F348605

General Info

Members Datasets Scaffolds Average Seq Length
235 130 470 245

Family's Representative Sequence

Representative Sequence 3300061719|Ga0466962_0148283|Ga0466962_0148283_68_940
Length 290
Sequence MRGLSPDARNVSSRPAGRPAHCVATHSIRRVTSARGRTVTADRPELSLVADTHLLDLPDTLRLLRDGELCVEGRLFDASNATLYCTVSLDGVTASCVHKPVAGERPLWDFPDGTLAYREVSAYLVSTAMDWDIVPPTVLRDGPWGIGMCQLWIDVDETVDLAALARSDHPQLRRMAVFDAVVNNADRKGGHLLPTPDGHVYGVDHGVCFSVDDKLRTLLWRWRGKRLTEEAIDVLSGLRAQLEGELGDALSGLLHYDEVAATKRRVDRLLSTRRHPMPSDDWPPVPWPPF

Samples

Sample ID Description Type Environment
1 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
61 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
62 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
63 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
64 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
99 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
102 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
119 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
120 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
121 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
123 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
124 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
125 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
126 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
127 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
128 2891562705 Microbispora tritici MT50 Isolate Unclassified
129 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
130 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.89
Metatranscriptomes 1.7
Isolates 3.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.26
Rhizosphere 92.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466962_0148283 3300061719 Bacteria 1138
2 Ga0070658_10000233 3300005327 Bacteria 49543
3 Ga0070658_10001229 3300005327 Bacteria 21956
4 Ga0070658_10005820 3300005327 Bacteria 9988
5 Ga0070658_10128085 3300005327 Bacteria 2114
6 Ga0070658_10152082 3300005327 Bacteria 1938
7 Ga0070658_10270502 3300005327 Bacteria 1445
8 Ga0070683_100081331 3300005329 Bacteria 3033
9 Ga0070690_100125745 3300005330 Bacteria 1726
10 Ga0070680_100000613 3300005336 Bacteria 24707
11 Ga0070680_100001295 3300005336 Bacteria 18097
12 Ga0070680_100099584 3300005336 Bacteria 2412
13 Ga0070682_100382468 3300005337 Bacteria 1059
14 Ga0070682_100455571 3300005337 Bacteria 981
15 Ga0068868_100023023 3300005338 Bacteria 4711
16 Ga0070660_100112320 3300005339 Bacteria 2169
17 Ga0070660_100133496 3300005339 Bacteria 1988
18 Ga0070660_100147239 3300005339 Bacteria 1892
19 Ga0070661_100385720 3300005344 Bacteria 1105
20 Ga0070692_10008728 3300005345 Bacteria 4533
21 Ga0070659_100001125 3300005366 Bacteria 19506
22 Ga0070659_100054353 3300005366 Bacteria 3154
23 Ga0070714_100596045 3300005435 Bacteria 1061
24 Ga0070713_100241038 3300005436 Bacteria 1646
25 Ga0070708_100051778 3300005445 Bacteria 3638
26 Ga0070681_10000165 3300005458 Bacteria 50320
27 Ga0070681_10008743 3300005458 Bacteria 9934
28 Ga0070681_10013662 3300005458 Bacteria 8081
29 Ga0070681_10089622 3300005458 Bacteria 3027
30 Ga0070706_100014226 3300005467 Bacteria 7352
31 Ga0070707_100147854 3300005468 Bacteria 2287
32 Ga0070698_100000003 3300005471 Bacteria 137957
33 Ga0070699_100015551 3300005518 Bacteria 6540
34 Ga0070699_100083352 3300005518 Bacteria 2789
35 Ga0070679_100000350 3300005530 Bacteria 39216
36 Ga0070679_100001987 3300005530 Bacteria 18362
37 Ga0070679_100008546 3300005530 Bacteria 9645
38 Ga0070679_100019399 3300005530 Bacteria 6611
39 Ga0070679_100024909 3300005530 Bacteria 5866
40 Ga0070679_100108563 3300005530 Bacteria 2761
41 Ga0070679_100897194 3300005530 Bacteria 830
42 Ga0070684_100070828 3300005535 Bacteria 3069
43 Ga0070684_100110223 3300005535 Bacteria 2468
44 Ga0068855_100003142 3300005563 Bacteria 20199
45 Ga0068855_100039266 3300005563 Bacteria 5619
46 Ga0068855_100104094 3300005563 Bacteria 3265
47 Ga0068855_100308246 3300005563 Bacteria 1752
48 Ga0068856_100052219 3300005614 Bacteria 4031
49 Ga0068852_100296681 3300005616 Bacteria 1563
50 Ga0070716_100004651 3300006173 Bacteria 6577
51 Ga0070712_100562618 3300006175 Bacteria 962
52 Ga0075428_100157361 3300006844 Bacteria 2467
53 Ga0075436_100006270 3300006914 Bacteria 8147
54 Ga0105240_10041229 3300009093 Bacteria 5895
55 Ga0105240_10527841 3300009093 Bacteria 1309
56 Ga0111539_10034235 3300009094 Bacteria 6162
57 Ga0105245_10243873 3300009098 Bacteria 1743
58 Ga0114129_10052736 3300009147 Bacteria 5708
59 Ga0114129_10062218 3300009147 Bacteria 5215
60 Ga0105237_10061954 3300009545 Bacteria 3739
61 Ga0157373_10541883 3300013100 Bacteria 843
62 Ga0157371_10040044 3300013102 Bacteria 3349
63 Ga0157370_10006234 3300013104 Bacteria 13210
64 Ga0157370_10028961 3300013104 Bacteria 5441
65 Ga0157369_10009696 3300013105 Bacteria 11011
66 Ga0157369_10039774 3300013105 Bacteria 5138
67 Ga0157369_10072142 3300013105 Bacteria 3706
68 Ga0157369_10209438 3300013105 Bacteria 2044
69 Ga0157369_10360643 3300013105 Bacteria 1509
70 Ga0157369_10640738 3300013105 Bacteria 1096
71 Ga0157372_10045199 3300013307 Bacteria 4884
72 Ga0157372_10152977 3300013307 Bacteria 2663
73 Ga0157372_10739350 3300013307 Bacteria 1144
74 Ga0206353_10617287 3300020082 Bacteria 6420
75 Ga0206353_10893769 3300020082 Bacteria 1219
76 Ga0206353_11289999 3300020082 Bacteria 905
77 Ga0213876_10008917 3300021384 Bacteria 5410
78 Ga0224712_10017663 3300022467 Bacteria 2370
79 Ga0207705_10001247 3300025909 Bacteria 20442
80 Ga0207705_10002141 3300025909 Bacteria 15316
81 Ga0207705_10012428 3300025909 Bacteria 6150
82 Ga0207705_10153929 3300025909 Bacteria 1724
83 Ga0207705_10168863 3300025909 Bacteria 1646
84 Ga0207705_10168869 3300025909 Bacteria 1646
85 Ga0207705_10170499 3300025909 Bacteria 1638
86 Ga0207705_10187777 3300025909 Bacteria 1562
87 Ga0207705_10265672 3300025909 Bacteria 1311
88 Ga0207707_10000324 3300025912 Bacteria 50333
89 Ga0207707_10001604 3300025912 Bacteria 20867
90 Ga0207707_10040974 3300025912 Bacteria 4044
91 Ga0207695_10393282 3300025913 Bacteria 1271
92 Ga0207695_10689691 3300025913 Bacteria 902
93 Ga0207693_10090530 3300025915 Bacteria 2398
94 Ga0207660_10000735 3300025917 Bacteria 21790
95 Ga0207660_10001598 3300025917 Bacteria 15200
96 Ga0207660_10045439 3300025917 Bacteria 3094
97 Ga0207657_10048789 3300025919 Bacteria 3695
98 Ga0207657_10109309 3300025919 Bacteria 2285
99 Ga0207657_10182330 3300025919 Bacteria 1697
100 Ga0207657_10195400 3300025919 Bacteria 1630
101 Ga0207657_10212207 3300025919 Bacteria 1553
102 Ga0207652_10000308 3300025921 Bacteria 50308
103 Ga0207652_10012834 3300025921 Bacteria 6775
104 Ga0207652_10026220 3300025921 Bacteria 4852
105 Ga0207652_10085463 3300025921 Bacteria 2765
106 Ga0207652_10145699 3300025921 Bacteria 2119
107 Ga0207652_10253404 3300025921 Bacteria 1587
108 Ga0207652_10381524 3300025921 Bacteria 1272
109 Ga0207646_10125227 3300025922 Bacteria 2310
110 Ga0207646_10204112 3300025922 Bacteria 1785
111 Ga0207690_10000089 3300025932 Bacteria 75740
112 Ga0207690_10052031 3300025932 Bacteria 2742
113 Ga0207665_10005392 3300025939 Bacteria 8539
114 Ga0207665_10018459 3300025939 Bacteria 4583
115 Ga0207689_10101658 3300025942 Bacteria 2361
116 Ga0207661_10059273 3300025944 Bacteria 3084
117 Ga0207667_10076516 3300025949 Bacteria 3473
118 Ga0207667_10093167 3300025949 Bacteria 3111
119 Ga0207667_10692068 3300025949 Bacteria 1022
120 Ga0207677_10015735 3300026023 Bacteria 4461
121 Ga0207702_10537222 3300026078 Bacteria 1142
122 Ga0207698_10072759 3300026142 Bacteria 2734
123 Ga0265334_10102349 3300028573 Bacteria 1036
124 Ga0265338_10256561 3300028800 Bacteria 1287
125 Ga0265330_10073191 3300031235 Bacteria 1482
126 Ga0265320_10048229 3300031240 Bacteria 2080
127 Ga0265325_10015336 3300031241 Bacteria 4310
128 Ga0265340_10002258 3300031247 Bacteria 11014
129 Ga0265340_10003076 3300031247 Bacteria 9474
130 Ga0265339_10024072 3300031249 Bacteria 3513
131 Ga0265339_10153572 3300031249 Bacteria 1162
132 Ga0265316_10121670 3300031344 Bacteria 1971
133 Ga0265316_10156549 3300031344 Bacteria 1705
134 Ga0307408_100134888 3300031548 Bacteria 1930
135 Ga0265314_10054115 3300031711 Bacteria 2779
136 Ga0265342_10059869 3300031712 Bacteria 2248
137 Ga0307413_10402206 3300031824 Bacteria 1073
138 Ga0307410_10003952 3300031852 Bacteria 7553
139 Ga0307410_10067228 3300031852 Bacteria 2472
140 Ga0307406_10046418 3300031901 Bacteria 2733
141 Ga0307406_10255209 3300031901 Bacteria 1323
142 Ga0307406_10313421 3300031901 Bacteria 1210
143 Ga0307407_10002110 3300031903 Bacteria 7631
144 Ga0307407_10091708 3300031903 Bacteria 1864
145 Ga0307407_10166351 3300031903 Bacteria 1448
146 Ga0307412_10356884 3300031911 Bacteria 1176
147 Ga0307409_100157486 3300031995 Bacteria 1981
148 Ga0307409_100313001 3300031995 Bacteria 1466
149 Ga0307416_100061328 3300032002 Bacteria 3068
150 Ga0307416_100282493 3300032002 Bacteria 1638
151 Ga0307416_100519507 3300032002 Bacteria 1259
152 Ga0307414_10074143 3300032004 Bacteria 2464
153 Ga0307415_100046679 3300032126 Bacteria 2911
154 Ga0307415_100106287 3300032126 Bacteria 2072
155 Ga0307415_100203439 3300032126 Bacteria 1573
156 Ga0307415_100242566 3300032126 Bacteria 1458
157 Ga0307415_100551158 3300032126 Bacteria 1017
158 Ga0373946_0317547 3300035171 Bacteria 773
159 Ga0373935_0057101 3300035692 Bacteria 2490
160 Ga0395899_0257372 3300037312 Bacteria 1195
161 Ga0395900_0214186 3300037418 Bacteria 1944
162 Ga0395898_0030598 3300037466 Bacteria 5386
163 Ga0395901_0004614 3300038443 Bacteria 13905
164 Ga0395901_0023504 3300038443 Bacteria 6321
165 Ga0395901_0042123 3300038443 Bacteria 4733
166 Ga0436365_0034810 3300039437 Bacteria 7400
167 Ga0451795_0263141 3300041456 Bacteria 793
168 Ga0466969_0125557 3300044656 Bacteria 1192
169 Ga0466966_0083493 3300044684 Bacteria 1987
170 Ga0466966_0147797 3300044684 Bacteria 1434
171 Ga0466961_0013525 3300044693 Bacteria 5226
172 Ga0466961_0041034 3300044693 Bacteria 2966
173 Ga0466961_0090281 3300044693 Bacteria 1935
174 Ga0466961_0284875 3300044693 Bacteria 1011
175 Ga0466963_0047426 3300044694 Bacteria 2835
176 Ga0466963_0213109 3300044694 Bacteria 1352
177 Ga0466971_0049227 3300044719 Bacteria 1896
178 Ga0466970_0112272 3300044765 Bacteria 1489
179 Ga0466957_0216831 3300044842 Bacteria 1262
180 Ga0466960_0024434 3300044901 Bacteria 2726
181 Ga0466958_0031763 3300045836 Bacteria 3138
182 Ga0466958_0089769 3300045836 Bacteria 1900
183 Ga0466958_0160697 3300045836 Bacteria 1419
184 Ga0466967_0025595 3300045976 Bacteria 4869
185 Ga0466967_0026306 3300045976 Bacteria 4817
186 Ga0466967_0152553 3300045976 Bacteria 2161
187 Ga0466967_0206465 3300045976 Bacteria 1862
188 Ga0466967_0297095 3300045976 Bacteria 1553
189 Ga0466967_0413495 3300045976 Bacteria 1314
190 Ga0466967_0482003 3300045976 Bacteria 1215
191 Ga0466967_0796679 3300045976 Bacteria 938
192 Ga0466967_0822438 3300045976 Bacteria 923
193 Ga0495620_0155590 3300046515 Bacteria 890
194 Ga0495630_0181487 3300046517 Bacteria 1605
195 Ga0495631_0083812 3300046518 Bacteria 1374
196 Ga0495621_0078043 3300046539 Bacteria 1231
197 Ga0495674_0016649 3300047319 Bacteria 6860
198 Ga0495680_0098922 3300047322 Bacteria 2176
199 Ga0496100_0381608 3300048903 Bacteria 1070
200 Ga0496105_0180301 3300048908 Bacteria 1730
201 Ga0496108_0447932 3300048911 Bacteria 1128
202 Ga0496109_0173108 3300048912 Bacteria 2026
203 Ga0496111_0028712 3300048914 Bacteria 3943
204 Ga0496112_0055139 3300048915 Bacteria 3907
205 Ga0496112_0059270 3300048915 Bacteria 3772
206 Ga0496112_0329069 3300048915 Bacteria 1472
207 Ga0496113_0208300 3300048916 Bacteria 1556
208 Ga0501046_0041341 3300049580 Bacteria 3680
209 Ga0501069_0036671 3300049585 Bacteria 2705
210 Ga0501070_0001124 3300049586 Bacteria 24014
211 Ga0501070_0002709 3300049586 Bacteria 15474
212 Ga0501070_0017899 3300049586 Bacteria 5950
213 Ga0501070_0576655 3300049586 Bacteria 899
214 Ga0501074_0002068 3300049590 Bacteria 13868
215 Ga0501075_0514193 3300049591 Bacteria 914
216 Ga0501076_0055039 3300049592 Bacteria 3155
217 Ga0501079_0024418 3300049741 Bacteria 4637
218 Ga0501080_0017793 3300049742 Bacteria 6578
219 Ga0501080_0027339 3300049742 Bacteria 5304
220 Ga0501080_0035225 3300049742 Bacteria 4672
221 Ga0501044_0024999 3300049823 Bacteria 6333
222 nmdc:mga05p37_95308_c1 3300050507 Bacteria 3666
223 nmdc:mga08x19_6393_c1 3300050514 Bacteria 6973
224 Ga0495601_0032268 3300053077 Bacteria 3259
225 Ga0495619_0003127 3300053085 Bacteria 10736
226 Ga0501084_0512849 3300054114 Bacteria 1013
227 Ga0466962_0301004 3300061719 Bacteria 793
228 2623498850 2622736605 Bacteria 4992138
229 2856743883 2856741275 Bacteria 8096094
230 2873319507 2873314349 Bacteria 8512634
231 2891400559 2891395885 Bacteria 9251614
232 2891562252 2891554331 Bacteria 8812224
233 2891569830 2891562705 Bacteria 8039471
234 8055069998 8055066027 Bacteria 9479577
235 8055174637 8055172936 Bacteria 9305943
236 Ga0466962_0148283
237 Ga0070658_10000233
238 Ga0070658_10001229
239 Ga0070658_10005820
240 Ga0070658_10128085
241 Ga0070658_10152082
242 Ga0070658_10270502
243 Ga0070683_100081331
244 Ga0070690_100125745
245 Ga0070680_100000613
246 Ga0070680_100001295
247 Ga0070680_100099584
248 Ga0070682_100382468
249 Ga0070682_100455571
250 Ga0068868_100023023
251 Ga0070660_100112320
252 Ga0070660_100133496
253 Ga0070660_100147239
254 Ga0070661_100385720
255 Ga0070692_10008728
256 Ga0070659_100001125
257 Ga0070659_100054353
258 Ga0070714_100596045
259 Ga0070713_100241038
260 Ga0070708_100051778
261 Ga0070681_10000165
262 Ga0070681_10008743
263 Ga0070681_10013662
264 Ga0070681_10089622
265 Ga0070706_100014226
266 Ga0070707_100147854
267 Ga0070698_100000003
268 Ga0070699_100015551
269 Ga0070699_100083352
270 Ga0070679_100000350
271 Ga0070679_100001987
272 Ga0070679_100008546
273 Ga0070679_100019399
274 Ga0070679_100024909
275 Ga0070679_100108563
276 Ga0070679_100897194
277 Ga0070684_100070828
278 Ga0070684_100110223
279 Ga0068855_100003142
280 Ga0068855_100039266
281 Ga0068855_100104094
282 Ga0068855_100308246
283 Ga0068856_100052219
284 Ga0068852_100296681
285 Ga0070716_100004651
286 Ga0070712_100562618
287 Ga0075428_100157361
288 Ga0075436_100006270
289 Ga0105240_10041229
290 Ga0105240_10527841
291 Ga0111539_10034235
292 Ga0105245_10243873
293 Ga0114129_10052736
294 Ga0114129_10062218
295 Ga0105237_10061954
296 Ga0157373_10541883
297 Ga0157371_10040044
298 Ga0157370_10006234
299 Ga0157370_10028961
300 Ga0157369_10009696
301 Ga0157369_10039774
302 Ga0157369_10072142
303 Ga0157369_10209438
304 Ga0157369_10360643
305 Ga0157369_10640738
306 Ga0157372_10045199
307 Ga0157372_10152977
308 Ga0157372_10739350
309 Ga0206353_10617287
310 Ga0206353_10893769
311 Ga0206353_11289999
312 Ga0213876_10008917
313 Ga0224712_10017663
314 Ga0207705_10001247
315 Ga0207705_10002141
316 Ga0207705_10012428
317 Ga0207705_10153929
318 Ga0207705_10168863
319 Ga0207705_10168869
320 Ga0207705_10170499
321 Ga0207705_10187777
322 Ga0207705_10265672
323 Ga0207707_10000324
324 Ga0207707_10001604
325 Ga0207707_10040974
326 Ga0207695_10393282
327 Ga0207695_10689691
328 Ga0207693_10090530
329 Ga0207660_10000735
330 Ga0207660_10001598
331 Ga0207660_10045439
332 Ga0207657_10048789
333 Ga0207657_10109309
334 Ga0207657_10182330
335 Ga0207657_10195400
336 Ga0207657_10212207
337 Ga0207652_10000308
338 Ga0207652_10012834
339 Ga0207652_10026220
340 Ga0207652_10085463
341 Ga0207652_10145699
342 Ga0207652_10253404
343 Ga0207652_10381524
344 Ga0207646_10125227
345 Ga0207646_10204112
346 Ga0207690_10000089
347 Ga0207690_10052031
348 Ga0207665_10005392
349 Ga0207665_10018459
350 Ga0207689_10101658
351 Ga0207661_10059273
352 Ga0207667_10076516
353 Ga0207667_10093167
354 Ga0207667_10692068
355 Ga0207677_10015735
356 Ga0207702_10537222
357 Ga0207698_10072759
358 Ga0265334_10102349
359 Ga0265338_10256561
360 Ga0265330_10073191
361 Ga0265320_10048229
362 Ga0265325_10015336
363 Ga0265340_10002258
364 Ga0265340_10003076
365 Ga0265339_10024072
366 Ga0265339_10153572
367 Ga0265316_10121670
368 Ga0265316_10156549
369 Ga0307408_100134888
370 Ga0265314_10054115
371 Ga0265342_10059869
372 Ga0307413_10402206
373 Ga0307410_10003952
374 Ga0307410_10067228
375 Ga0307406_10046418
376 Ga0307406_10255209
377 Ga0307406_10313421
378 Ga0307407_10002110
379 Ga0307407_10091708
380 Ga0307407_10166351
381 Ga0307412_10356884
382 Ga0307409_100157486
383 Ga0307409_100313001
384 Ga0307416_100061328
385 Ga0307416_100282493
386 Ga0307416_100519507
387 Ga0307414_10074143
388 Ga0307415_100046679
389 Ga0307415_100106287
390 Ga0307415_100203439
391 Ga0307415_100242566
392 Ga0307415_100551158
393 Ga0373946_0317547
394 Ga0373935_0057101
395 Ga0395899_0257372
396 Ga0395900_0214186
397 Ga0395898_0030598
398 Ga0395901_0004614
399 Ga0395901_0023504
400 Ga0395901_0042123
401 Ga0436365_0034810
402 Ga0451795_0263141
403 Ga0466969_0125557
404 Ga0466966_0083493
405 Ga0466966_0147797
406 Ga0466961_0013525
407 Ga0466961_0041034
408 Ga0466961_0090281
409 Ga0466961_0284875
410 Ga0466963_0047426
411 Ga0466963_0213109
412 Ga0466971_0049227
413 Ga0466970_0112272
414 Ga0466957_0216831
415 Ga0466960_0024434
416 Ga0466958_0031763
417 Ga0466958_0089769
418 Ga0466958_0160697
419 Ga0466967_0025595
420 Ga0466967_0026306
421 Ga0466967_0152553
422 Ga0466967_0206465
423 Ga0466967_0297095
424 Ga0466967_0413495
425 Ga0466967_0482003
426 Ga0466967_0796679
427 Ga0466967_0822438
428 Ga0495620_0155590
429 Ga0495630_0181487
430 Ga0495631_0083812
431 Ga0495621_0078043
432 Ga0495674_0016649
433 Ga0495680_0098922
434 Ga0496100_0381608
435 Ga0496105_0180301
436 Ga0496108_0447932
437 Ga0496109_0173108
438 Ga0496111_0028712
439 Ga0496112_0055139
440 Ga0496112_0059270
441 Ga0496112_0329069
442 Ga0496113_0208300
443 Ga0501046_0041341
444 Ga0501069_0036671
445 Ga0501070_0001124
446 Ga0501070_0002709
447 Ga0501070_0017899
448 Ga0501070_0576655
449 Ga0501074_0002068
450 Ga0501075_0514193
451 Ga0501076_0055039
452 Ga0501079_0024418
453 Ga0501080_0017793
454 Ga0501080_0027339
455 Ga0501080_0035225
456 Ga0501044_0024999
457 nmdc:mga05p37_95308_c1
458 nmdc:mga08x19_6393_c1
459 Ga0495601_0032268
460 Ga0495619_0003127
461 Ga0501084_0512849
462 Ga0466962_0301004
463 2623498850
464 2856743883
465 2873319507
466 2891400559
467 2891562252
468 2891569830
469 8055069998
470 8055174637

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l33-assembly1.cif.gz_A crystal structure of a de novo designed protein with curved beta-sheet 0.7614 20 55
2qcj-assembly2.cif.gz_B native structure of lyp 0.7419 24 50
4pla-assembly1.cif.gz_A crystal structure of phosphatidyl inositol 4-kinase ii alpha in complex with atp 0.7005 57 232
4wtv-assembly1.cif.gz_A crystal structure of the phosphatidylinositol 4-kinase iibeta 0.6817 64 231
4wtv-assembly2.cif.gz_B crystal structure of the phosphatidylinositol 4-kinase iibeta 0.6758 69 231
ID Description Score Start End Superfamily
af_O06242_7_252_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9357 24 234 3.10.450.50
af_O06242_7_252_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8052 24 234 3.10.450.50
af_B1Q276_79_231_1.20.58.830 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7863 186 227 1.20.58.830
af_K7V932_138_349_1.10.1070.11 Mainly Alpha;Orthogonal Bundle;Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5;Phosphatidylinositol 3-/4-kinase, catalytic domain 0.7309 69 230 1.10.1070.11
af_Q6ZBQ6_207_412_1.10.1070.11 Mainly Alpha;Orthogonal Bundle;Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5;Phosphatidylinositol 3-/4-kinase, catalytic domain 0.7197 67 228 1.10.1070.11
ID Description Score Start End GO Terms
AF-A0A6I3FUL7-F1-model_v4 Phosphatidylinositol kinase 0.9784 13 196 GO:0016301
AF-A0A838SJB0-F1-model_v4 SCO1664 family protein 0.9759 10 245
AF-A0A3C0XJI9-F1-model_v4 SCO1664 family protein 0.9738 8 245
AF-A0A7J9X261-F1-model_v4 SCO1664 family protein 0.9737 17 245
AF-A0A4R5B7L5-F1-model_v4 Phosphatidylinositol kinase 0.9723 11 245 GO:0016301

Map