Bacteria 971
184 Ga0501068_0858486 3300049584 Bacteria 596
185 Ga0501069_0311344 3300049585 Bacteria 924
186 Ga0501070_0168702 3300049586 Bacteria 1803
187 Ga0501070_0619877 3300049586 Bacteria 861
188 Ga0501071_0000694 3300049587 Bacteria 17628
189 Ga0501072_0025369 3300049588 Bacteria 4618
190 Ga0501073_0025509 3300049589 Bacteria 4238
191 Ga0501074_0221260 3300049590 Bacteria 1348
192 Ga0501074_0279724 3300049590 Bacteria 1186
193 Ga0501079_0321344 3300049741 Bacteria 1212
194 Ga0501079_0759368 3300049741 Bacteria 763
195 Ga0501080_0056517 3300049742 Bacteria 3654
196 Ga0501080_0278594 3300049742 Bacteria 1521
197 Ga0501080_0999844 3300049742 Bacteria 725
198 Ga0501035_0007821 3300049822 Bacteria 9989
199 Ga0501035_0025716 3300049822 Bacteria 5395
200 Ga0501035_0315906 3300049822 Bacteria 1313
201 Ga0501044_0008083 3300049823 Bacteria 11549
202 Ga0501044_0036446 3300049823 Bacteria 5146
203 Ga0501044_0120597 3300049823 Bacteria 2624
204 Ga0501044_0136145 3300049823 Bacteria 2447
205 Ga0501044_0540696 3300049823 Bacteria 1063
206 nmdc:mga0yw44_807114_c1 3300050492 Bacteria 637
207 nmdc:mga0yw44_97073_c1 3300050492 Bacteria 1871
208 nmdc:mga07m45_128964_c1 3300050496 Bacteria 1463
209 Ga0500650_0007175 3300053098 Bacteria 4319
210 Ga0500556_0000001 3300053104 Bacteria 1135060
211 Ga0500626_233275 3300053128 Bacteria 699
212 Ga0500652_234453 3300053131 Bacteria 733
213 Ga0500559_0192421 3300053136 Bacteria 961
214 Ga0500568_0000006 3300053139 Bacteria 522235
215 Ga0500568_0000158 3300053139 Bacteria 58729
216 Ga0500568_0009401 3300053139 Bacteria 4649
217 Ga0500573_0000013 3300053140 Bacteria 196637
218 Ga0500573_0000719 3300053140 Bacteria 14727
219 Ga0500573_0033318 3300053140 Bacteria 2973
220 Ga0500573_0042039 3300053140 Bacteria 2640
221 Ga0500573_0122146 3300053140 Bacteria 1449
222 Ga0500577_0030771 3300053142 Bacteria 1871
223 Ga0500577_0062855 3300053142 Bacteria 1433
224 Ga0500577_0312004 3300053142 Bacteria 687
225 Ga0500616_0000021 3300053153 Bacteria 484527
226 Ga0501084_0345582 3300054114 Bacteria 1257
227 Ga0466962_0013877 3300061719 Bacteria 3880

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10200773 Ga0114129_102007734 137
2 3300041452 Ga0451793_0374260 Ga0451793_0374260_256_687 141
3 3300035398 Ga0316574_0142605 Ga0316574_0142605_61_504 142
4 3300053098 Ga0500650_0007175 Ga0500650_0007175_487_927 145
5 3300053142 Ga0500577_0030771 Ga0500577_0030771_825_1265 145
6 3300053142 Ga0500577_0062855 Ga0500577_0062855_429_869 145
7 3300041441 Ga0451787_305493 Ga0451787_305493_80_529 146
8 3300044658 Ga0466972_0181501 Ga0466972_0181501_162_605 146
9 3300044693 Ga0466961_0249937 Ga0466961_0249937_228_671 146
10 3300044719 Ga0466971_0163513 Ga0466971_0163513_115_558 146
11 3300044765 Ga0466970_0065694 Ga0466970_0065694_470_913 146
12 3300044842 Ga0466957_0410106 Ga0466957_0410106_351_794 146
13 3300006051 Ga0075364_10065689 Ga0075364_100656894 147
14 3300013307 Ga0157372_10982926 Ga0157372_109829262 147
15 3300047320 Ga0495672_0004830 Ga0495672_0004830_10240_10746 147
16 3300048906 Ga0496103_0486921 Ga0496103_0486921_267_716 147
17 3300053128 Ga0500626_233275 Ga0500626_233275_134_586 147
18 3300053131 Ga0500652_234453 Ga0500652_234453_215_667 147
19 iso_pu_bacteria 2643221572 2643875033 147
20 iso_pu_bacteria 2643221669 2644382089 147
21 iso_pu_bacteria 2808606372 2808901883 147
22 iso_pu_bacteria 2844841374 2844842670 147
23 iso_pu_bacteria 2895660088 2895661159 147
24 iso_pu_bacteria 2919055335 2919058355 147
25 iso_pu_bacteria 2919523602 2919524746 147
26 iso_pu_bacteria 2928153084 2928156331 147
27 iso_pu_bacteria 8057345674 8057348816 147
28 3300049571 Ga0501034_0787171 Ga0501034_0787171_235_681 148
29 3300006038 Ga0075365_10589651 Ga0075365_105896511 149
30 3300048917 Ga0496114_0943216 Ga0496114_0943216_89_562 149
31 3300048924 Ga0496121_0097701 Ga0496121_0097701_782_1231 149
32 3300049571 Ga0501034_0004595 Ga0501034_0004595_6574_7023 149
33 3300049583 Ga0501067_0045424 Ga0501067_0045424_1813_2262 149
34 3300049584 Ga0501068_0858486 Ga0501068_0858486_125_574 149
35 3300049588 Ga0501072_0025369 Ga0501072_0025369_2230_2679 149
36 3300049741 Ga0501079_0759368 Ga0501079_0759368_141_590 149
37 3300049742 Ga0501080_0278594 Ga0501080_0278594_44_493 149
38 3300053139 Ga0500568_0009401 Ga0500568_0009401_3610_4065 149
39 3300041441 Ga0451787_166805 Ga0451787_166805_287_739 150
40 3300044683 Ga0466965_0049077 Ga0466965_0049077_1386_1838 150
41 3300047472 Ga0495686_0113121 Ga0495686_0113121_501_953 150
42 3300048924 Ga0496121_0000076 Ga0496121_0000076_59416_59871 150
43 3300048924 Ga0496121_0170228 Ga0496121_0170228_387_839 150
44 3300048927 Ga0496124_0268850 Ga0496124_0268850_660_1112 150
45 3300048928 Ga0496125_0083890 Ga0496125_0083890_1630_2082 150
46 3300049569 Ga0501032_0088995 Ga0501032_0088995_678_1130 150
47 3300049569 Ga0501032_0303533 Ga0501032_0303533_390_860 150
48 3300049570 Ga0501033_0187696 Ga0501033_0187696_473_925 150
49 3300049571 Ga0501034_0141868 Ga0501034_0141868_1274_1744 150
50 3300049571 Ga0501034_0145720 Ga0501034_0145720_1823_2293 150
51 3300049571 Ga0501034_0299039 Ga0501034_0299039_677_1129 150
52 3300049571 Ga0501034_0345938 Ga0501034_0345938_635_1105 150
53 3300049571 Ga0501034_0363094 Ga0501034_0363094_50_502 150
54 3300049572 Ga0501036_0183690 Ga0501036_0183690_1131_1601 150
55 3300049573 Ga0501037_0005372 Ga0501037_0005372_3194_3646 150
56 3300049573 Ga0501037_0060557 Ga0501037_0060557_98_568 150
57 3300049573 Ga0501037_0279039 Ga0501037_0279039_322_774 150
58 3300049574 Ga0501038_0032754 Ga0501038_0032754_1946_2398 150
59 3300049574 Ga0501038_0065017 Ga0501038_0065017_2588_3058 150
60 3300049575 Ga0501039_0910722 Ga0501039_0910722_14_484 150
61 3300049579 Ga0501043_0071612 Ga0501043_0071612_590_1060 150
62 3300049581 Ga0501047_0003353 Ga0501047_0003353_9400_9852 150
63 3300049583 Ga0501067_0257590 Ga0501067_0257590_243_695 150
64 3300049586 Ga0501070_0619877 Ga0501070_0619877_94_564 150
65 3300049822 Ga0501035_0007821 Ga0501035_0007821_7503_7955 150
66 3300049823 Ga0501044_0008083 Ga0501044_0008083_8259_8711 150
67 3300049823 Ga0501044_0120597 Ga0501044_0120597_1964_2434 150
68 3300049823 Ga0501044_0540696 Ga0501044_0540696_307_777 150
69 3300053104 Ga0500556_0000001 Ga0500556_0000001_361745_362197 150
70 3300053139 Ga0500568_0000006 Ga0500568_0000006_360929_361381 150
71 3300053139 Ga0500568_0000158 Ga0500568_0000158_4761_5213 150
72 3300001979 JGI24740J21852_10006767 JGI24740J21852_100067674 151
73 3300001989 JGI24739J22299_10041193 JGI24739J22299_100411932 151
74 3300001990 JGI24737J22298_10021425 JGI24737J22298_100214252 151
75 3300002067 JGI24735J21928_10002575 JGI24735J21928_100025755 151
76 3300003578 Ga0006562J51391_1012007 Ga0006562J51391_10120073 151
77 3300003578 Ga0006562J51391_1012008 Ga0006562J51391_10120082 151
78 3300003752 Ga0055539_1000008 Ga0055539_100000872 151
79 3300003756 Ga0055533_1000001 Ga0055533_1000001998 151
80 3300003759 Ga0055525_1000540 Ga0055525_10005405 151
81 3300003763 Ga0055529_1011448 Ga0055529_10114482 151
82 3300003841 Ga0055541_1014290 Ga0055541_10142902 151
83 3300005327 Ga0070658_10000357 Ga0070658_1000035729 151
84 3300005327 Ga0070658_10037649 Ga0070658_100376493 151
85 3300005327 Ga0070658_10842791 Ga0070658_108427912 151
86 3300005327 Ga0070658_10856448 Ga0070658_108564481 151
87 3300005337 Ga0070682_100453839 Ga0070682_1004538392 151
88 3300005338 Ga0068868_100022656 Ga0068868_1000226564 151
89 3300005366 Ga0070659_100028959 Ga0070659_1000289594 151
90 3300005367 Ga0070667_100048971 Ga0070667_1000489713 151
91 3300005435 Ga0070714_100113848 Ga0070714_1001138481 151
92 3300005438 Ga0070701_10201030 Ga0070701_102010302 151
93 3300005455 Ga0070663_100162894 Ga0070663_1001628943 151
94 3300005455 Ga0070663_100216253 Ga0070663_1002162533 151
95 3300005455 Ga0070663_100676241 Ga0070663_1006762412 151
96 3300005457 Ga0070662_100660100 Ga0070662_1006601001 151
97 3300005539 Ga0068853_100480482 Ga0068853_1004804822 151
98 3300005563 Ga0068855_100168691 Ga0068855_1001686913 151
99 3300005577 Ga0068857_100576793 Ga0068857_1005767931 151
100 3300005614 Ga0068856_100157842 Ga0068856_1001578422 151
101 3300005840 Ga0068870_10013914 Ga0068870_100139144 151
102 3300006038 Ga0075365_10057042 Ga0075365_100570424 151
103 3300006353 Ga0075370_10079816 Ga0075370_100798164 151
104 3300009094 Ga0111539_10220874 Ga0111539_102208744 151
105 3300009148 Ga0105243_10103794 Ga0105243_101037942 151
106 3300010375 Ga0105239_12884330 Ga0105239_128843301 151
107 3300010375 Ga0105239_12944873 Ga0105239_129448731 151
108 3300011119 Ga0105246_10636056 Ga0105246_106360562 151
109 3300011119 Ga0105246_11512897 Ga0105246_115128972 151
110 3300013102 Ga0157371_10005704 Ga0157371_100057048 151
111 3300013102 Ga0157371_10492309 Ga0157371_104923091 151
112 3300013104 Ga0157370_10001218 Ga0157370_1000121813 151
113 3300013105 Ga0157369_10033100 Ga0157369_100331004 151
114 3300013105 Ga0157369_10195088 Ga0157369_101950883 151
115 3300014326 Ga0157380_10027697 Ga0157380_100276976 151
116 3300014968 Ga0157379_10057343 Ga0157379_100573435 151
117 3300017792 Ga0163161_11041420 Ga0163161_110414202 151
118 3300020069 Ga0197907_11398818 Ga0197907_113988184 151
119 3300020070 Ga0206356_10393866 Ga0206356_103938663 151
120 3300020076 Ga0206355_1066417 Ga0206355_10664173 151
121 3300020077 Ga0206351_10570854 Ga0206351_105708541 151
122 3300020078 Ga0206352_10157244 Ga0206352_101572441 151
123 3300020081 Ga0206354_10519915 Ga0206354_105199153 151
124 3300020082 Ga0206353_10477024 Ga0206353_104770246 151
125 3300022467 Ga0224712_10068573 Ga0224712_100685731 151
126 3300025225 Ga0209566_100149 Ga0209566_10014965 151
127 3300025226 Ga0209674_100001 Ga0209674_100001998 151
128 3300025230 Ga0209563_100001 Ga0209563_100001998 151
129 3300025230 Ga0209563_101058 Ga0209563_1010582 151
130 3300025253 Ga0209677_100001 Ga0209677_100001998 151
131 3300025253 Ga0209677_101706 Ga0209677_1017068 151
132 3300025272 Ga0209455_1007291 Ga0209455_10072914 151
133 3300025904 Ga0207647_10155684 Ga0207647_101556843 151
134 3300025907 Ga0207645_10527061 Ga0207645_105270611 151
135 3300025909 Ga0207705_10000006 Ga0207705_10000006310 151
136 3300025909 Ga0207705_10020182 Ga0207705_100201824 151
137 3300025909 Ga0207705_10915233 Ga0207705_109152332 151
138 3300025919 Ga0207657_10011960 Ga0207657_100119603 151
139 3300025919 Ga0207657_10220068 Ga0207657_102200682 151
140 3300025924 Ga0207694_10131794 Ga0207694_101317944 151
141 3300025929 Ga0207664_10675291 Ga0207664_106752911 151
142 3300025932 Ga0207690_10009072 Ga0207690_100090724 151
143 3300025933 Ga0207706_10467641 Ga0207706_104676412 151
144 3300025935 Ga0207709_10239355 Ga0207709_102393552 151
145 3300025949 Ga0207667_10035112 Ga0207667_100351126 151
146 3300025972 Ga0207668_10064433 Ga0207668_100644333 151
147 3300025986 Ga0207658_10145759 Ga0207658_101457593 151
148 3300026023 Ga0207677_10013148 Ga0207677_100131483 151
149 3300026067 Ga0207678_10166457 Ga0207678_101664572 151
150 3300026075 Ga0207708_10282529 Ga0207708_102825292 151
151 3300026078 Ga0207702_10263586 Ga0207702_102635863 151
152 3300026116 Ga0207674_10371322 Ga0207674_103713223 151
153 3300026118 Ga0207675_100309403 Ga0207675_1003094033 151
154 3300026142 Ga0207698_10176453 Ga0207698_101764531 151
155 3300028794 Ga0307515_10333865 Ga0307515_103338651 151
156 3300031548 Ga0307408_100577358 Ga0307408_1005773582 151
157 3300031649 Ga0307514_10003426 Ga0307514_100034264 151
158 3300031903 Ga0307407_10131546 Ga0307407_101315462 151
159 3300037312 Ga0395899_0006790 Ga0395899_0006790_6055_6513 151
160 3300037418 Ga0395900_0457767 Ga0395900_0457767_663_1121 151
161 3300037466 Ga0395898_0268266 Ga0395898_0268266_541_999 151
162 3300038443 Ga0395901_0773546 Ga0395901_0773546_253_711 151
163 3300041452 Ga0451793_0277642 Ga0451793_0277642_50_535 151
164 3300041452 Ga0451793_0463249 Ga0451793_0463249_34_510 151
165 3300044658 Ga0466972_0011422 Ga0466972_0011422_3473_3931 151
166 3300044658 Ga0466972_0108177 Ga0466972_0108177_695_1153 151
167 3300044684 Ga0466966_0089644 Ga0466966_0089644_11_469 151
168 3300044693 Ga0466961_0023766 Ga0466961_0023766_1335_1793 151
169 3300044693 Ga0466961_0238433 Ga0466961_0238433_469_927 151
170 3300044706 Ga0466964_0114059 Ga0466964_0114059_34_492 151
171 3300044719 Ga0466971_0042670 Ga0466971_0042670_1486_1944 151
172 3300044735 Ga0466968_0031361 Ga0466968_0031361_1365_1823 151
173 3300044765 Ga0466970_0015577 Ga0466970_0015577_2296_2754 151
174 3300044765 Ga0466970_0201068 Ga0466970_0201068_95_553 151
175 3300044842 Ga0466957_0034826 Ga0466957_0034826_226_684 151
176 3300044901 Ga0466960_0022183 Ga0466960_0022183_514_972 151
177 3300045049 Ga0466959_0086827 Ga0466959_0086827_1406_1864 151
178 3300045836 Ga0466958_0146080 Ga0466958_0146080_1013_1471 151
179 3300045976 Ga0466967_2588165 Ga0466967_2588165_22_480 151
180 3300046460 Ga0495638_0070715 Ga0495638_0070715_279_737 151
181 3300046471 Ga0495650_0003791 Ga0495650_0003791_9913_10383 151
182 3300046507 Ga0495606_0505035 Ga0495606_0505035_30_488 151
183 3300046523 Ga0495644_0043531 Ga0495644_0043531_542_1039 151
184 3300046615 Ga0495656_0279847 Ga0495656_0279847_252_710 151
185 3300046616 Ga0495668_0807403 Ga0495668_0807403_39_497 151
186 3300047472 Ga0495686_0176768 Ga0495686_0176768_257_715 151
187 3300048916 Ga0496113_0235358 Ga0496113_0235358_390_848 151
188 3300048920 Ga0496117_0043480 Ga0496117_0043480_2790_3248 151
189 3300048922 Ga0496119_0288090 Ga0496119_0288090_193_651 151
190 3300048924 Ga0496121_0501623 Ga0496121_0501623_137_607 151
191 3300048925 Ga0496122_0001724 Ga0496122_0001724_22481_22951 151
192 3300048925 Ga0496122_0017756 Ga0496122_0017756_3806_4264 151
193 3300048926 Ga0496123_0005747 Ga0496123_0005747_4887_5357 151
194 3300048926 Ga0496123_0301073 Ga0496123_0301073_148_606 151
195 3300048928 Ga0496125_0355753 Ga0496125_0355753_88_546 151
196 3300049568 Ga0501031_0883108 Ga0501031_0883108_59_517 151
197 3300049570 Ga0501033_0007694 Ga0501033_0007694_7816_8274 151
198 3300049571 Ga0501034_0064451 Ga0501034_0064451_1626_2099 151
199 3300049571 Ga0501034_0455636 Ga0501034_0455636_96_554 151
200 3300049571 Ga0501034_0521176 Ga0501034_0521176_590_1048 151
201 3300049572 Ga0501036_0848391 Ga0501036_0848391_62_520 151
202 3300049572 Ga0501036_1342449 Ga0501036_1342449_35_493 151
203 3300049573 Ga0501037_0132826 Ga0501037_0132826_87_545 151
204 3300049574 Ga0501038_1278288 Ga0501038_1278288_59_517 151
205 3300049579 Ga0501043_0218436 Ga0501043_0218436_105_563 151
206 3300049579 Ga0501043_0482484 Ga0501043_0482484_114_587 151
207 3300049579 Ga0501043_0639072 Ga0501043_0639072_265_723 151
208 3300049579 Ga0501043_1144056 Ga0501043_1144056_60_518 151
209 3300049581 Ga0501047_0146426 Ga0501047_0146426_79_537 151
210 3300049581 Ga0501047_0153127 Ga0501047_0153127_115_573 151
211 3300049585 Ga0501069_0311344 Ga0501069_0311344_264_722 151
212 3300049586 Ga0501070_0168702 Ga0501070_0168702_1173_1646 151
213 3300049587 Ga0501071_0000694 Ga0501071_0000694_16077_16550 151
214 3300049589 Ga0501073_0025509 Ga0501073_0025509_2586_3044 151
215 3300049590 Ga0501074_0221260 Ga0501074_0221260_671_1144 151
216 3300049590 Ga0501074_0279724 Ga0501074_0279724_519_977 151
217 3300049741 Ga0501079_0321344 Ga0501079_0321344_458_916 151
218 3300049742 Ga0501080_0056517 Ga0501080_0056517_735_1193 151
219 3300049742 Ga0501080_0999844 Ga0501080_0999844_30_488 151
220 3300049822 Ga0501035_0025716 Ga0501035_0025716_4830_5288 151
221 3300049822 Ga0501035_0315906 Ga0501035_0315906_60_518 151
222 3300049823 Ga0501044_0036446 Ga0501044_0036446_2805_3263 151
223 3300049823 Ga0501044_0136145 Ga0501044_0136145_60_518 151
224 3300050492 nmdc:mga0yw44_807114_c1 nmdc:mga0yw44_807114_c1_17_487 151
225 3300050492 nmdc:mga0yw44_97073_c1 nmdc:mga0yw44_97073_c1_1118_1573 151
226 3300050496 nmdc:mga07m45_128964_c1 nmdc:mga07m45_128964_c1_782_1237 151
227 3300053136 Ga0500559_0192421 Ga0500559_0192421_401_859 151
228 3300053140 Ga0500573_0000013 Ga0500573_0000013_151450_151962 151
229 3300053140 Ga0500573_0000719 Ga0500573_0000719_4047_4526 151
230 3300053140 Ga0500573_0033318 Ga0500573_0033318_1707_2165 151
231 3300053140 Ga0500573_0042039 Ga0500573_0042039_1295_1753 151
232 3300053140 Ga0500573_0122146 Ga0500573_0122146_177_635 151
233 3300053142 Ga0500577_0312004 Ga0500577_0312004_57_572 151
234 3300053153 Ga0500616_0000021 Ga0500616_0000021_427220_427678 151
235 3300054114 Ga0501084_0345582 Ga0501084_0345582_569_1042 151
236 3300061719 Ga0466962_0013877 Ga0466962_0013877_2814_3272 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00692

dUTPase

dUTPase

36

166

0.95

PF22769

DCD

dCTP deaminase-like

47

141

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sm8-assembly1.cif.gz_C m. tuberculosis dutpase complexed with chromium and dutp 0.9552 4 128
1slh-assembly1.cif.gz_B mycobacterium tuberculosis dutpase complexed with magnesium and dudp 0.9497 5 127
3i93-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis dutpase stop138t mutant 0.939 1 127
3h6d-assembly1.cif.gz_A structure of the mycobacterium tuberculosis dutpase d28n mutant 0.9314 2 131
5edd-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis dutpase r140k, h145w mutant 0.9275 2 131
ID Description Score Start End Superfamily
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9531 4 128 2.70.40.10
1sjnC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9285 4 137 2.70.40.10
5y5qC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9186 4 120 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9175 4 128 2.70.40.10
3mbqA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9149 4 128 2.70.40.10
ID Description Score Start End GO Terms
AF-W4TF36-F1-model_v4 deleted 0.9765 2 122
AF-A0A0R2QXH6-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9621 2 128 GO:0000287
GO:0004170
GO:0006226
GO:0016020
GO:0046081
AF-A0A7V9BGE2-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.958 10 119 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A838HTA3-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9577 5 130 GO:0000287
GO:0004170
GO:0006226
GO:0016747
GO:0046081
AF-A0A059WW43-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.956 4 125 GO:0000287
GO:0004170
GO:0006226
GO:0046081

Feature Viewer

pLDDT pTM Quality
84.31 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map