F348998

General Info

Members Datasets Scaffolds Average Seq Length
236 194 466 254

Family's Representative Sequence

Representative Sequence 3300006943|Ga0099822_1011725|Ga0099822_10117253
Length 305
Sequence MAESASTTITTALRLKNKIAIVTGGASGIGEATARLFAEEGARMVVIADIQDELGKEVAASIGGDRCSYFHCDVAEEDEVQRLVHSTVKAYGQVDIMFSNAGIISPSKQTVAELHMSELDRLFTVNVRGMAACVKHAARAMVEGRVRGSIVCTGSVCGSHGGLKGTDYIMSKHAVLGLMRSASMQLAEHGIRVNCVSPNGLATPLTCKLRGTSEEETREGYRKYARLQGVVLTPKQVAQAVLFLASDDSSAFVTGLDLRVDGGFSHGHLFHVCVGLCLICYMLWIYLLGDCGSILYDISLTYIRH

Samples

Sample ID Description Type Environment
1 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
37 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
38 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
47 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
54 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
55 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
56 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
57 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
74 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
75 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
76 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
77 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
82 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
83 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
93 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
99 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
100 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
101 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
114 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
115 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
130 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
131 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
146 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
147 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
148 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
149 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
150 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
151 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
152 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
153 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
154 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
155 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
156 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
157 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
158 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
159 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
160 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
161 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
162 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
163 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
164 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
165 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
168 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
169 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
170 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
171 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
172 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
173 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
174 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
175 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
176 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
179 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
180 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
181 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
182 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
183 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
184 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
185 2808606448 Streptomyces sp. 193411 Isolate Unclassified
186 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
187 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
188 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
189 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
190 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
191 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
192 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
193 2928163908 Burkholderia sp. 567 Isolate Unclassified
194 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.37
Metatranscriptomes 0.42
Isolates 7.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.92
Nodule 15.25
Rhizoplane 3.81
Rhizosphere 48.31
Stem 0
Stem Tuber 0
Unclassified 3.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099822_1011725 3300006943 Eukaryota 10637
2 SwRhRL2b_contig_552341 2162886007 Bacteria 1417
3 JGI24739J22299_10006942 3300001989 Bacteria 4267
4 JGI24735J21928_10030021 3300002067 Bacteria 1616
5 JGI25162J39368_1000004 3300002737 Bacteria 441040
6 JGI25163J39215_1000179 3300002771 Bacteria 24461
7 JGI25164J39214_1000031 3300002772 Bacteria 144582
8 JGI25165J46597_1000011 3300003214 Bacteria 441040
9 rootL2_10288840 3300003322 Bacteria 2221
10 rootL2_10311359 3300003322 Bacteria 2380
11 Ga0065704_10110146 3300005289 Bacteria 1987
12 Ga0070683_100762060 3300005329 Bacteria 927
13 Ga0070682_100264935 3300005337 Bacteria 1245
14 Ga0068868_100406217 3300005338 Bacteria 1176
15 Ga0070660_100260033 3300005339 Bacteria 1417
16 Ga0070669_100165258 3300005353 Bacteria 1722
17 Ga0070710_10097381 3300005437 Bacteria 1745
18 Ga0070711_100191748 3300005439 Bacteria 1571
19 Ga0070694_100112413 3300005444 Bacteria 1942
20 Ga0070706_100334370 3300005467 Bacteria 1412
21 Ga0070707_100024683 3300005468 Bacteria 5696
22 Ga0070698_100004990 3300005471 Bacteria 14541
23 Ga0070699_100099349 3300005518 Bacteria 2550
24 Ga0070699_100342569 3300005518 Bacteria 1346
25 Ga0070697_100132780 3300005536 Bacteria 2089
26 Ga0070695_100001756 3300005545 Bacteria 12191
27 Ga0070704_100193854 3300005549 Bacteria 1635
28 Ga0070704_100327908 3300005549 Bacteria 1285
29 Ga0068855_100000006 3300005563 Bacteria 298092
30 Ga0068852_100041513 3300005616 Bacteria 3888
31 Ga0068852_100939830 3300005616 Bacteria 882
32 Ga0068870_10348975 3300005840 Bacteria 949
33 Ga0081455_10000199 3300005937 Bacteria 76227
34 Ga0070717_10263060 3300006028 Bacteria 1526
35 Ga0075368_10026803 3300006042 Bacteria 2218
36 Ga0070716_100186719 3300006173 Bacteria 1366
37 Ga0075369_10006270 3300006186 Bacteria 4493
38 Ga0075433_10294730 3300006852 Bacteria 1437
39 Ga0075436_100048207 3300006914 Bacteria 2939
40 Ga0099825_1000055 3300006941 Eukaryota 69510
41 Ga0099825_1001163 3300006941 Eukaryota 32727
42 Ga0099824_1000022 3300006942 Eukaryota 87751
43 Ga0099824_1000081 3300006942 Eukaryota 69534
44 Ga0099822_1002281 3300006943 Eukaryota 23745
45 Ga0099823_1000809 3300006944 Eukaryota 23266
46 Ga0099823_1018539 3300006944 Eukaryota 6707
47 Ga0075435_100085733 3300007076 Bacteria 2593
48 Ga0105240_10198983 3300009093 Bacteria 2350
49 Ga0105245_10771714 3300009098 Bacteria 998
50 Ga0105241_11007667 3300009174 Bacteria 779
51 Ga0105242_10884381 3300009176 Bacteria 892
52 Ga0105237_10224155 3300009545 Bacteria 1880
53 Ga0105238_10021527 3300009551 Bacteria 6567
54 Ga0123340_1000113 3300009763 Eukaryota 36042
55 Ga0123341_1022358 3300009765 Eukaryota 5264
56 Ga0105239_10006444 3300010375 Bacteria 13614
57 Ga0157369_10317525 3300013105 Bacteria 1620
58 Ga0157378_10046748 3300013297 Bacteria 3847
59 Ga0157378_10254629 3300013297 Bacteria 1682
60 Ga0157376_10099587 3300014969 Bacteria 2536
61 Ga0157376_10348368 3300014969 Unclassified 1417
62 Ga0182006_1007495 3300015261 Bacteria 4991
63 Ga0182006_1052838 3300015261 Bacteria 1560
64 Ga0214544_1001065 3300021320 Eukaryota 55340
65 Ga0214544_1002314 3300021320 Eukaryota 40165
66 Ga0214544_1016953 3300021320 Eukaryota 6781
67 Ga0214542_1000044 3300021321 Eukaryota 150282
68 Ga0214542_1001041 3300021321 Eukaryota 55362
69 Ga0214542_1009492 3300021321 Eukaryota 15023
70 Ga0214545_1000758 3300021324 Eukaryota 55379
71 Ga0214545_1003792 3300021324 Eukaryota 28633
72 Ga0214545_1017913 3300021324 Eukaryota 6653
73 Ga0214543_1000048 3300021327 Eukaryota 149759
74 Ga0214543_1000869 3300021327 Eukaryota 55330
75 Ga0214543_1008896 3300021327 Eukaryota 16076
76 Ga0209760_100032 3300025207 Bacteria 138015
77 Ga0207427_100003 3300025231 Bacteria 1035004
78 Ga0209437_100002 3300025233 Bacteria 1574801
79 Ga0209233_1000004 3300025261 Bacteria 1574798
80 Ga0207647_10001580 3300025904 Bacteria 17479
81 Ga0207699_10085385 3300025906 Bacteria 1968
82 Ga0207684_10009314 3300025910 Bacteria 8678
83 Ga0207684_10036468 3300025910 Bacteria 4174
84 Ga0207693_10287997 3300025915 Bacteria 1287
85 Ga0207657_10282743 3300025919 Bacteria 1317
86 Ga0207694_10000014 3300025924 Bacteria 374435
87 Ga0207665_10089290 3300025939 Bacteria 2134
88 Ga0207689_10178183 3300025942 Bacteria 1753
89 Ga0207689_10267325 3300025942 Bacteria 1415
90 Ga0207667_10000051 3300025949 Bacteria 233836
91 Ga0207651_10298442 3300025960 Bacteria 1339
92 Ga0207641_10011144 3300026088 Bacteria 7375
93 Ga0207698_10043358 3300026142 Bacteria 3370
94 Ga0207698_10732770 3300026142 Bacteria 986
95 Ga0209389_1000553 3300027296 Eukaryota 22831
96 Ga0209389_1027790 3300027296 Eukaryota 4871
97 Ga0209589_1004453 3300027357 Eukaryota 24184
98 Ga0209589_1004660 3300027357 Eukaryota 23561
99 Ga0209589_1013575 3300027357 Eukaryota 10572
100 Ga0209489_101311 3300027361 Eukaryota 50747
101 Ga0209489_101429 3300027361 Eukaryota 49076
102 Ga0209700_100400 3300027363 Eukaryota 78798
103 Ga0209700_104058 3300027363 Eukaryota 26998
104 Ga0209974_10029650 3300027876 Bacteria 1813
105 Ga0265322_10007419 3300028654 Bacteria 3202
106 Ga0307515_10000047 3300028794 Bacteria 291475
107 Ga0307515_10025838 3300028794 Eukaryota 10137
108 Ga0265338_10038263 3300028800 Unclassified 4549
109 Ga0307511_10024552 3300030521 Eukaryota 5583
110 Ga0265330_10015595 3300031235 Bacteria 3514
111 Ga0265329_10008148 3300031242 Bacteria 3995
112 Ga0265331_10217867 3300031250 Bacteria 858
113 Ga0265316_10000135 3300031344 Bacteria 80236
114 Ga0265316_10013490 3300031344 Bacteria 7252
115 Ga0307509_10086150 3300031507 Eukaryota 3230
116 Ga0265313_10007071 3300031595 Bacteria 7756
117 Ga0307508_10046227 3300031616 Eukaryota 3887
118 Ga0265342_10024305 3300031712 Bacteria 3826
119 Ga0316576_10149579 3300031727 Unclassified 1760
120 Ga0316576_10340653 3300031727 Bacteria 1117
121 Ga0307516_10021644 3300031730 Eukaryota 6613
122 Ga0307516_10023283 3300031730 Eukaryota 6353
123 Ga0316577_10088670 3300031733 Unclassified 1731
124 Ga0307518_10102082 3300031838 Eukaryota 2052
125 Ga0307410_10029625 3300031852 Bacteria 3488
126 Ga0307409_100043270 3300031995 Bacteria 3380
127 Ga0307411_10005852 3300032005 Bacteria 6096
128 Ga0307415_100180884 3300032126 Bacteria 1654
129 Ga0307415_100308411 3300032126 Bacteria 1314
130 Ga0307507_10039260 3300033179 Eukaryota 4781
131 Ga0307510_10220160 3300033180 Eukaryota 1410
132 Ga0315911_1010673 3300033442 Eukaryota 3967
133 Ga0315911_1021376 3300033442 Eukaryota 3287
134 Ga0373936_0024648 3300035113 Bacteria 2350
135 Ga0373956_0119037 3300035119 Bacteria 1233
136 Ga0316574_0002188 3300035398 Bacteria 9699
137 Ga0373937_0662876 3300036401 Bacteria 989
138 Ga0316582_0065322 3300036647 Unclassified 2342
139 Ga0316584_0036372 3300036712 Bacteria 3653
140 Ga0395899_0025656 3300037312 Bacteria 4448
141 Ga0395900_0066387 3300037418 Bacteria 3707
142 Ga0395898_0091833 3300037466 Bacteria 2920
143 Ga0316581_0027900 3300037588 Unclassified 1690
144 Ga0395901_0001280 3300038443 Bacteria 26656
145 Ga0436361_1175655 3300039447 Bacteria 1831
146 Ga0439465_0064514 3300041413 Bacteria 1218
147 Ga0451840_30491 3300041497 Eukaryota 1026
148 Ga0439464_0029301 3300042439 Bacteria 1538
149 Ga0466961_0016361 3300044693 Bacteria 4764
150 Ga0466959_0020943 3300045049 Bacteria 4820
151 Ga0495590_0008805 3300046457 Bacteria 3838
152 Ga0495628_0415622 3300046516 Unclassified 981
153 Ga0495665_0062514 3300046531 Bacteria 1966
154 Ga0495645_0127291 3300046543 Unclassified 1789
155 Ga0495645_0229643 3300046543 Bacteria 1244
156 Ga0495625_0138382 3300046660 Bacteria 1644
157 Ga0495674_0015759 3300047319 Bacteria 7055
158 Ga0495686_0098996 3300047472 Bacteria 1761
159 Ga0496101_0027072 3300048904 Bacteria 3989
160 Ga0496104_0002671 3300048907 Bacteria 15348
161 Ga0496111_0468502 3300048914 Bacteria 929
162 Ga0496112_0055822 3300048915 Bacteria 3885
163 Ga0496116_0049280 3300048919 Bacteria 2818
164 Ga0496117_0005876 3300048920 Bacteria 12687
165 Ga0496117_0178528 3300048920 Bacteria 1223
166 Ga0496118_0023958 3300048921 Bacteria 5283
167 Ga0496118_0036691 3300048921 Bacteria 3958
168 Ga0496121_0001572 3300048924 Bacteria 38031
169 Ga0496121_0007799 3300048924 Bacteria 12818
170 Ga0496122_0083803 3300048925 Bacteria 2208
171 Ga0501034_0298397 3300049571 Bacteria 1548
172 Ga0501047_0175022 3300049581 Bacteria 2014
173 Ga0501073_0011621 3300049589 Bacteria 6433
174 Ga0501080_0077746 3300049742 Bacteria 3086
175 Ga0501044_0465713 3300049823 Bacteria 1169
176 nmdc:mga0k408_6601_c1 3300050493 Bacteria 6183
177 nmdc:mga06z11_6225_c1 3300050494 Bacteria 4836
178 nmdc:mga04h51_49539_c1 3300050495 Bacteria 1404
179 nmdc:mga07m45_19040_c1 3300050496 Bacteria 3715
180 nmdc:mga07m45_228_c2 3300050496 Bacteria 19933
181 nmdc:mga0n895_254976_c1 3300050512 Bacteria 1780
182 nmdc:mga0a205_444257_c1 3300050515 Bacteria 1157
183 nmdc:mga0a205_631949_c1 3300050515 Bacteria 922
184 nmdc:mga0sz30_12191_c1 3300050516 Bacteria 3339
185 Ga0500581_092035 3300053089 Eukaryota 1501
186 Ga0500647_0120147 3300053091 Eukaryota 1244
187 Ga0500651_0089076 3300053093 Eukaryota 1902
188 Ga0500640_030216 3300053095 Eukaryota 2372
189 Ga0500641_0073730 3300053096 Eukaryota 1441
190 Ga0500648_047434 3300053097 Eukaryota 2438
191 Ga0500654_003752 3300053099 Eukaryota 10823
192 Ga0500553_131879 3300053101 Eukaryota 1005
193 Ga0500557_088876 3300053105 Eukaryota 1023
194 Ga0500558_077538 3300053106 Eukaryota 1359
195 Ga0500607_038349 3300053121 Eukaryota 2607
196 Ga0500608_123217 3300053122 Eukaryota 1172
197 Ga0500614_010803 3300053123 Eukaryota 1965
198 Ga0500617_021252 3300053124 Eukaryota 2852
199 Ga0500623_008971 3300053127 Eukaryota 4989
200 Ga0500642_0023203 3300053130 Eukaryota 2487
201 Ga0500652_040528 3300053131 Eukaryota 1872
202 Ga0500579_020097 3300053143 Eukaryota 4332
203 Ga0500590_171986 3300053148 Eukaryota 951
204 Ga0500600_0072355 3300053149 Eukaryota 1887
205 Ga0500616_0000029 3300053153 Bacteria 428959
206 Ga0500622_0049686 3300053156 Eukaryota 2162
207 Ga0500633_0100473 3300053160 Eukaryota 1064
208 Ga0500634_0058649 3300053161 Eukaryota 2050
209 Ga0500639_102436 3300053163 Eukaryota 1406
210 Ga0500649_044455 3300053722 Eukaryota 1872
211 Ga0500567_041156 3300053723 Eukaryota 2154
212 Ga0500570_044348 3300053724 Eukaryota 2293
213 Ga0500576_046523 3300053725 Eukaryota 1938
214 Ga0500584_057869 3300053726 Eukaryota 1733
215 Ga0500625_061680 3300053729 Eukaryota 1699
216 Ga0501082_0099340 3300060353 Bacteria 2516
217 2599943463 2599185302 Bacteria 5954930
218 2599954574 2599185304 Bacteria 5951361
219 2599983887 2599185309 Bacteria 5969593
220 2600001489 2599185312 Bacteria 5912071
221 2600048692 2599185320 Bacteria 5963263
222 2644442024 2643221678 Bacteria 9540101
223 2808847090 2808606359 Bacteria 9866990
224 2809231336 2808606448 Bacteria 8656184
225 2844317691 2844315083 Bacteria 8138177
226 2844670662 2844665904 Bacteria 6817974
227 2858691044 2858688981 Bacteria 8184122
228 2887377488 2887375801 Bacteria 5334027
229 2903735371 2903727486 Bacteria 8281579
230 2906608710 2906602504 Bacteria 8295279
231 2919470039 2919468124 Bacteria 9133025
232 2928166163 2928163908 Bacteria 7561269
233 8019773218 8019769354 Bacteria 6924660
234 Ga0099822_1011725
235 SwRhRL2b_contig_552341
236 JGI24739J22299_10006942
237 JGI24735J21928_10030021
238 JGI25162J39368_1000004
239 JGI25163J39215_1000179
240 JGI25164J39214_1000031
241 JGI25165J46597_1000011
242 rootL2_10288840
243 rootL2_10311359
244 Ga0065704_10110146
245 Ga0070683_100762060
246 Ga0070682_100264935
247 Ga0068868_100406217
248 Ga0070660_100260033
249 Ga0070669_100165258
250 Ga0070710_10097381
251 Ga0070711_100191748
252 Ga0070694_100112413
253 Ga0070706_100334370
254 Ga0070707_100024683
255 Ga0070698_100004990
256 Ga0070699_100099349
257 Ga0070699_100342569
258 Ga0070697_100132780
259 Ga0070695_100001756
260 Ga0070704_100193854
261 Ga0070704_100327908
262 Ga0068855_100000006
263 Ga0068852_100041513
264 Ga0068852_100939830
265 Ga0068870_10348975
266 Ga0081455_10000199
267 Ga0070717_10263060
268 Ga0075368_10026803
269 Ga0070716_100186719
270 Ga0075369_10006270
271 Ga0075433_10294730
272 Ga0075436_100048207
273 Ga0099825_1000055
274 Ga0099825_1001163
275 Ga0099824_1000022
276 Ga0099824_1000081
277 Ga0099822_1002281
278 Ga0099823_1000809
279 Ga0099823_1018539
280 Ga0075435_100085733
281 Ga0105240_10198983
282 Ga0105245_10771714
283 Ga0105241_11007667
284 Ga0105242_10884381
285 Ga0105237_10224155
286 Ga0105238_10021527
287 Ga0123340_1000113
288 Ga0123341_1022358
289 Ga0105239_10006444
290 Ga0157369_10317525
291 Ga0157378_10046748
292 Ga0157378_10254629
293 Ga0157376_10099587
294 Ga0157376_10348368
295 Ga0182006_1007495
296 Ga0182006_1052838
297 Ga0214544_1001065
298 Ga0214544_1002314
299 Ga0214544_1016953
300 Ga0214542_1000044
301 Ga0214542_1001041
302 Ga0214542_1009492
303 Ga0214545_1000758
304 Ga0214545_1003792
305 Ga0214545_1017913
306 Ga0214543_1000048
307 Ga0214543_1000869
308 Ga0214543_1008896
309 Ga0209760_100032
310 Ga0207427_100003
311 Ga0209437_100002
312 Ga0209233_1000004
313 Ga0207647_10001580
314 Ga0207699_10085385
315 Ga0207684_10009314
316 Ga0207684_10036468
317 Ga0207693_10287997
318 Ga0207657_10282743
319 Ga0207694_10000014
320 Ga0207665_10089290
321 Ga0207689_10178183
322 Ga0207689_10267325
323 Ga0207667_10000051
324 Ga0207651_10298442
325 Ga0207641_10011144
326 Ga0207698_10043358
327 Ga0207698_10732770
328 Ga0209389_1000553
329 Ga0209389_1027790
330 Ga0209589_1004453
331 Ga0209589_1004660
332 Ga0209589_1013575
333 Ga0209489_101311
334 Ga0209489_101429
335 Ga0209700_100400
336 Ga0209700_104058
337 Ga0209974_10029650
338 Ga0265322_10007419
339 Ga0307515_10000047
340 Ga0307515_10025838
341 Ga0265338_10038263
342 Ga0307511_10024552
343 Ga0265330_10015595
344 Ga0265329_10008148
345 Ga0265331_10217867
346 Ga0265316_10000135
347 Ga0265316_10013490
348 Ga0307509_10086150
349 Ga0265313_10007071
350 Ga0307508_10046227
351 Ga0265342_10024305
352 Ga0316576_10149579
353 Ga0316576_10340653
354 Ga0307516_10021644
355 Ga0307516_10023283
356 Ga0316577_10088670
357 Ga0307518_10102082
358 Ga0307410_10029625
359 Ga0307409_100043270
360 Ga0307411_10005852
361 Ga0307415_100180884
362 Ga0307415_100308411
363 Ga0307507_10039260
364 Ga0307510_10220160
365 Ga0315911_1010673
366 Ga0315911_1021376
367 Ga0373936_0024648
368 Ga0373956_0119037
369 Ga0316574_0002188
370 Ga0373937_0662876
371 Ga0316582_0065322
372 Ga0316584_0036372
373 Ga0395899_0025656
374 Ga0395900_0066387
375 Ga0395898_0091833
376 Ga0316581_0027900
377 Ga0395901_0001280
378 Ga0436361_1175655
379 Ga0439465_0064514
380 Ga0451840_30491
381 Ga0439464_0029301
382 Ga0466961_0016361
383 Ga0466959_0020943
384 Ga0495590_0008805
385 Ga0495628_0415622
386 Ga0495665_0062514
387 Ga0495645_0127291
388 Ga0495645_0229643
389 Ga0495625_0138382
390 Ga0495674_0015759
391 Ga0495686_0098996
392 Ga0496101_0027072
393 Ga0496104_0002671
394 Ga0496111_0468502
395 Ga0496112_0055822
396 Ga0496116_0049280
397 Ga0496117_0005876
398 Ga0496117_0178528
399 Ga0496118_0023958
400 Ga0496118_0036691
401 Ga0496121_0001572
402 Ga0496121_0007799
403 Ga0496122_0083803
404 Ga0501034_0298397
405 Ga0501047_0175022
406 Ga0501073_0011621
407 Ga0501080_0077746
408 Ga0501044_0465713
409 nmdc:mga0k408_6601_c1
410 nmdc:mga06z11_6225_c1
411 nmdc:mga04h51_49539_c1
412 nmdc:mga07m45_19040_c1
413 nmdc:mga07m45_228_c2
414 nmdc:mga0n895_254976_c1
415 nmdc:mga0a205_444257_c1
416 nmdc:mga0a205_631949_c1
417 nmdc:mga0sz30_12191_c1
418 Ga0500581_092035
419 Ga0500647_0120147
420 Ga0500651_0089076
421 Ga0500640_030216
422 Ga0500641_0073730
423 Ga0500648_047434
424 Ga0500654_003752
425 Ga0500553_131879
426 Ga0500557_088876
427 Ga0500558_077538
428 Ga0500607_038349
429 Ga0500608_123217
430 Ga0500614_010803
431 Ga0500617_021252
432 Ga0500623_008971
433 Ga0500642_0023203
434 Ga0500652_040528
435 Ga0500579_020097
436 Ga0500590_171986
437 Ga0500600_0072355
438 Ga0500616_0000029
439 Ga0500622_0049686
440 Ga0500633_0100473
441 Ga0500634_0058649
442 Ga0500639_102436
443 Ga0500649_044455
444 Ga0500567_041156
445 Ga0500570_044348
446 Ga0500576_046523
447 Ga0500584_057869
448 Ga0500625_061680
449 Ga0501082_0099340
450 2599943463
451 2599954574
452 2599983887
453 2600001489
454 2600048692
455 2644442024
456 2808847090
457 2809231336
458 2844317691
459 2844670662
460 2858691044
461 2887377488
462 2903735371
463 2906608710
464 2919470039
465 2928166163
466 8019773218

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

18

214

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

24

265

0.92

PF08659

KR

KR domain

19

197

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fgs-assembly1.cif.gz_D crystal structure of a probable dehydrogenase protein 0.9794 1 250
4fgs-assembly1.cif.gz_B crystal structure of a probable dehydrogenase protein 0.9781 2 250
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9777 2 250
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9772 2 250
4i5f-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s 0.9751 2 250
ID Description Score Start End Superfamily
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9619 2 76 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9591 2 250 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9553 3 190 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9491 1 250 3.40.50.720
1ulsC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9481 2 249 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1J5R7E1-F1-model_v4 Diacetyl reductase (EC 1.1.1.304) 0.9861 2 250 GO:0052588
AF-A0A1H0LJ26-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9853 1 250 GO:0016491
AF-A0A5B8UWP2-F1-model_v4 SDR family oxidoreductase 0.985 2 250 GO:0016491
AF-A0A0N1DUU3-F1-model_v4 Short-chain dehydrogenase 0.9839 2 250 GO:0016491
AF-A0A7H9V983-F1-model_v4 deleted 0.9827 1 249

Map