F348886

General Info

Members Datasets Scaffolds Average Seq Length
236 176 472 206

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100227928|Ga0070698_1002279282
Length 242
Sequence MIYLKIFEQAISQNCQTKRSTLLQKEPAIILLDHWNMDDLLFFRGLLIGFSIAAPVGPIGVLCIRRTLSDGRLSGLVSGLGAATADALYGCVAGFGLTFISSFLVGQQMWFKLFGGLFLCYLGIKTLLSKPAEQAAKASGSGLLGAYASTFLLTVTIPLTILSFAAIFAALGLGNTTGSYASAVVLVLGVFLGSALWWLLLVGGVGLFRTKFNAQGLLWVNRMSGLIITVFGVVALGRLMYV

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
86 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
87 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
88 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
98 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
103 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
109 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
115 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
160 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
161 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
162 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
163 2643221731 Bacillus sp. Root147 Isolate Unclassified
164 2643221732 Bacillus sp. Root239 Isolate Unclassified
165 2738543017 Bacillus sp. OV186 Isolate Unclassified
166 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
167 2842882022 Bacillus sp. R-71893 Isolate Unclassified
168 2857586860 Bacillus sp. R-71935 Isolate Unclassified
169 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
170 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
171 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
172 2919720352 Priestia megaterium 4340 Isolate Unclassified
173 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
174 2929004312 Priestia megaterium 1104 Isolate Unclassified
175 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
176 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.64
Metatranscriptomes 0
Isolates 6.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.66
Nodule 0
Rhizoplane 4.24
Rhizosphere 81.78
Stem 0
Stem Tuber 0
Unclassified 15.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100227928 3300005471 Unclassified 1796
2 JGI25151J46595_10008831 3300003187 Bacteria 4817
3 JGI25151J46595_10091394 3300003187 Bacteria 846
4 rootH1_10042465 3300003316 Bacteria 11931
5 Ga0055528_1020092 3300003790 Bacteria 2181
6 Ga0070683_100229744 3300005329 Bacteria 1764
7 Ga0070690_100010917 3300005330 Bacteria 5300
8 Ga0070670_100056772 3300005331 Unclassified 3361
9 Ga0070670_100200086 3300005331 Archaea 1736
10 Ga0070682_100765058 3300005337 Unclassified 781
11 Ga0070689_100146335 3300005340 Bacteria 1903
12 Ga0070691_10019969 3300005341 Bacteria 3093
13 Ga0070687_100430983 3300005343 Bacteria 872
14 Ga0070692_10030750 3300005345 Bacteria 2687
15 Ga0070668_101042848 3300005347 Bacteria 736
16 Ga0070688_100347341 3300005365 Bacteria 1085
17 Ga0070667_100880273 3300005367 Bacteria 833
18 Ga0070714_100031964 3300005435 Bacteria 4394
19 Ga0070713_100072211 3300005436 Bacteria 2918
20 Ga0070701_10076931 3300005438 Bacteria 1797
21 Ga0070701_10125586 3300005438 Bacteria 1451
22 Ga0070705_100011925 3300005440 Bacteria 4402
23 Ga0070705_100049065 3300005440 Unclassified 2449
24 Ga0070705_100400147 3300005440 Unclassified 1017
25 Ga0070694_100202887 3300005444 Bacteria 1479
26 Ga0070694_100470376 3300005444 Bacteria 996
27 Ga0070708_100455980 3300005445 Bacteria 1206
28 Ga0070681_10003549 3300005458 Bacteria 14629
29 Ga0068867_100081466 3300005459 Bacteria 2440
30 Ga0070706_100000365 3300005467 Bacteria 54483
31 Ga0070698_100074202 3300005471 Unclassified 3407
32 Ga0070698_100457756 3300005471 Bacteria 1212
33 Ga0070699_100076356 3300005518 Bacteria 2916
34 Ga0070699_100559166 3300005518 Bacteria 1042
35 Ga0070684_100771242 3300005535 Unclassified 898
36 Ga0070697_100583139 3300005536 Bacteria 982
37 Ga0070672_100514824 3300005543 Bacteria 1036
38 Ga0070695_100043163 3300005545 Bacteria 2866
39 Ga0070696_100168431 3300005546 Unclassified 1618
40 Ga0070696_100168999 3300005546 Unclassified 1615
41 Ga0070696_100459588 3300005546 Bacteria 1006
42 Ga0070704_100194612 3300005549 Bacteria 1632
43 Ga0070704_100553565 3300005549 Bacteria 1005
44 Ga0068855_100679842 3300005563 Bacteria 1103
45 Ga0068857_100986343 3300005577 Bacteria 810
46 Ga0070702_100472986 3300005615 Bacteria 914
47 Ga0068859_100120698 3300005617 Bacteria 2688
48 Ga0068863_100055461 3300005841 Unclassified 3752
49 Ga0068860_100140075 3300005843 Unclassified 2325
50 Ga0068862_100214490 3300005844 Bacteria 1740
51 Ga0070712_100005791 3300006175 Bacteria 7638
52 Ga0070712_100052596 3300006175 Bacteria 2841
53 Ga0075428_100120603 3300006844 Unclassified 2855
54 Ga0075431_100278386 3300006847 Bacteria 1694
55 Ga0075434_100012560 3300006871 Bacteria 8031
56 Ga0075434_100137899 3300006871 Bacteria 2459
57 Ga0075429_100004735 3300006880 Bacteria 11712
58 Ga0075429_100089870 3300006880 Bacteria 2678
59 Ga0075429_100161372 3300006880 Bacteria 1963
60 Ga0075436_100105949 3300006914 Bacteria 1961
61 Ga0075436_100238397 3300006914 Bacteria 1293
62 Ga0097620_100120697 3300006931 Bacteria 2688
63 Ga0075435_100007570 3300007076 Bacteria 7754
64 Ga0075435_100844224 3300007076 Unclassified 798
65 Ga0099794_10017970 3300007265 Unclassified 3162
66 Ga0114129_10412294 3300009147 Bacteria 1779
67 Ga0105243_10216210 3300009148 Bacteria 1691
68 Ga0105243_10386442 3300009148 Unclassified 1296
69 Ga0105242_10058603 3300009176 Bacteria 3158
70 Ga0105248_10054105 3300009177 Bacteria 4501
71 Ga0105238_10054017 3300009551 Bacteria 4036
72 Ga0105249_10069764 3300009553 Bacteria 3244
73 Ga0105246_10509760 3300011119 Bacteria 1023
74 Ga0157369_10358282 3300013105 Bacteria 1515
75 Ga0157374_10033471 3300013296 Bacteria 4689
76 Ga0157378_10165051 3300013297 Bacteria 2074
77 Ga0157375_11305498 3300013308 Bacteria 853
78 Ga0163163_10122898 3300014325 Bacteria 2631
79 Ga0213875_10010774 3300021388 Bacteria 4571
80 Ga0209147_100341 3300025229 Bacteria 34416
81 Ga0209673_1002715 3300025273 Bacteria 11690
82 Ga0209676_1000277 3300025292 Bacteria 106682
83 Ga0209025_1000095 3300025294 Bacteria 240057
84 Ga0209025_1000757 3300025294 Bacteria 53988
85 Ga0209025_1002045 3300025294 Bacteria 22979
86 Ga0209025_1003527 3300025294 Bacteria 14683
87 Ga0207655_1013280 3300025728 Bacteria 4741
88 Ga0207684_10000176 3300025910 Bacteria 104968
89 Ga0207693_10006918 3300025915 Bacteria 9367
90 Ga0207663_10241873 3300025916 Unclassified 1324
91 Ga0207660_10246054 3300025917 Bacteria 1410
92 Ga0207662_10554362 3300025918 Bacteria 796
93 Ga0207646_10062126 3300025922 Bacteria 3335
94 Ga0207650_10057544 3300025925 Unclassified 2892
95 Ga0207650_10093094 3300025925 Unclassified 2306
96 Ga0207700_10356936 3300025928 Bacteria 1274
97 Ga0207700_10366172 3300025928 Bacteria 1258
98 Ga0207664_10064177 3300025929 Bacteria 2936
99 Ga0207670_10119791 3300025936 Bacteria 1911
100 Ga0207669_10699734 3300025937 Unclassified 833
101 Ga0207691_10126249 3300025940 Bacteria 2263
102 Ga0207661_10083400 3300025944 Unclassified 2645
103 Ga0207667_11363603 3300025949 Unclassified 684
104 Ga0207674_10039235 3300026116 Bacteria 4910
105 Ga0209588_1007387 3300027671 Bacteria 3229
106 Ga0209974_10037834 3300027876 Unclassified 1602
107 Ga0268265_10026881 3300028380 Bacteria 4099
108 Ga0268264_10086676 3300028381 Bacteria 2691
109 Ga0268264_11208525 3300028381 Unclassified 765
110 Ga0265337_1015247 3300028556 Bacteria 2521
111 Ga0265337_1029167 3300028556 Bacteria 1651
112 Ga0265326_10030364 3300028558 Bacteria 1539
113 Ga0265319_1001014 3300028563 Bacteria 17548
114 Ga0265318_10002409 3300028577 Bacteria 10004
115 Ga0265336_10000157 3300028666 Bacteria 48443
116 Ga0265338_10003304 3300028800 Bacteria 22861
117 Ga0265338_10208063 3300028800 Bacteria 1470
118 Ga0265324_10003105 3300029957 Bacteria 8094
119 Ga0265320_10006976 3300031240 Bacteria 7047
120 Ga0265340_10193693 3300031247 Unclassified 916
121 Ga0265316_10009198 3300031344 Bacteria 9100
122 Ga0265316_10350765 3300031344 Unclassified 1068
123 Ga0307408_100598438 3300031548 Bacteria 979
124 Ga0265313_10000004 3300031595 Bacteria 188027
125 Ga0316575_10092178 3300031665 Bacteria 1228
126 Ga0316579_10200540 3300031691 Unclassified 965
127 Ga0265314_10000460 3300031711 Bacteria 54250
128 Ga0265342_10051526 3300031712 Bacteria 2456
129 Ga0316576_10137052 3300031727 Bacteria 1842
130 Ga0316576_10627230 3300031727 Bacteria 783
131 Ga0316578_10001356 3300031728 Bacteria 9869
132 Ga0316577_10007571 3300031733 Bacteria 5793
133 Ga0316577_10066590 3300031733 Bacteria 2011
134 Ga0316577_10081502 3300031733 Bacteria 1809
135 Ga0316577_10225171 3300031733 Unclassified 1061
136 Ga0307409_100333004 3300031995 Bacteria 1425
137 Ga0307416_100907566 3300032002 Bacteria 981
138 Ga0373931_0469236 3300035691 Bacteria 808
139 Ga0373947_0351141 3300035725 Unclassified 990
140 Ga0316582_0604507 3300036647 Unclassified 755
141 Ga0316582_0713790 3300036647 Bacteria 688
142 Ga0316584_0010904 3300036712 Bacteria 6366
143 Ga0316584_0018611 3300036712 Bacteria 5013
144 Ga0316584_0028359 3300036712 Bacteria 4128
145 Ga0316584_0237521 3300036712 Bacteria 1335
146 Ga0316584_0456174 3300036712 Bacteria 903
147 Ga0373925_0725500 3300037068 Bacteria 819
148 Ga0395899_0412829 3300037312 Bacteria 891
149 Ga0316581_0045626 3300037588 Bacteria 1339
150 Ga0436364_1507937 3300037853 Bacteria 4572
151 Ga0400483_225879 3300039062 Unclassified 1825
152 Ga0400489_80736 3300039093 Unclassified 1064
153 Ga0436362_0633248 3300039453 Bacteria 1960
154 Ga0451577_0040534 3300042876 Bacteria 4181
155 Ga0451577_0043628 3300042876 Unclassified 4017
156 Ga0451577_0108762 3300042876 Bacteria 2478
157 Ga0451577_0158592 3300042876 Unclassified 2037
158 Ga0453683_0043007 3300044673 Bacteria 2836
159 Ga0453683_0289906 3300044673 Bacteria 1046
160 Ga0453684_0010737 3300044712 Bacteria 15559
161 Ga0453684_0021822 3300044712 Bacteria 9537
162 Ga0453684_0082281 3300044712 Bacteria 4011
163 Ga0453684_0120068 3300044712 Bacteria 3176
164 Ga0453684_0295509 3300044712 Bacteria 1843
165 Ga0453684_0424017 3300044712 Bacteria 1485
166 Ga0453684_0840163 3300044712 Unclassified 987
167 Ga0453684_0937594 3300044712 Unclassified 925
168 Ga0453684_1281634 3300044712 Bacteria 765
169 Ga0451576_0034294 3300045051 Bacteria 5391
170 Ga0451576_0079095 3300045051 Bacteria 3421
171 Ga0451576_0104519 3300045051 Unclassified 2946
172 Ga0451576_0136042 3300045051 Bacteria 2562
173 Ga0451576_0139963 3300045051 Unclassified 2524
174 Ga0466967_0555673 3300045976 Bacteria 1130
175 Ga0495603_0027550 3300046455 Bacteria 3428
176 Ga0495585_0013086 3300046492 Bacteria 4865
177 Ga0495636_0112412 3300047318 Bacteria 1199
178 Ga0496101_0039591 3300048904 Bacteria 3353
179 Ga0496102_0405943 3300048905 Bacteria 1280
180 Ga0496103_0004340 3300048906 Bacteria 8609
181 Ga0496104_0008554 3300048907 Bacteria 9099
182 Ga0496108_0004322 3300048911 Bacteria 11421
183 Ga0496110_0079285 3300048913 Bacteria 2923
184 Ga0496111_0005420 3300048914 Bacteria 8175
185 Ga0496112_0007000 3300048915 Bacteria 9956
186 Ga0496113_0241104 3300048916 Bacteria 1442
187 Ga0496115_0006173 3300048918 Bacteria 8763
188 Ga0496116_0006365 3300048919 Bacteria 10739
189 Ga0496118_0237892 3300048921 Bacteria 1045
190 Ga0496120_0134591 3300048923 Bacteria 1262
191 Ga0496122_0093276 3300048925 Bacteria 2042
192 Ga0496125_0002014 3300048928 Bacteria 27546
193 Ga0496125_0023506 3300048928 Bacteria 5687
194 Ga0501034_0408286 3300049571 Bacteria 1280
195 Ga0501036_1119771 3300049572 Bacteria 643
196 Ga0501039_0387123 3300049575 Bacteria 1098
197 Ga0501040_0051179 3300049576 Bacteria 2826
198 Ga0501040_0079503 3300049576 Bacteria 2270
199 Ga0501041_0091316 3300049577 Bacteria 1880
200 Ga0501041_0109901 3300049577 Bacteria 1710
201 Ga0501042_0174837 3300049578 Bacteria 1549
202 Ga0501071_0143871 3300049587 Bacteria 1777
203 Ga0501072_0295257 3300049588 Bacteria 1288
204 Ga0501074_0056934 3300049590 Bacteria 2817
205 Ga0501075_0296273 3300049591 Bacteria 1232
206 Ga0501076_0033599 3300049592 Bacteria 4005
207 Ga0501076_0206364 3300049592 Bacteria 1605
208 Ga0501079_0021442 3300049741 Bacteria 4942
209 Ga0501079_0139475 3300049741 Bacteria 1888
210 Ga0501080_0882560 3300049742 Bacteria 780
211 Ga0501081_0005922 3300049743 Bacteria 7912
212 Ga0501081_0155243 3300049743 Bacteria 1646
213 nmdc:mga05p37_399828_c1 3300050507 Bacteria 1604
214 nmdc:mga09592_17389_c1 3300050508 Bacteria 5891
215 nmdc:mga0qj67_185516_c1 3300050509 Bacteria 1690
216 nmdc:mga06r32_131758_c1 3300050510 Bacteria 2472
217 nmdc:mga06r32_425412_c1 3300050510 Bacteria 1309
218 nmdc:mga0n895_10658_c1 3300050512 Bacteria 8139
219 Ga0495619_0214675 3300053085 Bacteria 1332
220 Ga0500638_000022 3300053162 Bacteria 67797
221 Ga0530510_0327495 3300061734 Bacteria 1149
222 2556065485 2554235469 Bacteria 3590176
223 2644719228 2643221731 Bacteria 5623886
224 2644722365 2643221732 Bacteria 5756404
225 2739269686 2738543017 Bacteria 4271950
226 2808867710 2808606364 Bacteria 4465927
227 2842885167 2842882022 Bacteria 6158489
228 2857589367 2857586860 Bacteria 4354574
229 2904527605 2904524088 Bacteria 5887454
230 2919143750 2919143609 Bacteria 6219228
231 2919520714 2919517244 Bacteria 5858162
232 2919724563 2919720352 Bacteria 5986006
233 2928097403 2928093941 Bacteria 5965005
234 2929004549 2929004312 Bacteria 5678476
235 2960381649 2960375949 Bacteria 5361395
236 8022893727 8022893055 Bacteria 5300455
237 Ga0070698_100227928
238 JGI25151J46595_10008831
239 JGI25151J46595_10091394
240 rootH1_10042465
241 Ga0055528_1020092
242 Ga0070683_100229744
243 Ga0070690_100010917
244 Ga0070670_100056772
245 Ga0070670_100200086
246 Ga0070682_100765058
247 Ga0070689_100146335
248 Ga0070691_10019969
249 Ga0070687_100430983
250 Ga0070692_10030750
251 Ga0070668_101042848
252 Ga0070688_100347341
253 Ga0070667_100880273
254 Ga0070714_100031964
255 Ga0070713_100072211
256 Ga0070701_10076931
257 Ga0070701_10125586
258 Ga0070705_100011925
259 Ga0070705_100049065
260 Ga0070705_100400147
261 Ga0070694_100202887
262 Ga0070694_100470376
263 Ga0070708_100455980
264 Ga0070681_10003549
265 Ga0068867_100081466
266 Ga0070706_100000365
267 Ga0070698_100074202
268 Ga0070698_100457756
269 Ga0070699_100076356
270 Ga0070699_100559166
271 Ga0070684_100771242
272 Ga0070697_100583139
273 Ga0070672_100514824
274 Ga0070695_100043163
275 Ga0070696_100168431
276 Ga0070696_100168999
277 Ga0070696_100459588
278 Ga0070704_100194612
279 Ga0070704_100553565
280 Ga0068855_100679842
281 Ga0068857_100986343
282 Ga0070702_100472986
283 Ga0068859_100120698
284 Ga0068863_100055461
285 Ga0068860_100140075
286 Ga0068862_100214490
287 Ga0070712_100005791
288 Ga0070712_100052596
289 Ga0075428_100120603
290 Ga0075431_100278386
291 Ga0075434_100012560
292 Ga0075434_100137899
293 Ga0075429_100004735
294 Ga0075429_100089870
295 Ga0075429_100161372
296 Ga0075436_100105949
297 Ga0075436_100238397
298 Ga0097620_100120697
299 Ga0075435_100007570
300 Ga0075435_100844224
301 Ga0099794_10017970
302 Ga0114129_10412294
303 Ga0105243_10216210
304 Ga0105243_10386442
305 Ga0105242_10058603
306 Ga0105248_10054105
307 Ga0105238_10054017
308 Ga0105249_10069764
309 Ga0105246_10509760
310 Ga0157369_10358282
311 Ga0157374_10033471
312 Ga0157378_10165051
313 Ga0157375_11305498
314 Ga0163163_10122898
315 Ga0213875_10010774
316 Ga0209147_100341
317 Ga0209673_1002715
318 Ga0209676_1000277
319 Ga0209025_1000095
320 Ga0209025_1000757
321 Ga0209025_1002045
322 Ga0209025_1003527
323 Ga0207655_1013280
324 Ga0207684_10000176
325 Ga0207693_10006918
326 Ga0207663_10241873
327 Ga0207660_10246054
328 Ga0207662_10554362
329 Ga0207646_10062126
330 Ga0207650_10057544
331 Ga0207650_10093094
332 Ga0207700_10356936
333 Ga0207700_10366172
334 Ga0207664_10064177
335 Ga0207670_10119791
336 Ga0207669_10699734
337 Ga0207691_10126249
338 Ga0207661_10083400
339 Ga0207667_11363603
340 Ga0207674_10039235
341 Ga0209588_1007387
342 Ga0209974_10037834
343 Ga0268265_10026881
344 Ga0268264_10086676
345 Ga0268264_11208525
346 Ga0265337_1015247
347 Ga0265337_1029167
348 Ga0265326_10030364
349 Ga0265319_1001014
350 Ga0265318_10002409
351 Ga0265336_10000157
352 Ga0265338_10003304
353 Ga0265338_10208063
354 Ga0265324_10003105
355 Ga0265320_10006976
356 Ga0265340_10193693
357 Ga0265316_10009198
358 Ga0265316_10350765
359 Ga0307408_100598438
360 Ga0265313_10000004
361 Ga0316575_10092178
362 Ga0316579_10200540
363 Ga0265314_10000460
364 Ga0265342_10051526
365 Ga0316576_10137052
366 Ga0316576_10627230
367 Ga0316578_10001356
368 Ga0316577_10007571
369 Ga0316577_10066590
370 Ga0316577_10081502
371 Ga0316577_10225171
372 Ga0307409_100333004
373 Ga0307416_100907566
374 Ga0373931_0469236
375 Ga0373947_0351141
376 Ga0316582_0604507
377 Ga0316582_0713790
378 Ga0316584_0010904
379 Ga0316584_0018611
380 Ga0316584_0028359
381 Ga0316584_0237521
382 Ga0316584_0456174
383 Ga0373925_0725500
384 Ga0395899_0412829
385 Ga0316581_0045626
386 Ga0436364_1507937
387 Ga0400483_225879
388 Ga0400489_80736
389 Ga0436362_0633248
390 Ga0451577_0040534
391 Ga0451577_0043628
392 Ga0451577_0108762
393 Ga0451577_0158592
394 Ga0453683_0043007
395 Ga0453683_0289906
396 Ga0453684_0010737
397 Ga0453684_0021822
398 Ga0453684_0082281
399 Ga0453684_0120068
400 Ga0453684_0295509
401 Ga0453684_0424017
402 Ga0453684_0840163
403 Ga0453684_0937594
404 Ga0453684_1281634
405 Ga0451576_0034294
406 Ga0451576_0079095
407 Ga0451576_0104519
408 Ga0451576_0136042
409 Ga0451576_0139963
410 Ga0466967_0555673
411 Ga0495603_0027550
412 Ga0495585_0013086
413 Ga0495636_0112412
414 Ga0496101_0039591
415 Ga0496102_0405943
416 Ga0496103_0004340
417 Ga0496104_0008554
418 Ga0496108_0004322
419 Ga0496110_0079285
420 Ga0496111_0005420
421 Ga0496112_0007000
422 Ga0496113_0241104
423 Ga0496115_0006173
424 Ga0496116_0006365
425 Ga0496118_0237892
426 Ga0496120_0134591
427 Ga0496122_0093276
428 Ga0496125_0002014
429 Ga0496125_0023506
430 Ga0501034_0408286
431 Ga0501036_1119771
432 Ga0501039_0387123
433 Ga0501040_0051179
434 Ga0501040_0079503
435 Ga0501041_0091316
436 Ga0501041_0109901
437 Ga0501042_0174837
438 Ga0501071_0143871
439 Ga0501072_0295257
440 Ga0501074_0056934
441 Ga0501075_0296273
442 Ga0501076_0033599
443 Ga0501076_0206364
444 Ga0501079_0021442
445 Ga0501079_0139475
446 Ga0501080_0882560
447 Ga0501081_0005922
448 Ga0501081_0155243
449 nmdc:mga05p37_399828_c1
450 nmdc:mga09592_17389_c1
451 nmdc:mga0qj67_185516_c1
452 nmdc:mga06r32_131758_c1
453 nmdc:mga06r32_425412_c1
454 nmdc:mga0n895_10658_c1
455 Ga0495619_0214675
456 Ga0500638_000022
457 Ga0530510_0327495
458 2556065485
459 2644719228
460 2644722365
461 2739269686
462 2808867710
463 2842885167
464 2857589367
465 2904527605
466 2919143750
467 2919520714
468 2919724563
469 2928097403
470 2929004549
471 2960381649
472 8022893727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

50

238

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.6744 2 194
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.6357 2 194
8evu-assembly1.cif.gz_E cryo em structure of vibrio cholerae nqr 0.4763 2 195
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.4642 5 205
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.4553 5 205
ID Description Score Start End Superfamily
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5523 40 199 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5508 4 202 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5421 6 201 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5285 40 199 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5219 6 201 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A239NVM7-F1-model_v4 deleted 0.9812 1 204
AF-A0A0F5YE51-F1-model_v4 Lysine transporter LysE 0.9762 1 205 GO:0005886
GO:0015171
AF-A0A1G0UMV2-F1-model_v4 Lysine transporter LysE 0.9739 1 203 GO:0005886
GO:0015171
AF-A0A239NVM7-F1-model_v4 deleted 0.9718 1 204
AF-A0A0Q9YFP2-F1-model_v4 Leucine export protein LeuE 0.9702 1 201 GO:0005886
GO:0015171

Map