F348633

General Info

Members Datasets Scaffolds Average Seq Length
235 167 211 179

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2873314349|2873317227
Length 201
Sequence EIGLRARHEDDIPILQTELHDDVVTSSRAAGRPWRPITPGSKESPFAVDDKERRDVAFSVVKLDGGTLVGVATLWGIDDHNRSAHIGLGLLPSARGKGYGTDVVAVLCHYGFVVRGLWRLQAETLSDNVAMLRSAERNGFVREGVLRSSAWVMGEFLDLVLLGLLVQDWKPDPGRHRTGEGRVPEPAPAAEGRDGSPRQGL

Samples

Sample ID Description Type Environment
1 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
2 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
3 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
4 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
5 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
6 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
7 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
8 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
9 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
10 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
11 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
12 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
13 2867369537 Streptomyces sp. Z26 Isolate Unclassified
14 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
15 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
16 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
17 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
18 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
19 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
20 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
21 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
22 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
27 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
28 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
29 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
39 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
53 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
56 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
57 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
58 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
62 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
63 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
68 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
91 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
92 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
93 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
94 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
100 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
104 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
109 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
110 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
130 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
131 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
132 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
137 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
140 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
155 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
156 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
164 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
165 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
166 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
167 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.36
Metatranscriptomes 0.43
Isolates 10.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.36
Nodule 0
Rhizoplane 0.43
Rhizosphere 80.43
Stem 0
Stem Tuber 0
Unclassified 9.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10015699 3300001990 Bacteria 2449
2 JGI24738J21930_10021853 3300002075 Bacteria 1326
3 rootL2_10029718 3300003322 Bacteria 3210
4 JGI25160J50197_1000387 3300003354 Bacteria 28549
5 JGI25160J50197_1003759 3300003354 Bacteria 6686
6 JGI25160J50197_1023859 3300003354 Bacteria 1751
7 Ga0055539_1000005 3300003752 Bacteria 609598
8 Ga0055533_1000001 3300003756 Bacteria 1863437
9 Ga0055525_1000150 3300003759 Bacteria 94263
10 Ga0070667_100059939 3300005367 Bacteria 3221
11 Ga0068854_100328754 3300005578 Bacteria 1245
12 Ga0075365_10395601 3300006038 Bacteria 975
13 Ga0075363_100020638 3300006048 Bacteria 3307
14 Ga0075363_100285868 3300006048 Bacteria 955
15 Ga0105239_11336528 3300010375 Bacteria 827
16 Ga0105246_11065896 3300011119 Bacteria 736
17 Ga0157369_10623939 3300013105 Bacteria 1112
18 Ga0157372_10605621 3300013307 Bacteria 1277
19 Ga0183367_1006 3300015688 Bacteria 648044
20 Ga0206356_10851068 3300020070 Bacteria 932
21 Ga0209566_100053 3300025225 Bacteria 224436
22 Ga0209674_100001 3300025226 Bacteria 4013750
23 Ga0209563_100001 3300025230 Bacteria 4013775
24 Ga0209677_100001 3300025253 Bacteria 4013787
25 Ga0209673_1075946 3300025273 Bacteria 784
26 Ga0207426_1000593 3300025302 Bacteria 47865
27 Ga0207426_1002532 3300025302 Bacteria 11471
28 Ga0207426_1017467 3300025302 Bacteria 2550
29 Ga0207647_10026932 3300025904 Bacteria 3753
30 Ga0207658_10122843 3300025986 Bacteria 2073
31 Ga0207702_10268828 3300026078 Bacteria 1607
32 Ga0209371_1011411 3300027312 Bacteria 2641
33 Ga0307515_10272738 3300028794 Bacteria 1410
34 Ga0265338_10204188 3300028800 Bacteria 1488
35 Ga0268256_1012378 3300030500 Bacteria 2641
36 Ga0265325_10120178 3300031241 Bacteria 1267
37 Ga0265316_10367889 3300031344 Bacteria 1039
38 Ga0307513_10000003 3300031456 Bacteria 590921
39 Ga0307509_10032184 3300031507 Bacteria 5781
40 Ga0307516_10022269 3300031730 Bacteria 6510
41 Ga0307518_10201942 3300031838 Bacteria 1319
42 Ga0307518_10468178 3300031838 Bacteria 665
43 Ga0307412_10432051 3300031911 Bacteria 1080
44 Ga0307412_11113185 3300031911 Bacteria 703
45 Ga0307416_102548013 3300032002 Bacteria 610
46 Ga0307507_10134801 3300033179 Bacteria 1917
47 Ga0307507_10352161 3300033179 Bacteria 865
48 Ga0307510_10075137 3300033180 Bacteria 3333
49 Ga0373948_0093644 3300034817 Bacteria 700
50 Ga0395900_0134969 3300037418 Bacteria 2528
51 Ga0395898_0132425 3300037466 Bacteria 2387
52 Ga0395901_0016494 3300038443 Bacteria 7527
53 Ga0439442_006610 3300042002 Bacteria 2328
54 Ga0439449_0001346 3300042007 Bacteria 9626
55 Ga0439449_0038964 3300042007 Bacteria 1766
56 Ga0466969_0007628 3300044656 Bacteria 5750
57 Ga0466972_0002493 3300044658 Bacteria 9103
58 Ga0466972_0025246 3300044658 Bacteria 2946
59 Ga0466972_0043140 3300044658 Bacteria 2191
60 Ga0466965_0067495 3300044683 Bacteria 1795
61 Ga0466965_0260270 3300044683 Bacteria 932
62 Ga0466966_0031634 3300044684 Bacteria 3431
63 Ga0466966_0056371 3300044684 Bacteria 2486
64 Ga0466966_0208464 3300044684 Bacteria 1181
65 Ga0466961_0015731 3300044693 Bacteria 4855
66 Ga0466961_0540950 3300044693 Bacteria 702
67 Ga0466964_0450787 3300044706 Bacteria 682
68 Ga0466971_0068282 3300044719 Bacteria 1612
69 Ga0466968_0020477 3300044735 Bacteria 2671
70 Ga0466968_0026590 3300044735 Bacteria 2376
71 Ga0466968_0363751 3300044735 Bacteria 704
72 Ga0466970_0010961 3300044765 Bacteria 4610
73 Ga0466970_0068941 3300044765 Bacteria 1900
74 Ga0466970_0153414 3300044765 Bacteria 1272
75 Ga0466957_0318418 3300044842 Bacteria 1049
76 Ga0466960_0105507 3300044901 Bacteria 1457
77 Ga0466960_0356493 3300044901 Bacteria 835
78 Ga0466960_0417442 3300044901 Bacteria 775
79 Ga0466959_0023932 3300045049 Bacteria 4521
80 Ga0466959_0046167 3300045049 Bacteria 3206
81 Ga0466967_0042909 3300045976 Bacteria 3913
82 Ga0495617_018798 3300046452 Bacteria 2337
83 Ga0495592_0038455 3300046454 Bacteria 3601
84 Ga0495592_0207406 3300046454 Bacteria 1318
85 Ga0495592_0372501 3300046454 Bacteria 911
86 Ga0495603_0187689 3300046455 Bacteria 1195
87 Ga0495590_0070893 3300046457 Bacteria 1223
88 Ga0495629_0010801 3300046459 Bacteria 6643
89 Ga0495629_0092835 3300046459 Bacteria 2106
90 Ga0495629_0168519 3300046459 Bacteria 1520
91 Ga0495641_0198013 3300046461 Bacteria 900
92 Ga0495651_0009153 3300046462 Bacteria 7600
93 Ga0495651_0450863 3300046462 Bacteria 831
94 Ga0495651_0644907 3300046462 Bacteria 664
95 Ga0495580_0555077 3300046472 Bacteria 762
96 Ga0495582_0465308 3300046473 Bacteria 730
97 Ga0495605_0082051 3300046474 Bacteria 1507
98 Ga0495662_0020765 3300046476 Bacteria 3177
99 Ga0495662_0064862 3300046476 Bacteria 1765
100 Ga0495585_0167309 3300046492 Bacteria 1137
101 Ga0495596_0052821 3300046500 Bacteria 1591
102 Ga0495607_0229882 3300046501 Bacteria 902
103 Ga0495606_0001273 3300046507 Bacteria 34937
104 Ga0495608_0227300 3300046511 Bacteria 1169
105 Ga0495608_0547582 3300046511 Bacteria 697
106 Ga0495610_0143450 3300046512 Bacteria 1025
107 Ga0495618_0067113 3300046514 Bacteria 2281
108 Ga0495618_0221846 3300046514 Bacteria 1192
109 Ga0495620_0000936 3300046515 Bacteria 17971
110 Ga0495628_0034322 3300046516 Bacteria 4081
111 Ga0495630_0463465 3300046517 Bacteria 971
112 Ga0495643_0004680 3300046522 Bacteria 9505
113 Ga0495648_0045536 3300046524 Bacteria 2728
114 Ga0495652_0001404 3300046529 Bacteria 26758
115 Ga0495640_0051989 3300046533 Bacteria 2814
116 Ga0495587_0030183 3300046536 Bacteria 3288
117 Ga0495609_0090799 3300046538 Bacteria 1328
118 Ga0495597_0096165 3300046542 Bacteria 1252
119 Ga0495633_0045805 3300046558 Bacteria 2070
120 Ga0495667_0356137 3300046559 Bacteria 924
121 Ga0495634_0004067 3300046642 Bacteria 11582
122 Ga0495634_0027672 3300046642 Bacteria 3944
123 Ga0495635_0060166 3300046663 Bacteria 2611
124 Ga0495661_0052360 3300046665 Bacteria 2460
125 Ga0495588_0399802 3300046674 Bacteria 721
126 Ga0495657_0006795 3300046675 Bacteria 8911
127 Ga0495657_0010762 3300046675 Bacteria 6872
128 Ga0495646_0183050 3300046680 Bacteria 1149
129 Ga0495658_0385975 3300046683 Bacteria 892
130 Ga0495613_0006696 3300046689 Bacteria 8604
131 Ga0495613_0028982 3300046689 Bacteria 4116
132 Ga0495613_0038272 3300046689 Bacteria 3554
133 Ga0495613_0105323 3300046689 Bacteria 2036
134 Ga0495624_0074292 3300046690 Bacteria 2112
135 Ga0495649_0004377 3300046694 Bacteria 9241
136 Ga0495589_0425458 3300046794 Bacteria 608
137 Ga0495600_0003358 3300046809 Bacteria 9411
138 Ga0495600_0009446 3300046809 Bacteria 6026
139 Ga0495600_0155510 3300046809 Bacteria 1479
140 Ga0495600_0225270 3300046809 Bacteria 1198
141 Ga0495660_0114180 3300046810 Bacteria 1374
142 Ga0495581_0251120 3300047315 Bacteria 1034
143 Ga0495604_0002677 3300047317 Bacteria 14303
144 Ga0495604_0032349 3300047317 Bacteria 4147
145 Ga0495604_0032869 3300047317 Bacteria 4109
146 Ga0495604_0336261 3300047317 Bacteria 1006
147 Ga0495674_0189929 3300047319 Bacteria 1708
148 Ga0495674_0391284 3300047319 Bacteria 1123
149 Ga0495680_0053195 3300047322 Bacteria 3152
150 Ga0495683_0289444 3300047323 Bacteria 706
151 Ga0495687_003312 3300047443 Bacteria 11815
152 Ga0495687_008023 3300047443 Bacteria 6105
153 Ga0495685_039940 3300047447 Bacteria 1605
154 Ga0495681_0046332 3300047470 Bacteria 2074
155 Ga0495686_0089241 3300047472 Bacteria 1873
156 Ga0495593_0022338 3300047673 Bacteria 3526
157 Ga0495593_0199279 3300047673 Bacteria 1006
158 Ga0495602_0387180 3300048088 Bacteria 1000
159 Ga0495614_0022472 3300048089 Bacteria 2722
160 Ga0495626_0031156 3300048091 Bacteria 2568
161 Ga0496104_0271942 3300048907 Bacteria 1607
162 Ga0495678_050103 3300049459 Bacteria 1620
163 Ga0495682_0075078 3300049460 Bacteria 1216
164 Ga0501031_0228981 3300049568 Bacteria 1210
165 Ga0501031_0869002 3300049568 Bacteria 577
166 Ga0501032_0085714 3300049569 Bacteria 2094
167 Ga0501032_0105527 3300049569 Bacteria 1866
168 Ga0501032_0241849 3300049569 Bacteria 1172
169 Ga0501034_0010851 3300049571 Bacteria 9464
170 Ga0501034_0011089 3300049571 Bacteria 9359
171 Ga0501034_0056380 3300049571 Bacteria 3954
172 Ga0501034_0230781 3300049571 Bacteria 1800
173 Ga0501036_0025064 3300049572 Bacteria 5030
174 Ga0501036_0050488 3300049572 Bacteria 3522
175 Ga0501037_0245570 3300049573 Bacteria 1254
176 Ga0501038_0000819 3300049574 Bacteria 27660
177 Ga0501038_0116190 3300049574 Bacteria 2211
178 Ga0501038_0375806 3300049574 Bacteria 1103
179 Ga0501039_0727673 3300049575 Bacteria 775
180 Ga0501043_0022716 3300049579 Bacteria 4919
181 Ga0501043_0026238 3300049579 Bacteria 4571
182 Ga0501043_0608774 3300049579 Bacteria 806
183 Ga0501046_0321395 3300049580 Bacteria 1128
184 Ga0501047_0035790 3300049581 Bacteria 4797
185 Ga0501047_0048708 3300049581 Bacteria 4092
186 Ga0501047_0234215 3300049581 Bacteria 1688
187 Ga0501047_0404667 3300049581 Bacteria 1197
188 Ga0501069_0478966 3300049585 Bacteria 741
189 Ga0501070_0123124 3300049586 Bacteria 2143
190 Ga0501070_0214113 3300049586 Bacteria 1581
191 Ga0501070_0355304 3300049586 Bacteria 1189
192 Ga0501073_0475639 3300049589 Bacteria 864
193 Ga0501217_099455 3300049661 Bacteria 825
194 Ga0501223_020382 3300049663 Bacteria 1300
195 Ga0501257_098205 3300049686 Bacteria 767
196 Ga0501080_0042150 3300049742 Bacteria 4252
197 Ga0501080_1067835 3300049742 Bacteria 698
198 Ga0501279_017985 3300049775 Bacteria 992
199 Ga0501035_0015944 3300049822 Bacteria 6934
200 Ga0501035_0024594 3300049822 Bacteria 5522
201 Ga0501035_0058991 3300049822 Bacteria 3418
202 Ga0501035_0221222 3300049822 Bacteria 1616
203 Ga0501044_0013772 3300049823 Bacteria 8739
204 Ga0501044_0105121 3300049823 Bacteria 2836
205 Ga0501044_0130753 3300049823 Bacteria 2504
206 Ga0501044_0375561 3300049823 Bacteria 1337
207 nmdc:mga03n38_13393_c1 3300050490 Bacteria 3114
208 nmdc:mga0yw44_98325_c1 3300050492 Bacteria 1860
209 Ga0500578_0313411 3300053086 Bacteria 927
210 Ga0500614_137511 3300053123 Bacteria 729
211 Ga0500573_0082840 3300053140 Bacteria 1821

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300033179 Ga0307507_10134801 Ga0307507_101348011 171
2 3300046459 Ga0495629_0168519 Ga0495629_0168519_897_1451 171
3 3300046476 Ga0495662_0020765 Ga0495662_0020765_2190_2744 171
4 3300046536 Ga0495587_0030183 Ga0495587_0030183_387_941 171
5 3300046642 Ga0495634_0004067 Ga0495634_0004067_6236_6790 171
6 3300046680 Ga0495646_0183050 Ga0495646_0183050_380_934 171
7 3300046683 Ga0495658_0385975 Ga0495658_0385975_267_821 171
8 3300046689 Ga0495613_0006696 Ga0495613_0006696_4359_4913 171
9 3300046809 Ga0495600_0225270 Ga0495600_0225270_163_717 171
10 3300047317 Ga0495604_0002677 Ga0495604_0002677_5265_5819 171
11 3300047319 Ga0495674_0189929 Ga0495674_0189929_250_804 171
12 3300053123 Ga0500614_137511 Ga0500614_137511_149_703 171
13 3300046454 Ga0495592_0038455 Ga0495592_0038455_2866_3420 172
14 3300046459 Ga0495629_0092835 Ga0495629_0092835_483_1037 172
15 3300046462 Ga0495651_0644907 Ga0495651_0644907_61_615 172
16 3300046514 Ga0495618_0067113 Ga0495618_0067113_671_1225 172
17 3300046517 Ga0495630_0463465 Ga0495630_0463465_389_943 172
18 3300046663 Ga0495635_0060166 Ga0495635_0060166_787_1341 172
19 3300046809 Ga0495600_0003358 Ga0495600_0003358_6152_6706 172
20 3300047673 Ga0495593_0199279 Ga0495593_0199279_188_742 172
21 3300048088 Ga0495602_0387180 Ga0495602_0387180_353_907 172
22 iso_pu_bacteria 2862290372 2862291609 174
23 3300046455 Ga0495603_0187689 Ga0495603_0187689_446_997 175
24 3300048089 Ga0495614_0022472 Ga0495614_0022472_1488_2039 175
25 iso_pu_bacteria 2873314349 2873317227 175
26 iso_pu_bacteria 2912757875 2912758668 175
27 3300044842 Ga0466957_0318418 Ga0466957_0318418_156_686 176
28 iso_pu_bacteria 2616644814 2616699424 176
29 iso_pu_bacteria 2643221587 2643948183 176
30 iso_pu_bacteria 2643221677 2644429656 176
31 iso_pu_bacteria 2643221678 2644438669 176
32 iso_pu_bacteria 2643221682 2644459010 176
33 iso_pu_bacteria 2784746768 2785366849 176
34 iso_pu_bacteria 2808606359 2808848798 176
35 iso_pu_bacteria 2811994917 2812483362 176
36 iso_pu_bacteria 2861520306 2861524521 176
37 iso_pu_bacteria 2862281513 2862287717 176
38 iso_pu_bacteria 2867346516 2867351708 176
39 iso_pu_bacteria 2867369537 2867375053 176
40 iso_pu_bacteria 2875391855 2875393913 176
41 iso_pu_bacteria 2877676314 2877683703 176
42 iso_pu_bacteria 2895427314 2895430260 176
43 iso_pu_bacteria 2918501144 2918505550 176
44 iso_pu_bacteria 2919468124 2919471423 176
45 iso_pu_bacteria 2935409751 2935410317 176
46 iso_pu_bacteria 3002998708 3003008507 176
47 iso_pu_bacteria 8001781756 8001783508 176
48 iso_pu_bacteria 8056207758 8056209918 176
49 3300044693 Ga0466961_0540950 Ga0466961_0540950_121_654 177
50 3300049571 Ga0501034_0056380 Ga0501034_0056380_327_860 177
51 3300046462 Ga0495651_0009153 Ga0495651_0009153_5304_5840 178
52 3300046516 Ga0495628_0034322 Ga0495628_0034322_491_1027 178
53 3300046529 Ga0495652_0001404 Ga0495652_0001404_14408_14944 178
54 3300046809 Ga0495600_0009446 Ga0495600_0009446_228_764 178
55 3300047317 Ga0495604_0032349 Ga0495604_0032349_3144_3680 178
56 3300048907 Ga0496104_0271942 Ga0496104_0271942_483_1019 178
57 3300049568 Ga0501031_0869002 Ga0501031_0869002_13_549 178
58 3300049569 Ga0501032_0241849 Ga0501032_0241849_229_765 178
59 3300049571 Ga0501034_0230781 Ga0501034_0230781_598_1134 178
60 3300049572 Ga0501036_0050488 Ga0501036_0050488_2835_3371 178
61 3300049573 Ga0501037_0245570 Ga0501037_0245570_243_779 178
62 3300049574 Ga0501038_0375806 Ga0501038_0375806_395_931 178
63 3300049575 Ga0501039_0727673 Ga0501039_0727673_164_700 178
64 3300049579 Ga0501043_0026238 Ga0501043_0026238_428_964 178
65 3300049579 Ga0501043_0608774 Ga0501043_0608774_69_605 178
66 3300049581 Ga0501047_0048708 Ga0501047_0048708_1796_2332 178
67 3300049581 Ga0501047_0404667 Ga0501047_0404667_513_1049 178
68 3300049586 Ga0501070_0123124 Ga0501070_0123124_743_1279 178
69 3300049742 Ga0501080_0042150 Ga0501080_0042150_1587_2123 178
70 3300049742 Ga0501080_1067835 Ga0501080_1067835_65_601 178
71 3300049822 Ga0501035_0024594 Ga0501035_0024594_2170_2706 178
72 3300049822 Ga0501035_0058991 Ga0501035_0058991_2872_3408 178
73 3300049823 Ga0501044_0013772 Ga0501044_0013772_3440_3976 178
74 3300049823 Ga0501044_0105121 Ga0501044_0105121_773_1309 178
75 3300006048 Ga0075363_100020638 Ga0075363_1000206385 179
76 3300010375 Ga0105239_11336528 Ga0105239_113365282 179
77 3300013307 Ga0157372_10605621 Ga0157372_106056211 179
78 3300028794 Ga0307515_10272738 Ga0307515_102727382 179
79 3300044658 Ga0466972_0043140 Ga0466972_0043140_286_825 179
80 3300044684 Ga0466966_0056371 Ga0466966_0056371_1421_1960 179
81 3300044735 Ga0466968_0026590 Ga0466968_0026590_986_1525 179
82 3300044765 Ga0466970_0010961 Ga0466970_0010961_1839_2378 179
83 3300045049 Ga0466959_0023932 Ga0466959_0023932_2888_3427 179
84 3300046452 Ga0495617_018798 Ga0495617_018798_1760_2299 179
85 3300046457 Ga0495590_0070893 Ga0495590_0070893_423_962 179
86 3300046459 Ga0495629_0010801 Ga0495629_0010801_163_702 179
87 3300046461 Ga0495641_0198013 Ga0495641_0198013_231_770 179
88 3300046473 Ga0495582_0465308 Ga0495582_0465308_35_574 179
89 3300046501 Ga0495607_0229882 Ga0495607_0229882_282_821 179
90 3300046507 Ga0495606_0001273 Ga0495606_0001273_5689_6228 179
91 3300046515 Ga0495620_0000936 Ga0495620_0000936_14476_15015 179
92 3300046642 Ga0495634_0027672 Ga0495634_0027672_2098_2637 179
93 3300046694 Ga0495649_0004377 Ga0495649_0004377_5446_5985 179
94 3300046810 Ga0495660_0114180 Ga0495660_0114180_794_1333 179
95 3300047470 Ga0495681_0046332 Ga0495681_0046332_1078_1617 179
96 3300047472 Ga0495686_0089241 Ga0495686_0089241_961_1500 179
97 3300049568 Ga0501031_0228981 Ga0501031_0228981_308_847 179
98 3300049569 Ga0501032_0105527 Ga0501032_0105527_75_614 179
99 3300049571 Ga0501034_0011089 Ga0501034_0011089_8730_9269 179
100 3300049572 Ga0501036_0025064 Ga0501036_0025064_119_658 179
101 3300049574 Ga0501038_0116190 Ga0501038_0116190_1209_1748 179
102 3300049579 Ga0501043_0022716 Ga0501043_0022716_11_550 179
103 3300049581 Ga0501047_0234215 Ga0501047_0234215_23_562 179
104 3300049586 Ga0501070_0355304 Ga0501070_0355304_579_1118 179
105 3300049822 Ga0501035_0221222 Ga0501035_0221222_1052_1591 179
106 3300049823 Ga0501044_0130753 Ga0501044_0130753_219_758 179
107 3300050490 nmdc:mga03n38_13393_c1 nmdc:mga03n38_13393_c1_1640_2179 179
108 3300001990 JGI24737J22298_10015699 JGI24737J22298_100156992 180
109 3300002075 JGI24738J21930_10021853 JGI24738J21930_100218532 180
110 3300003322 rootL2_10029718 rootL2_100297182 180
111 3300003354 JGI25160J50197_1000387 JGI25160J50197_100038728 180
112 3300003354 JGI25160J50197_1003759 JGI25160J50197_10037595 180
113 3300003354 JGI25160J50197_1023859 JGI25160J50197_10238592 180
114 3300003752 Ga0055539_1000005 Ga0055539_1000005371 180
115 3300003756 Ga0055533_1000001 Ga0055533_10000011440 180
116 3300003759 Ga0055525_1000150 Ga0055525_100015051 180
117 3300005367 Ga0070667_100059939 Ga0070667_1000599394 180
118 3300005578 Ga0068854_100328754 Ga0068854_1003287541 180
119 3300006038 Ga0075365_10395601 Ga0075365_103956012 180
120 3300006048 Ga0075363_100285868 Ga0075363_1002858682 180
121 3300011119 Ga0105246_11065896 Ga0105246_110658961 180
122 3300013105 Ga0157369_10623939 Ga0157369_106239392 180
123 3300015688 Ga0183367_1006 Ga0183367_100664 180
124 3300020070 Ga0206356_10851068 Ga0206356_108510681 180
125 3300025225 Ga0209566_100053 Ga0209566_10005326 180
126 3300025226 Ga0209674_100001 Ga0209674_1000011440 180
127 3300025230 Ga0209563_100001 Ga0209563_1000011440 180
128 3300025253 Ga0209677_100001 Ga0209677_1000011440 180
129 3300025273 Ga0209673_1075946 Ga0209673_10759461 180
130 3300025302 Ga0207426_1000593 Ga0207426_100059311 180
131 3300025302 Ga0207426_1002532 Ga0207426_10025325 180
132 3300025302 Ga0207426_1017467 Ga0207426_10174672 180
133 3300025904 Ga0207647_10026932 Ga0207647_100269323 180
134 3300025986 Ga0207658_10122843 Ga0207658_101228434 180
135 3300026078 Ga0207702_10268828 Ga0207702_102688282 180
136 3300027312 Ga0209371_1011411 Ga0209371_10114113 180
137 3300028800 Ga0265338_10204188 Ga0265338_102041882 180
138 3300030500 Ga0268256_1012378 Ga0268256_10123783 180
139 3300031241 Ga0265325_10120178 Ga0265325_101201782 180
140 3300031344 Ga0265316_10367889 Ga0265316_103678891 180
141 3300031456 Ga0307513_10000003 Ga0307513_10000003246 180
142 3300031507 Ga0307509_10032184 Ga0307509_100321843 180
143 3300031730 Ga0307516_10022269 Ga0307516_100222691 180
144 3300031838 Ga0307518_10201942 Ga0307518_102019423 180
145 3300031838 Ga0307518_10468178 Ga0307518_104681781 180
146 3300031911 Ga0307412_10432051 Ga0307412_104320512 180
147 3300031911 Ga0307412_11113185 Ga0307412_111131851 180
148 3300032002 Ga0307416_102548013 Ga0307416_1025480131 180
149 3300033179 Ga0307507_10352161 Ga0307507_103521611 180
150 3300033180 Ga0307510_10075137 Ga0307510_100751372 180
151 3300034817 Ga0373948_0093644 Ga0373948_0093644_93_635 180
152 3300037418 Ga0395900_0134969 Ga0395900_0134969_789_1331 180
153 3300037466 Ga0395898_0132425 Ga0395898_0132425_1726_2268 180
154 3300038443 Ga0395901_0016494 Ga0395901_0016494_2729_3271 180
155 3300042002 Ga0439442_006610 Ga0439442_006610_1004_1546 180
156 3300042007 Ga0439449_0001346 Ga0439449_0001346_2810_3352 180
157 3300042007 Ga0439449_0038964 Ga0439449_0038964_666_1208 180
158 3300044656 Ga0466969_0007628 Ga0466969_0007628_68_613 180
159 3300044658 Ga0466972_0002493 Ga0466972_0002493_5997_6551 180
160 3300044658 Ga0466972_0025246 Ga0466972_0025246_1476_2018 180
161 3300044683 Ga0466965_0067495 Ga0466965_0067495_1194_1748 180
162 3300044683 Ga0466965_0260270 Ga0466965_0260270_214_756 180
163 3300044684 Ga0466966_0031634 Ga0466966_0031634_1254_1808 180
164 3300044684 Ga0466966_0208464 Ga0466966_0208464_595_1137 180
165 3300044693 Ga0466961_0015731 Ga0466961_0015731_2365_2919 180
166 3300044706 Ga0466964_0450787 Ga0466964_0450787_11_553 180
167 3300044719 Ga0466971_0068282 Ga0466971_0068282_582_1136 180
168 3300044735 Ga0466968_0020477 Ga0466968_0020477_198_752 180
169 3300044735 Ga0466968_0363751 Ga0466968_0363751_142_684 180
170 3300044765 Ga0466970_0068941 Ga0466970_0068941_829_1371 180
171 3300044765 Ga0466970_0153414 Ga0466970_0153414_650_1195 180
172 3300044901 Ga0466960_0105507 Ga0466960_0105507_480_1022 180
173 3300044901 Ga0466960_0356493 Ga0466960_0356493_111_653 180
174 3300044901 Ga0466960_0417442 Ga0466960_0417442_14_556 180
175 3300045049 Ga0466959_0046167 Ga0466959_0046167_1677_2231 180
176 3300045976 Ga0466967_0042909 Ga0466967_0042909_2166_2708 180
177 3300046454 Ga0495592_0207406 Ga0495592_0207406_454_996 180
178 3300046454 Ga0495592_0372501 Ga0495592_0372501_46_588 180
179 3300046462 Ga0495651_0450863 Ga0495651_0450863_169_711 180
180 3300046472 Ga0495580_0555077 Ga0495580_0555077_65_607 180
181 3300046474 Ga0495605_0082051 Ga0495605_0082051_17_559 180
182 3300046476 Ga0495662_0064862 Ga0495662_0064862_983_1525 180
183 3300046492 Ga0495585_0167309 Ga0495585_0167309_554_1096 180
184 3300046500 Ga0495596_0052821 Ga0495596_0052821_450_992 180
185 3300046511 Ga0495608_0227300 Ga0495608_0227300_527_1069 180
186 3300046511 Ga0495608_0547582 Ga0495608_0547582_93_635 180
187 3300046512 Ga0495610_0143450 Ga0495610_0143450_51_593 180
188 3300046514 Ga0495618_0221846 Ga0495618_0221846_493_1035 180
189 3300046522 Ga0495643_0004680 Ga0495643_0004680_6509_7051 180
190 3300046524 Ga0495648_0045536 Ga0495648_0045536_825_1367 180
191 3300046533 Ga0495640_0051989 Ga0495640_0051989_2098_2640 180
192 3300046538 Ga0495609_0090799 Ga0495609_0090799_727_1269 180
193 3300046542 Ga0495597_0096165 Ga0495597_0096165_606_1148 180
194 3300046558 Ga0495633_0045805 Ga0495633_0045805_517_1059 180
195 3300046559 Ga0495667_0356137 Ga0495667_0356137_50_592 180
196 3300046665 Ga0495661_0052360 Ga0495661_0052360_380_922 180
197 3300046674 Ga0495588_0399802 Ga0495588_0399802_21_563 180
198 3300046675 Ga0495657_0006795 Ga0495657_0006795_2093_2635 180
199 3300046675 Ga0495657_0010762 Ga0495657_0010762_119_661 180
200 3300046689 Ga0495613_0028982 Ga0495613_0028982_107_649 180
201 3300046689 Ga0495613_0038272 Ga0495613_0038272_229_771 180
202 3300046689 Ga0495613_0105323 Ga0495613_0105323_412_954 180
203 3300046690 Ga0495624_0074292 Ga0495624_0074292_523_1065 180
204 3300046794 Ga0495589_0425458 Ga0495589_0425458_46_588 180
205 3300046809 Ga0495600_0155510 Ga0495600_0155510_83_625 180
206 3300047315 Ga0495581_0251120 Ga0495581_0251120_175_717 180
207 3300047317 Ga0495604_0032869 Ga0495604_0032869_3022_3564 180
208 3300047317 Ga0495604_0336261 Ga0495604_0336261_193_735 180
209 3300047319 Ga0495674_0391284 Ga0495674_0391284_13_555 180
210 3300047322 Ga0495680_0053195 Ga0495680_0053195_93_635 180
211 3300047323 Ga0495683_0289444 Ga0495683_0289444_123_665 180
212 3300047443 Ga0495687_003312 Ga0495687_003312_10717_11259 180
213 3300047443 Ga0495687_008023 Ga0495687_008023_5133_5675 180
214 3300047447 Ga0495685_039940 Ga0495685_039940_321_863 180
215 3300047673 Ga0495593_0022338 Ga0495593_0022338_681_1223 180
216 3300048091 Ga0495626_0031156 Ga0495626_0031156_1839_2381 180
217 3300049459 Ga0495678_050103 Ga0495678_050103_380_922 180
218 3300049460 Ga0495682_0075078 Ga0495682_0075078_160_702 180
219 3300049569 Ga0501032_0085714 Ga0501032_0085714_1415_1957 180
220 3300049571 Ga0501034_0010851 Ga0501034_0010851_6300_6842 180
221 3300049574 Ga0501038_0000819 Ga0501038_0000819_18780_19322 180
222 3300049580 Ga0501046_0321395 Ga0501046_0321395_207_749 180
223 3300049581 Ga0501047_0035790 Ga0501047_0035790_2808_3350 180
224 3300049585 Ga0501069_0478966 Ga0501069_0478966_40_582 180
225 3300049586 Ga0501070_0214113 Ga0501070_0214113_817_1359 180
226 3300049589 Ga0501073_0475639 Ga0501073_0475639_181_723 180
227 3300049661 Ga0501217_099455 Ga0501217_099455_114_659 180
228 3300049663 Ga0501223_020382 Ga0501223_020382_343_888 180
229 3300049686 Ga0501257_098205 Ga0501257_098205_186_731 180
230 3300049775 Ga0501279_017985 Ga0501279_017985_20_565 180
231 3300049822 Ga0501035_0015944 Ga0501035_0015944_5801_6343 180
232 3300049823 Ga0501044_0375561 Ga0501044_0375561_392_934 180
233 3300050492 nmdc:mga0yw44_98325_c1 nmdc:mga0yw44_98325_c1_271_813 180
234 3300053086 Ga0500578_0313411 Ga0500578_0313411_339_881 180
235 3300053140 Ga0500573_0082840 Ga0500573_0082840_708_1250 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

1

141

0.86

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

27

140

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v8h-assembly2.cif.gz_C crystal structure of thymidylate synthase from burkholderia thailandensis 0.9017 124 171
3v8h-assembly1.cif.gz_D crystal structure of thymidylate synthase from burkholderia thailandensis 0.9013 124 171
3fbu-assembly2.cif.gz_B-2 the crystal structure of the acetyltransferase (gnat family) from bacillus anthracis 0.9011 62 170
3v8h-assembly1.cif.gz_A crystal structure of thymidylate synthase from burkholderia thailandensis 0.9001 124 171
3v8h-assembly2.cif.gz_B crystal structure of thymidylate synthase from burkholderia thailandensis 0.9001 124 171
ID Description Score Start End Superfamily
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9266 123 173 3.40.630.30
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9042 103 173 3.40.630.30
3v8hC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9017 124 171 3.30.572.10
3fbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9011 62 170 3.40.630.30
4xplA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8948 56 171 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A447U3F5-F1-model_v4 Spermidine N1-acetyltransferase (EC 2.3.1.57) 0.9633 54 172 GO:0004145
AF-A0A7U9NKQ5-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9606 58 177 GO:0016747
AF-A0A1Q7F3W7-F1-model_v4 N-acetyltransferase domain-containing protein 0.9576 58 175 GO:0016747
AF-Q9V1M6-F1-model_v4 Acetyl transferase 0.9552 57 170 GO:0016747
AF-A0A3D5NRA5-F1-model_v4 GNAT family N-acetyltransferase 0.9552 87 173 GO:0016747

Feature Viewer

pLDDT pTM Quality
82.89 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map