F348906

General Info

Members Datasets Scaffolds Average Seq Length
236 157 472 186

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100430525|Ga0070696_1004305251
Length 218
Sequence MNIFAPFLTASRVLQNKKPSQTETDSHEWKTRTNMRKLWVKAWITLDGVFDADTMDHWWQNTNSPERMQYIKEEYSKGDAYLLGRVTYEMLWPGWSTQTTGDGPGPILNRMHKYVVSNTLTTAPWKESTIISGNVVDEIAKLKQQPGKDIIIDGSGSLVQSLMGTGLIDEYRFLVQPYVMGRGRRFFPDGTPQTSLRLVESKTLSFGSLALVYQPTDK

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
111 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
116 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
130 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
138 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
139 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
140 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
141 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
142 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
143 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
144 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
147 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 1.27
Rhizosphere 95.76
Stem 0
Stem Tuber 0
Unclassified 11.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100430525 3300005546 Unclassified 1038
2 JGI25406J46586_10095778 3300003203 Bacteria 890
3 rootH1_10054168 3300003323 Bacteria 3496
4 Ga0070676_10014084 3300005328 Bacteria 4389
5 Ga0070670_100364993 3300005331 Bacteria 1270
6 Ga0068868_100617387 3300005338 Bacteria 962
7 Ga0070689_100365792 3300005340 Bacteria 1213
8 Ga0070692_10218719 3300005345 Bacteria 1125
9 Ga0070675_100009933 3300005354 Bacteria 7423
10 Ga0070675_100106497 3300005354 Bacteria 2367
11 Ga0070675_100250812 3300005354 Bacteria 1549
12 Ga0070675_100829527 3300005354 Bacteria 846
13 Ga0070688_100257567 3300005365 Bacteria 1245
14 Ga0070688_100881530 3300005365 Bacteria 705
15 Ga0070714_100671612 3300005435 Unclassified 998
16 Ga0070713_100086298 3300005436 Bacteria 2691
17 Ga0070713_100387026 3300005436 Bacteria 1304
18 Ga0070701_10655272 3300005438 Bacteria 701
19 Ga0070700_100030104 3300005441 Bacteria 3241
20 Ga0070700_100174819 3300005441 Bacteria 1490
21 Ga0070694_100110195 3300005444 Bacteria 1960
22 Ga0070694_100273352 3300005444 Bacteria 1286
23 Ga0070708_100118900 3300005445 Bacteria 2435
24 Ga0070708_101360116 3300005445 Unclassified 663
25 Ga0070706_100064324 3300005467 Bacteria 3390
26 Ga0070707_100037950 3300005468 Bacteria 4600
27 Ga0070707_100231230 3300005468 Unclassified 1800
28 Ga0070707_100290797 3300005468 Bacteria 1588
29 Ga0070707_100370514 3300005468 Bacteria 1391
30 Ga0070698_100103495 3300005471 Bacteria 2817
31 Ga0070698_100213087 3300005471 Bacteria 1866
32 Ga0070699_100010501 3300005518 Bacteria 8011
33 Ga0070699_100034695 3300005518 Bacteria 4360
34 Ga0070684_100069241 3300005535 Bacteria 3103
35 Ga0070697_100020664 3300005536 Bacteria 5211
36 Ga0068853_100974023 3300005539 Unclassified 816
37 Ga0070672_100436413 3300005543 Bacteria 1126
38 Ga0070686_100517256 3300005544 Bacteria 929
39 Ga0070696_100642209 3300005546 Unclassified 860
40 Ga0068855_100055349 3300005563 Bacteria 4660
41 Ga0068855_100133897 3300005563 Bacteria 2828
42 Ga0068852_100272837 3300005616 Bacteria 1628
43 Ga0068859_101046893 3300005617 Bacteria 897
44 Ga0068864_100263857 3300005618 Bacteria 1603
45 Ga0068864_101455367 3300005618 Bacteria 688
46 Ga0068861_101137972 3300005719 Bacteria 752
47 Ga0068863_100813241 3300005841 Bacteria 932
48 Ga0068858_101702643 3300005842 Unclassified 623
49 Ga0068860_100059201 3300005843 Bacteria 3642
50 Ga0068860_100783047 3300005843 Bacteria 967
51 Ga0068860_101197099 3300005843 Bacteria 780
52 Ga0068862_100062150 3300005844 Bacteria 3211
53 Ga0068862_100429279 3300005844 Bacteria 1242
54 Ga0068862_100579993 3300005844 Bacteria 1074
55 Ga0081539_10011445 3300005985 Bacteria 7007
56 Ga0070717_10016020 3300006028 Bacteria 5805
57 Ga0070717_10083064 3300006028 Unclassified 2693
58 Ga0070717_10686421 3300006028 Bacteria 930
59 Ga0097621_100218935 3300006237 Unclassified 1658
60 Ga0068871_100487057 3300006358 Unclassified 1110
61 Ga0075428_100190111 3300006844 Bacteria 2221
62 Ga0075428_100584631 3300006844 Bacteria 1193
63 Ga0075433_10091759 3300006852 Bacteria 2685
64 Ga0075434_100092864 3300006871 Unclassified 3020
65 Ga0075434_100644383 3300006871 Bacteria 1078
66 Ga0075429_100057855 3300006880 Unclassified 3376
67 Ga0075429_100228067 3300006880 Bacteria 1631
68 Ga0068865_100891769 3300006881 Bacteria 773
69 Ga0097620_101046893 3300006931 Bacteria 897
70 Ga0105240_10336064 3300009093 Bacteria 1717
71 Ga0105240_11775987 3300009093 Bacteria 643
72 Ga0111539_10033677 3300009094 Bacteria 6219
73 Ga0111539_10042420 3300009094 Bacteria 5463
74 Ga0111539_10106105 3300009094 Bacteria 3296
75 Ga0111539_12220349 3300009094 Unclassified 637
76 Ga0105247_10163612 3300009101 Unclassified 1475
77 Ga0105247_10239461 3300009101 Bacteria 1236
78 Ga0114129_10115449 3300009147 Unclassified 3700
79 Ga0114129_10924014 3300009147 Bacteria 1104
80 Ga0105241_10646004 3300009174 Bacteria 960
81 Ga0105242_10240422 3300009176 Bacteria 1627
82 Ga0105237_11132385 3300009545 Bacteria 789
83 Ga0105249_10133693 3300009553 Bacteria 2371
84 Ga0105249_10169901 3300009553 Bacteria 2114
85 Ga0105249_10201236 3300009553 Bacteria 1949
86 Ga0105249_10905426 3300009553 Unclassified 949
87 Ga0105239_10001735 3300010375 Bacteria 28734
88 Ga0105239_10045881 3300010375 Bacteria 4789
89 Ga0105239_10803712 3300010375 Bacteria 1078
90 Ga0105246_10104843 3300011119 Bacteria 2065
91 Ga0157373_10241589 3300013100 Bacteria 1277
92 Ga0157374_10754723 3300013296 Unclassified 988
93 Ga0157378_10379840 3300013297 Bacteria 1387
94 Ga0157378_12016363 3300013297 Bacteria 627
95 Ga0163162_10186710 3300013306 Bacteria 2200
96 Ga0163162_10207049 3300013306 Bacteria 2091
97 Ga0163162_10453882 3300013306 Bacteria 1414
98 Ga0163162_10960237 3300013306 Bacteria 965
99 Ga0157375_10170185 3300013308 Bacteria 2325
100 Ga0157375_10200327 3300013308 Bacteria 2152
101 Ga0157375_10286268 3300013308 Unclassified 1811
102 Ga0163163_11036972 3300014325 Bacteria 883
103 Ga0157377_10961588 3300014745 Bacteria 643
104 Ga0157379_10818342 3300014968 Bacteria 880
105 Ga0157379_10883050 3300014968 Bacteria 847
106 Ga0157376_10287579 3300014969 Bacteria 1551
107 Ga0213873_10118844 3300021358 Bacteria 774
108 Ga0213874_10004320 3300021377 Bacteria 3228
109 Ga0213874_10199912 3300021377 Bacteria 718
110 Ga0209455_1003822 3300025272 Bacteria 5161
111 Ga0207645_10072170 3300025907 Bacteria 2209
112 Ga0207645_10879078 3300025907 Bacteria 609
113 Ga0207643_10090618 3300025908 Bacteria 1782
114 Ga0207684_10061446 3300025910 Bacteria 3190
115 Ga0207684_10212763 3300025910 Bacteria 1668
116 Ga0207654_10918330 3300025911 Bacteria 635
117 Ga0207695_10009450 3300025913 Bacteria 12060
118 Ga0207695_10472661 3300025913 Bacteria 1136
119 Ga0207660_11117372 3300025917 Unclassified 642
120 Ga0207662_10450245 3300025918 Bacteria 880
121 Ga0207662_10628956 3300025918 Bacteria 748
122 Ga0207646_10002456 3300025922 Bacteria 21890
123 Ga0207646_10074999 3300025922 Bacteria 3022
124 Ga0207646_10153164 3300025922 Unclassified 2079
125 Ga0207646_10310535 3300025922 Unclassified 1425
126 Ga0207646_10395122 3300025922 Bacteria 1249
127 Ga0207681_10179217 3300025923 Bacteria 1613
128 Ga0207650_10288518 3300025925 Bacteria 1337
129 Ga0207659_10151985 3300025926 Bacteria 1809
130 Ga0207659_10203927 3300025926 Bacteria 1581
131 Ga0207687_10130322 3300025927 Bacteria 1894
132 Ga0207700_10480523 3300025928 Bacteria 1098
133 Ga0207664_10803429 3300025929 Unclassified 846
134 Ga0207706_10010807 3300025933 Bacteria 8332
135 Ga0207709_10161681 3300025935 Bacteria 1562
136 Ga0207670_10209270 3300025936 Bacteria 1486
137 Ga0207691_10380833 3300025940 Bacteria 1204
138 Ga0207691_10510748 3300025940 Bacteria 1020
139 Ga0207689_10587268 3300025942 Bacteria 937
140 Ga0207667_10957193 3300025949 Bacteria 845
141 Ga0207651_10684154 3300025960 Bacteria 903
142 Ga0207712_10741990 3300025961 Bacteria 860
143 Ga0207678_10265979 3300026067 Bacteria 1470
144 Ga0207708_10060177 3300026075 Bacteria 2899
145 Ga0207708_10158780 3300026075 Bacteria 1784
146 Ga0207708_10918516 3300026075 Bacteria 758
147 Ga0207641_10775368 3300026088 Bacteria 947
148 Ga0207641_11061921 3300026088 Bacteria 808
149 Ga0207648_10251784 3300026089 Bacteria 1574
150 Ga0207648_11366433 3300026089 Bacteria 666
151 Ga0207676_10179573 3300026095 Bacteria 1852
152 Ga0207676_10228508 3300026095 Bacteria 1662
153 Ga0207674_10639699 3300026116 Bacteria 1027
154 Ga0207674_11684895 3300026116 Bacteria 602
155 Ga0207675_100172539 3300026118 Bacteria 2067
156 Ga0207698_10242533 3300026142 Bacteria 1644
157 Ga0207428_10195957 3300027907 Bacteria 1521
158 Ga0207428_10945700 3300027907 Bacteria 607
159 Ga0268265_10224283 3300028380 Bacteria 1647
160 Ga0268265_10258701 3300028380 Bacteria 1546
161 Ga0268265_10687372 3300028380 Unclassified 987
162 Ga0307408_100437685 3300031548 Bacteria 1131
163 Ga0307413_10047869 3300031824 Bacteria 2552
164 Ga0307410_10054293 3300031852 Bacteria 2715
165 Ga0307406_10273538 3300031901 Bacteria 1284
166 Ga0307407_10042539 3300031903 Bacteria 2548
167 Ga0307407_10336270 3300031903 Bacteria 1064
168 Ga0307412_10539339 3300031911 Bacteria 978
169 Ga0307412_10614373 3300031911 Bacteria 922
170 Ga0307416_100623577 3300032002 Bacteria 1160
171 Ga0307414_10214644 3300032004 Bacteria 1575
172 Ga0307411_10136871 3300032005 Bacteria 1800
173 Ga0307411_10236046 3300032005 Bacteria 1428
174 Ga0307415_100195322 3300032126 Bacteria 1600
175 Ga0436363_0083364 3300039450 Bacteria 963
176 Ga0436362_0763367 3300039453 Bacteria 607
177 Ga0436362_1118624 3300039453 Bacteria 1644
178 Ga0451797_0911836 3300041453 Bacteria 857
179 Ga0451853_0116760 3300041512 Bacteria 662
180 Ga0450923_009813 3300042125 Bacteria 1683
181 Ga0466969_0176609 3300044656 Bacteria 978
182 Ga0466972_0003458 3300044658 Bacteria 7838
183 Ga0466972_0153617 3300044658 Bacteria 1082
184 Ga0466965_0000199 3300044683 Bacteria 18781
185 Ga0466965_0299866 3300044683 Bacteria 872
186 Ga0466961_0035014 3300044693 Bacteria 3224
187 Ga0466961_0145930 3300044693 Bacteria 1480
188 Ga0466961_0147884 3300044693 Bacteria 1468
189 Ga0466963_0584386 3300044694 Bacteria 789
190 Ga0453684_0305859 3300044712 Bacteria 1806
191 Ga0453684_0850841 3300044712 Bacteria 980
192 Ga0466968_0000608 3300044735 Bacteria 12200
193 Ga0466970_0174698 3300044765 Bacteria 1191
194 Ga0466957_0007540 3300044842 Bacteria 6150
195 Ga0466957_0321826 3300044842 Bacteria 1044
196 Ga0466960_0004362 3300044901 Bacteria 5523
197 Ga0466960_0019387 3300044901 Bacteria 2997
198 Ga0466959_0670025 3300045049 Bacteria 696
199 Ga0451576_0016836 3300045051 Bacteria 8059
200 Ga0466967_0928807 3300045976 Bacteria 866
201 Ga0496108_0000098 3300048911 Bacteria 90200
202 Ga0496110_0300199 3300048913 Bacteria 1463
203 Ga0501295_110331 3300049518 Bacteria 653
204 Ga0501299_073817 3300049522 Bacteria 745
205 Ga0501034_0336267 3300049571 Bacteria 1441
206 Ga0501037_0009279 3300049573 Bacteria 7214
207 Ga0501038_0022337 3300049574 Bacteria 5672
208 Ga0501039_0872934 3300049575 Bacteria 701
209 Ga0501047_0195272 3300049581 Bacteria 1886
210 Ga0501048_0732751 3300049582 Bacteria 710
211 Ga0501199_027244 3300049650 Bacteria 690
212 Ga0501207_087274 3300049654 Bacteria 609
213 Ga0501227_087517 3300049665 Bacteria 820
214 Ga0501230_049416 3300049667 Bacteria 833
215 Ga0501243_028193 3300049675 Bacteria 950
216 Ga0501256_016226 3300049685 Bacteria 752
217 Ga0501257_001208 3300049686 Bacteria 5301
218 Ga0501261_019118 3300049690 Bacteria 971
219 Ga0501261_049536 3300049690 Unclassified 685
220 Ga0501081_0859103 3300049743 Bacteria 684
221 Ga0501271_024024 3300049768 Bacteria 721
222 Ga0501283_032432 3300049779 Bacteria 881
223 Ga0501044_0017679 3300049823 Bacteria 7648
224 Ga0501212_048417 3300049851 Bacteria 715
225 nmdc:mga05p37_1707109_c1 3300050507 Bacteria 613
226 nmdc:mga05p37_19131_c1 3300050507 Bacteria 8284
227 nmdc:mga05p37_39878_c1 3300050507 Bacteria 5766
228 nmdc:mga09592_471904_c1 3300050508 Bacteria 1082
229 nmdc:mga06r32_562376_c1 3300050510 Bacteria 1113
230 nmdc:mga08y16_130444_c1 3300050511 Bacteria 2614
231 nmdc:mga0n895_391689_c1 3300050512 Unclassified 1405
232 nmdc:mga0n895_62802_c1 3300050512 Plasmid 3672
233 nmdc:mga0n895_692495_c1 3300050512 Bacteria 1015
234 nmdc:mga0a205_41502_c1 3300050515 Plasmid 4431
235 Ga0500607_219435 3300053121 Unclassified 794
236 Ga0466962_0280986 3300061719 Unclassified 822
237 Ga0070696_100430525
238 JGI25406J46586_10095778
239 rootH1_10054168
240 Ga0070676_10014084
241 Ga0070670_100364993
242 Ga0068868_100617387
243 Ga0070689_100365792
244 Ga0070692_10218719
245 Ga0070675_100009933
246 Ga0070675_100106497
247 Ga0070675_100250812
248 Ga0070675_100829527
249 Ga0070688_100257567
250 Ga0070688_100881530
251 Ga0070714_100671612
252 Ga0070713_100086298
253 Ga0070713_100387026
254 Ga0070701_10655272
255 Ga0070700_100030104
256 Ga0070700_100174819
257 Ga0070694_100110195
258 Ga0070694_100273352
259 Ga0070708_100118900
260 Ga0070708_101360116
261 Ga0070706_100064324
262 Ga0070707_100037950
263 Ga0070707_100231230
264 Ga0070707_100290797
265 Ga0070707_100370514
266 Ga0070698_100103495
267 Ga0070698_100213087
268 Ga0070699_100010501
269 Ga0070699_100034695
270 Ga0070684_100069241
271 Ga0070697_100020664
272 Ga0068853_100974023
273 Ga0070672_100436413
274 Ga0070686_100517256
275 Ga0070696_100642209
276 Ga0068855_100055349
277 Ga0068855_100133897
278 Ga0068852_100272837
279 Ga0068859_101046893
280 Ga0068864_100263857
281 Ga0068864_101455367
282 Ga0068861_101137972
283 Ga0068863_100813241
284 Ga0068858_101702643
285 Ga0068860_100059201
286 Ga0068860_100783047
287 Ga0068860_101197099
288 Ga0068862_100062150
289 Ga0068862_100429279
290 Ga0068862_100579993
291 Ga0081539_10011445
292 Ga0070717_10016020
293 Ga0070717_10083064
294 Ga0070717_10686421
295 Ga0097621_100218935
296 Ga0068871_100487057
297 Ga0075428_100190111
298 Ga0075428_100584631
299 Ga0075433_10091759
300 Ga0075434_100092864
301 Ga0075434_100644383
302 Ga0075429_100057855
303 Ga0075429_100228067
304 Ga0068865_100891769
305 Ga0097620_101046893
306 Ga0105240_10336064
307 Ga0105240_11775987
308 Ga0111539_10033677
309 Ga0111539_10042420
310 Ga0111539_10106105
311 Ga0111539_12220349
312 Ga0105247_10163612
313 Ga0105247_10239461
314 Ga0114129_10115449
315 Ga0114129_10924014
316 Ga0105241_10646004
317 Ga0105242_10240422
318 Ga0105237_11132385
319 Ga0105249_10133693
320 Ga0105249_10169901
321 Ga0105249_10201236
322 Ga0105249_10905426
323 Ga0105239_10001735
324 Ga0105239_10045881
325 Ga0105239_10803712
326 Ga0105246_10104843
327 Ga0157373_10241589
328 Ga0157374_10754723
329 Ga0157378_10379840
330 Ga0157378_12016363
331 Ga0163162_10186710
332 Ga0163162_10207049
333 Ga0163162_10453882
334 Ga0163162_10960237
335 Ga0157375_10170185
336 Ga0157375_10200327
337 Ga0157375_10286268
338 Ga0163163_11036972
339 Ga0157377_10961588
340 Ga0157379_10818342
341 Ga0157379_10883050
342 Ga0157376_10287579
343 Ga0213873_10118844
344 Ga0213874_10004320
345 Ga0213874_10199912
346 Ga0209455_1003822
347 Ga0207645_10072170
348 Ga0207645_10879078
349 Ga0207643_10090618
350 Ga0207684_10061446
351 Ga0207684_10212763
352 Ga0207654_10918330
353 Ga0207695_10009450
354 Ga0207695_10472661
355 Ga0207660_11117372
356 Ga0207662_10450245
357 Ga0207662_10628956
358 Ga0207646_10002456
359 Ga0207646_10074999
360 Ga0207646_10153164
361 Ga0207646_10310535
362 Ga0207646_10395122
363 Ga0207681_10179217
364 Ga0207650_10288518
365 Ga0207659_10151985
366 Ga0207659_10203927
367 Ga0207687_10130322
368 Ga0207700_10480523
369 Ga0207664_10803429
370 Ga0207706_10010807
371 Ga0207709_10161681
372 Ga0207670_10209270
373 Ga0207691_10380833
374 Ga0207691_10510748
375 Ga0207689_10587268
376 Ga0207667_10957193
377 Ga0207651_10684154
378 Ga0207712_10741990
379 Ga0207678_10265979
380 Ga0207708_10060177
381 Ga0207708_10158780
382 Ga0207708_10918516
383 Ga0207641_10775368
384 Ga0207641_11061921
385 Ga0207648_10251784
386 Ga0207648_11366433
387 Ga0207676_10179573
388 Ga0207676_10228508
389 Ga0207674_10639699
390 Ga0207674_11684895
391 Ga0207675_100172539
392 Ga0207698_10242533
393 Ga0207428_10195957
394 Ga0207428_10945700
395 Ga0268265_10224283
396 Ga0268265_10258701
397 Ga0268265_10687372
398 Ga0307408_100437685
399 Ga0307413_10047869
400 Ga0307410_10054293
401 Ga0307406_10273538
402 Ga0307407_10042539
403 Ga0307407_10336270
404 Ga0307412_10539339
405 Ga0307412_10614373
406 Ga0307416_100623577
407 Ga0307414_10214644
408 Ga0307411_10136871
409 Ga0307411_10236046
410 Ga0307415_100195322
411 Ga0436363_0083364
412 Ga0436362_0763367
413 Ga0436362_1118624
414 Ga0451797_0911836
415 Ga0451853_0116760
416 Ga0450923_009813
417 Ga0466969_0176609
418 Ga0466972_0003458
419 Ga0466972_0153617
420 Ga0466965_0000199
421 Ga0466965_0299866
422 Ga0466961_0035014
423 Ga0466961_0145930
424 Ga0466961_0147884
425 Ga0466963_0584386
426 Ga0453684_0305859
427 Ga0453684_0850841
428 Ga0466968_0000608
429 Ga0466970_0174698
430 Ga0466957_0007540
431 Ga0466957_0321826
432 Ga0466960_0004362
433 Ga0466960_0019387
434 Ga0466959_0670025
435 Ga0451576_0016836
436 Ga0466967_0928807
437 Ga0496108_0000098
438 Ga0496110_0300199
439 Ga0501295_110331
440 Ga0501299_073817
441 Ga0501034_0336267
442 Ga0501037_0009279
443 Ga0501038_0022337
444 Ga0501039_0872934
445 Ga0501047_0195272
446 Ga0501048_0732751
447 Ga0501199_027244
448 Ga0501207_087274
449 Ga0501227_087517
450 Ga0501230_049416
451 Ga0501243_028193
452 Ga0501256_016226
453 Ga0501257_001208
454 Ga0501261_019118
455 Ga0501261_049536
456 Ga0501081_0859103
457 Ga0501271_024024
458 Ga0501283_032432
459 Ga0501044_0017679
460 Ga0501212_048417
461 nmdc:mga05p37_1707109_c1
462 nmdc:mga05p37_19131_c1
463 nmdc:mga05p37_39878_c1
464 nmdc:mga09592_471904_c1
465 nmdc:mga06r32_562376_c1
466 nmdc:mga08y16_130444_c1
467 nmdc:mga0n895_391689_c1
468 nmdc:mga0n895_62802_c1
469 nmdc:mga0n895_692495_c1
470 nmdc:mga0a205_41502_c1
471 Ga0500607_219435
472 Ga0466962_0280986

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

36

209

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.8068 1 181
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.7986 1 181
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7803 3 179
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7681 3 179
5ecx-assembly1.cif.gz_B klebsiella pneumoniae dfra1 complexed with nadph and 6-ethyl-5-(3-(6-(pyridin-4-yl)benzo[d][1,3]dioxol-4-yl)but-1-yn-1-yl)pyrimidine-2,4-diamine 0.7669 3 179
ID Description Score Start End Superfamily
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8068 1 181 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7986 1 181 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7941 3 182 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7777 3 182 3.40.430.10
af_Q54FJ0_879_1544_2.70.130.10 Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain 0.7718 158 182 2.70.130.10
ID Description Score Start End GO Terms
AF-A0A3N5UR49-F1-model_v4 Dihydrofolate reductase 0.9475 1 182 GO:0008703
GO:0009231
AF-A0A7W1S804-F1-model_v4 Dihydrofolate reductase family protein 0.9441 31 180 GO:0008703
GO:0009231
AF-A0A3N5UR49-F1-model_v4 Dihydrofolate reductase 0.9425 1 182 GO:0008703
GO:0009231
AF-A0A3D1SPB8-F1-model_v4 Pyrimidine reductase 0.9406 1 180 GO:0008703
GO:0009231
AF-A0A535VT16-F1-model_v4 Dihydrofolate reductase 0.9283 29 179 GO:0008703
GO:0009231

Map