F348471

General Info

Members Datasets Scaffolds Average Seq Length
235 189 226 194

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0066838|Ga0495668_0066838_1240_1872
Length 210
Sequence LLLQQPEVRPEDVSMTTAPVPTGTIDPAWPEDAVEIGRILDAWGVKGWLRVQPFASDPQALFSSRRWFVKPPEPQGIKLPATAAAAFPPFLKVVQVKEHGDGVVAQVADVADRTGAEALRGARLFVSRASFPTAEKDEYYWVDLIGMTVVNREGQTLGTVAGLIDTGPHSVLRLAAPTPAEERLIPFVGAYVDDVSMAERRITVDWGLDY

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
8 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
9 2643221660 Methylibium sp. Root1272 Isolate Unclassified
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
16 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
56 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
57 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
80 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
84 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
94 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
105 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
106 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
107 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
108 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
109 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
110 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
113 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
114 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
117 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
118 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
119 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
120 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
121 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
122 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
123 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
124 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
125 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
157 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
158 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
162 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
163 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
164 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
167 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
175 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
176 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
177 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
178 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
179 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
180 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
181 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
182 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
183 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
184 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
185 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
186 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
188 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
189 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.62
Metatranscriptomes 2.55
Isolates 3.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.51
Nodule 0.85
Rhizoplane 7.23
Rhizosphere 49.79
Stem 0
Stem Tuber 0
Unclassified 13.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004956 3300001979 Bacteria 5661
2 JGI25152J39213_1001665 3300002773 Bacteria 9215
3 JGI25153J46596_10001565 3300003215 Bacteria 13563
4 JGI25153J46596_10002943 3300003215 Bacteria 9637
5 rootH2_10172112 3300003320 Bacteria 1088
6 rootH2_10223802 3300003320 Bacteria 1178
7 rootL2_10201648 3300003322 Bacteria 1484
8 JGI26128J50194_1000995 3300003347 Bacteria 1739
9 Ga0007409J51694_1058441 3300003575 Bacteria 1135
10 Ga0055524_1000510 3300003775 Bacteria 29983
11 Ga0055530_10001567 3300003791 Bacteria 16380
12 Ga0055530_10007731 3300003791 Bacteria 4464
13 Ga0055540_1000080 3300003792 Bacteria 111063
14 Ga0055531_10003485 3300003794 Bacteria 10008
15 Ga0065165_1003633 3300005262 Bacteria 10560
16 Ga0070675_100110975 3300005354 Bacteria 2320
17 Ga0070671_100006769 3300005355 Bacteria 9168
18 Ga0070659_100000319 3300005366 Bacteria 37297
19 Ga0070678_100034651 3300005456 Bacteria 3518
20 Ga0070662_100006305 3300005457 Bacteria 7644
21 Ga0068867_100000800 3300005459 Bacteria 21219
22 Ga0068867_100914737 3300005459 Bacteria 790
23 Ga0070706_100060312 3300005467 Bacteria 3502
24 Ga0068853_100226458 3300005539 Bacteria 1709
25 Ga0070665_100372412 3300005548 Bacteria 1435
26 Ga0070664_100147020 3300005564 Bacteria 2079
27 Ga0068852_100268051 3300005616 Bacteria 1642
28 Ga0068864_100780773 3300005618 Bacteria 938
29 Ga0068861_100371819 3300005719 Bacteria 1260
30 Ga0068863_100323497 3300005841 Bacteria 1498
31 Ga0068860_100282241 3300005843 Bacteria 1623
32 Ga0075365_10208187 3300006038 Bacteria 1371
33 Ga0075363_100075353 3300006048 Bacteria 1838
34 Ga0075364_10197179 3300006051 Bacteria 1364
35 Ga0075362_10063724 3300006177 Bacteria 1672
36 Ga0075362_10119466 3300006177 Bacteria 1247
37 Ga0075367_10024237 3300006178 Bacteria 3422
38 Ga0075366_10135628 3300006195 Bacteria 1486
39 Ga0075366_10165983 3300006195 Bacteria 1339
40 Ga0075370_10000538 3300006353 Bacteria 14505
41 Ga0075370_10004004 3300006353 Bacteria 7081
42 Ga0075430_100163799 3300006846 Bacteria 1851
43 Ga0075429_100002229 3300006880 Bacteria 16208
44 Ga0079104_1000267 3300006946 Bacteria 68733
45 Ga0075435_100364400 3300007076 Bacteria 1240
46 Ga0105248_10003694 3300009177 Bacteria 16961
47 Ga0105237_10001352 3300009545 Bacteria 32488
48 Ga0105239_10003766 3300010375 Bacteria 18446
49 Ga0157374_10106817 3300013296 Bacteria 2689
50 Ga0157378_10401000 3300013297 Bacteria 1351
51 Ga0157378_10413293 3300013297 Bacteria 1332
52 Ga0157380_10361432 3300014326 Bacteria 1362
53 Ga0213872_10000082 3300021361 Bacteria 88238
54 Ga0207425_1005144 3300025245 Bacteria 3778
55 Ga0209129_1000027 3300025258 Bacteria 409587
56 Ga0209565_1015028 3300025263 Bacteria 1758
57 Ga0209673_1004671 3300025273 Bacteria 7229
58 Ga0209673_1008939 3300025273 Bacteria 4401
59 Ga0209675_1004921 3300025291 Bacteria 5766
60 Ga0209564_1000014 3300025295 Bacteria 621501
61 Ga0209758_1000281 3300025297 Bacteria 100826
62 Ga0209758_1000310 3300025297 Bacteria 94307
63 Ga0209050_1000198 3300025298 Bacteria 134820
64 Ga0209050_1000739 3300025298 Bacteria 47380
65 Ga0209050_1028827 3300025298 Bacteria 1792
66 Ga0209256_1000203 3300025299 Bacteria 112500
67 Ga0209256_1041110 3300025299 Bacteria 1176
68 Ga0209051_1000035 3300025303 Bacteria 346999
69 Ga0209051_1013755 3300025303 Bacteria 3825
70 Ga0209257_1000346 3300025304 Bacteria 95662
71 Ga0207684_10132195 3300025910 Bacteria 2142
72 Ga0207671_10009654 3300025914 Bacteria 8043
73 Ga0207659_10150666 3300025926 Bacteria 1816
74 Ga0207644_10093298 3300025931 Bacteria 2247
75 Ga0207690_10001201 3300025932 Bacteria 16353
76 Ga0207706_10004342 3300025933 Bacteria 13312
77 Ga0207711_10032668 3300025941 Bacteria 4400
78 Ga0207679_10000056 3300025945 Bacteria 108254
79 Ga0207679_10090229 3300025945 Bacteria 2368
80 Ga0207639_10175369 3300026041 Bacteria 1819
81 Ga0207648_10984129 3300026089 Bacteria 790
82 Ga0207676_10161003 3300026095 Bacteria 1944
83 Ga0207683_10053290 3300026121 Bacteria 3546
84 Ga0207698_10258269 3300026142 Bacteria 1599
85 Ga0207698_10383405 3300026142 Bacteria 1338
86 Ga0209281_1000076 3300027111 Bacteria 263350
87 Ga0209996_1001480 3300027395 Bacteria 2842
88 Ga0209968_1000512 3300027526 Bacteria 6097
89 Ga0209966_1000382 3300027695 Bacteria 13432
90 Ga0209813_10101877 3300027866 Bacteria 978
91 Ga0209974_10000874 3300027876 Bacteria 10431
92 Ga0268266_10293158 3300028379 Bacteria 1516
93 Ga0268264_10188851 3300028381 Bacteria 1877
94 Ga0307517_10165710 3300028786 Bacteria 1469
95 Ga0307515_10001727 3300028794 Bacteria 48647
96 Ga0307515_10002873 3300028794 Bacteria 36628
97 Ga0307515_10030061 3300028794 Bacteria 9147
98 Ga0307515_10355230 3300028794 Bacteria 1110
99 Ga0307512_10073755 3300030522 Bacteria 2511
100 Ga0307513_10171817 3300031456 Bacteria 2044
101 Ga0307513_10415125 3300031456 Bacteria 1077
102 Ga0307509_10103893 3300031507 Bacteria 2868
103 Ga0307408_100440695 3300031548 Bacteria 1128
104 Ga0307408_100652864 3300031548 Bacteria 941
105 Ga0307508_10000007 3300031616 Bacteria 268359
106 Ga0307514_10025723 3300031649 Bacteria 4762
107 Ga0307516_10014861 3300031730 Bacteria 8218
108 Ga0307516_10291974 3300031730 Bacteria 1309
109 Ga0307410_10640350 3300031852 Bacteria 891
110 Ga0307406_10653622 3300031901 Bacteria 873
111 Ga0307416_100381355 3300032002 Bacteria 1440
112 Ga0307411_10312623 3300032005 Bacteria 1265
113 Ga0307411_10974214 3300032005 Bacteria 758
114 Ga0307415_100563346 3300032126 Bacteria 1008
115 Ga0395900_0000025 3300037418 Bacteria 321217
116 Ga0395905_0047645 3300037471 Bacteria 4015
117 Ga0436361_0848343 3300039447 Bacteria 176869
118 Ga0451789_0961199 3300041443 Bacteria 3212
119 Ga0451793_0636093 3300041452 Bacteria 1027
120 Ga0451797_0058272 3300041453 Bacteria 860
121 Ga0451795_1651988 3300041456 Bacteria 1289
122 Ga0451798_0030369 3300041458 Bacteria 1271
123 Ga0451798_0076574 3300041458 Bacteria 1571
124 Ga0451800_1203546 3300041459 Bacteria 1027
125 Ga0451804_0653625 3300041463 Bacteria 851
126 Ga0451807_2294657 3300041486 Bacteria 1108
127 Ga0451835_0920265 3300041492 Bacteria 867
128 Ga0451849_1194449 3300041505 Bacteria 1922
129 Ga0451843_1548019 3300041509 Bacteria 732
130 Ga0451853_0351485 3300041512 Bacteria 1881
131 Ga0451853_3167327 3300041512 Bacteria 2483
132 Ga0451853_3382570 3300041512 Bacteria 2664
133 Ga0439431_0002967 3300041997 Bacteria 3725
134 Ga0439448_0020090 3300042005 Bacteria 2064
135 Ga0439462_0069961 3300042015 Bacteria 953
136 Ga0450923_045801 3300042125 Bacteria 929
137 Ga0450888_018865 3300042126 Bacteria 866
138 Ga0450898_007606 3300042134 Bacteria 1690
139 Ga0439446_0080482 3300042156 Bacteria 1008
140 Ga0439458_0062184 3300042157 Bacteria 933
141 Ga0439434_0014900 3300042435 Bacteria 2314
142 Ga0450918_004824 3300042531 Bacteria 2439
143 Ga0466969_0000024 3300044656 Bacteria 96283
144 Ga0466969_0017146 3300044656 Bacteria 3785
145 Ga0466972_0001202 3300044658 Bacteria 12449
146 Ga0466972_0268431 3300044658 Bacteria 797
147 Ga0466965_0239628 3300044683 Bacteria 971
148 Ga0466966_0003894 3300044684 Bacteria 9859
149 Ga0466966_0014227 3300044684 Bacteria 5268
150 Ga0466961_0053914 3300044693 Bacteria 2565
151 Ga0466963_0123928 3300044694 Bacteria 1780
152 Ga0466964_0007328 3300044706 Bacteria 4124
153 Ga0466964_0128953 3300044706 Bacteria 1149
154 Ga0466970_0019609 3300044765 Bacteria 3507
155 Ga0466970_0134434 3300044765 Bacteria 1360
156 Ga0466960_0087398 3300044901 Bacteria 1582
157 Ga0466959_0005794 3300045049 Bacteria 8508
158 Ga0466959_0007565 3300045049 Bacteria 7635
159 Ga0466958_0073357 3300045836 Bacteria 2096
160 Ga0466967_0021815 3300045976 Bacteria 5211
161 Ga0495638_0024870 3300046460 Bacteria 3898
162 Ga0495650_0006033 3300046471 Bacteria 7659
163 Ga0495620_0108721 3300046515 Bacteria 1100
164 Ga0495620_0136082 3300046515 Bacteria 962
165 Ga0495632_0002230 3300046519 Bacteria 14956
166 Ga0495632_0084028 3300046519 Bacteria 1515
167 Ga0495668_0066838 3300046616 Bacteria 1978
168 Ga0495625_0042053 3300046660 Bacteria 3323
169 Ga0496102_0005822 3300048905 Bacteria 10484
170 Ga0496102_0015573 3300048905 Bacteria 6625
171 Ga0496104_0027047 3300048907 Bacteria 5305
172 Ga0496105_0042544 3300048908 Bacteria 3745
173 Ga0496108_0080689 3300048911 Bacteria 2756
174 Ga0496112_0004102 3300048915 Bacteria 12246
175 Ga0496113_0013209 3300048916 Bacteria 5583
176 Ga0496114_0016429 3300048917 Bacteria 5965
177 Ga0496118_0052234 3300048921 Bacteria 3120
178 Ga0496121_0009673 3300048924 Bacteria 11044
179 Ga0496124_0002665 3300048927 Bacteria 22878
180 Ga0496125_0018145 3300048928 Bacteria 6688
181 Ga0496125_0362099 3300048928 Bacteria 862
182 Ga0501305_015071 3300049161 Bacteria 1088
183 Ga0501292_006772 3300049515 Bacteria 1638
184 Ga0501294_004607 3300049517 Bacteria 1299
185 Ga0501319_006970 3300049535 Bacteria 847
186 Ga0501320_003796 3300049536 Bacteria 1301
187 Ga0501323_007416 3300049539 Bacteria 1252
188 Ga0501323_009777 3300049539 Bacteria 1134
189 Ga0501206_042071 3300049653 Bacteria 707
190 Ga0501207_060062 3300049654 Bacteria 695
191 Ga0501257_014446 3300049686 Bacteria 1816
192 Ga0501281_01808 3300049777 Bacteria 1616
193 Ga0501035_0268279 3300049822 Bacteria 1445
194 nmdc:mga03683_242368_c1 3300050489 Bacteria 836
195 nmdc:mga03683_55751_c1 3300050489 Bacteria 1660
196 nmdc:mga03n38_18069_c1 3300050490 Bacteria 2776
197 nmdc:mga0k408_162554_c1 3300050493 Bacteria 1331
198 nmdc:mga0k408_72005_c1 3300050493 Bacteria 2018
199 nmdc:mga0k408_79967_c1 3300050493 Bacteria 1913
200 nmdc:mga04h51_244029_c1 3300050495 Bacteria 718
201 nmdc:mga07m45_107306_c1 3300050496 Bacteria 1607
202 nmdc:mga07m45_203272_c1 3300050496 Bacteria 1152
203 nmdc:mga07m45_320747_c1 3300050496 Bacteria 901
204 nmdc:mga07m45_450170_c1 3300050496 Bacteria 747
205 nmdc:mga07m45_65863_c1 3300050496 Bacteria 2058
206 nmdc:mga07m45_678_c2 3300050496 Bacteria 13120
207 nmdc:mga09592_3000_c1 3300050508 Bacteria 13680
208 nmdc:mga0qj67_97691_c1 3300050509 Bacteria 2365
209 nmdc:mga0rr50_433122_c1 3300050513 Bacteria 1113
210 Ga0500578_0001649 3300053086 Bacteria 21508
211 Ga0500646_0026204 3300053090 Bacteria 1579
212 Ga0500651_0030527 3300053093 Bacteria 3390
213 Ga0500562_102300 3300053108 Bacteria 780
214 Ga0500593_000086 3300053117 Bacteria 33745
215 Ga0500628_006350 3300053129 Bacteria 1998
216 Ga0500642_0024727 3300053130 Bacteria 2430
217 Ga0500642_0167017 3300053130 Bacteria 1030
218 Ga0500652_000263 3300053131 Bacteria 19634
219 Ga0500658_0088252 3300053134 Bacteria 1337
220 Ga0500577_0125489 3300053142 Bacteria 1071
221 Ga0500579_114348 3300053143 Bacteria 1341
222 Ga0500604_0013038 3300053151 Bacteria 2250
223 Ga0500619_000004 3300053154 Bacteria 98915
224 Ga0500622_0001292 3300053156 Bacteria 20381
225 Ga0500645_047724 3300053730 Bacteria 1255
226 Ga0500587_000273 3300053739 Bacteria 5691

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0268279 Ga0501035_0268279_488_1069 155
2 3300031548 Ga0307408_100652864 Ga0307408_1006528642 161
3 3300031852 Ga0307410_10640350 Ga0307410_106403501 161
4 3300031901 Ga0307406_10653622 Ga0307406_106536222 161
5 3300032005 Ga0307411_10974214 Ga0307411_109742141 161
6 3300049515 Ga0501292_006772 Ga0501292_006772_838_1431 161
7 3300049517 Ga0501294_004607 Ga0501294_004607_407_1000 161
8 3300049654 Ga0501207_060062 Ga0501207_060062_67_660 161
9 3300049686 Ga0501257_014446 Ga0501257_014446_732_1325 161
10 3300049777 Ga0501281_01808 Ga0501281_01808_350_943 161
11 3300044658 Ga0466972_0268431 Ga0466972_0268431_11_535 163
12 3300044901 Ga0466960_0087398 Ga0466960_0087398_280_852 163
13 3300005548 Ga0070665_100372412 Ga0070665_1003724122 165
14 3300028379 Ga0268266_10293158 Ga0268266_102931582 165
15 3300041512 Ga0451853_0351485 Ga0451853_0351485_949_1551 167
16 3300003347 JGI26128J50194_1000995 JGI26128J50194_10009952 168
17 3300027395 Ga0209996_1001480 Ga0209996_10014805 168
18 3300027526 Ga0209968_1000512 Ga0209968_10005125 168
19 3300027695 Ga0209966_1000382 Ga0209966_100038214 168
20 3300037418 Ga0395900_0000025 Ga0395900_0000025_176778_177353 169
21 3300042125 Ga0450923_045801 Ga0450923_045801_46_576 169
22 3300044656 Ga0466969_0017146 Ga0466969_0017146_247_831 169
23 3300044684 Ga0466966_0014227 Ga0466966_0014227_205_789 169
24 3300044694 Ga0466963_0123928 Ga0466963_0123928_485_1069 169
25 3300044706 Ga0466964_0007328 Ga0466964_0007328_2742_3326 169
26 3300044765 Ga0466970_0019609 Ga0466970_0019609_2821_3405 169
27 3300045049 Ga0466959_0005794 Ga0466959_0005794_3242_3826 169
28 3300045836 Ga0466958_0073357 Ga0466958_0073357_205_789 169
29 3300045976 Ga0466967_0021815 Ga0466967_0021815_92_676 169
30 3300003791 Ga0055530_10007731 Ga0055530_100077316 170
31 3300005262 Ga0065165_1003633 Ga0065165_100363310 170
32 3300005457 Ga0070662_100006305 Ga0070662_1000063055 170
33 3300005616 Ga0068852_100268051 Ga0068852_1002680512 170
34 3300005719 Ga0068861_100371819 Ga0068861_1003718192 170
35 3300006038 Ga0075365_10208187 Ga0075365_102081872 170
36 3300006048 Ga0075363_100075353 Ga0075363_1000753534 170
37 3300006051 Ga0075364_10197179 Ga0075364_101971792 170
38 3300006177 Ga0075362_10063724 Ga0075362_100637243 170
39 3300006178 Ga0075367_10024237 Ga0075367_100242375 170
40 3300006195 Ga0075366_10135628 Ga0075366_101356282 170
41 3300006353 Ga0075370_10004004 Ga0075370_100040042 170
42 3300025273 Ga0209673_1008939 Ga0209673_10089392 170
43 3300025298 Ga0209050_1000198 Ga0209050_1000198107 170
44 3300025303 Ga0209051_1013755 Ga0209051_10137555 170
45 3300025933 Ga0207706_10004342 Ga0207706_1000434213 170
46 3300026142 Ga0207698_10258269 Ga0207698_102582692 170
47 3300028786 Ga0307517_10165710 Ga0307517_101657102 170
48 3300031730 Ga0307516_10291974 Ga0307516_102919742 170
49 3300041443 Ga0451789_0961199 Ga0451789_0961199_913_1503 170
50 3300041453 Ga0451797_0058272 Ga0451797_0058272_207_797 170
51 3300041458 Ga0451798_0076574 Ga0451798_0076574_557_1147 170
52 3300041459 Ga0451800_1203546 Ga0451800_1203546_134_724 170
53 3300041463 Ga0451804_0653625 Ga0451804_0653625_58_648 170
54 3300041492 Ga0451835_0920265 Ga0451835_0920265_128_718 170
55 3300041512 Ga0451853_3167327 Ga0451853_3167327_645_1235 170
56 3300044658 Ga0466972_0001202 Ga0466972_0001202_10798_11379 170
57 3300044706 Ga0466964_0128953 Ga0466964_0128953_260_841 170
58 3300046460 Ga0495638_0024870 Ga0495638_0024870_2760_3350 170
59 3300046471 Ga0495650_0006033 Ga0495650_0006033_428_1012 170
60 3300046515 Ga0495620_0136082 Ga0495620_0136082_234_824 170
61 3300046519 Ga0495632_0002230 Ga0495632_0002230_14231_14794 170
62 3300046616 Ga0495668_0066838 Ga0495668_0066838_1240_1872 170
63 3300050490 nmdc:mga03n38_18069_c1 nmdc:mga03n38_18069_c1_1387_1977 170
64 3300050493 nmdc:mga0k408_162554_c1 nmdc:mga0k408_162554_c1_480_1070 170
65 3300050496 nmdc:mga07m45_678_c2 nmdc:mga07m45_678_c2_10683_11273 170
66 3300053086 Ga0500578_0001649 Ga0500578_0001649_5458_6048 170
67 3300053090 Ga0500646_0026204 Ga0500646_0026204_589_1179 170
68 3300053093 Ga0500651_0030527 Ga0500651_0030527_1089_1679 170
69 3300053108 Ga0500562_102300 Ga0500562_102300_15_578 170
70 3300053129 Ga0500628_006350 Ga0500628_006350_610_1200 170
71 3300053130 Ga0500642_0024727 Ga0500642_0024727_213_803 170
72 3300053130 Ga0500642_0167017 Ga0500642_0167017_98_688 170
73 3300053131 Ga0500652_000263 Ga0500652_000263_14221_14811 170
74 3300053134 Ga0500658_0088252 Ga0500658_0088252_141_731 170
75 3300053142 Ga0500577_0125489 Ga0500577_0125489_417_1007 170
76 3300053143 Ga0500579_114348 Ga0500579_114348_574_1164 170
77 3300053151 Ga0500604_0013038 Ga0500604_0013038_902_1492 170
78 3300053156 Ga0500622_0001292 Ga0500622_0001292_11227_11817 170
79 3300053730 Ga0500645_047724 Ga0500645_047724_449_1039 170
80 iso_pu_bacteria 2585428057 2587725004 170
81 iso_pu_bacteria 2585428058 2587731634 170
82 iso_pu_bacteria 2588253510 2588292511 170
83 iso_pu_bacteria 2643221592 2643968114 170
84 iso_pu_bacteria 2643221625 2644142530 170
85 iso_pu_bacteria 2643221648 2644276971 170
86 3300002773 JGI25152J39213_1001665 JGI25152J39213_100166510 171
87 3300003215 JGI25153J46596_10002943 JGI25153J46596_1000294311 171
88 3300005456 Ga0070678_100034651 Ga0070678_1000346515 171
89 3300005539 Ga0068853_100226458 Ga0068853_1002264582 171
90 3300005843 Ga0068860_100282241 Ga0068860_1002822413 171
91 3300006195 Ga0075366_10165983 Ga0075366_101659832 171
92 3300006353 Ga0075370_10000538 Ga0075370_1000053814 171
93 3300009545 Ga0105237_10001352 Ga0105237_1000135228 171
94 3300010375 Ga0105239_10003766 Ga0105239_100037665 171
95 3300025245 Ga0207425_1005144 Ga0207425_10051445 171
96 3300025258 Ga0209129_1000027 Ga0209129_1000027214 171
97 3300025263 Ga0209565_1015028 Ga0209565_10150282 171
98 3300025273 Ga0209673_1004671 Ga0209673_10046715 171
99 3300025295 Ga0209564_1000014 Ga0209564_1000014567 171
100 3300025297 Ga0209758_1000310 Ga0209758_10003102 171
101 3300025299 Ga0209256_1041110 Ga0209256_10411102 171
102 3300025914 Ga0207671_10009654 Ga0207671_100096545 171
103 3300026041 Ga0207639_10175369 Ga0207639_101753692 171
104 3300026121 Ga0207683_10053290 Ga0207683_100532904 171
105 3300028381 Ga0268264_10188851 Ga0268264_101888512 171
106 3300041452 Ga0451793_0636093 Ga0451793_0636093_61_651 171
107 3300042005 Ga0439448_0020090 Ga0439448_0020090_400_960 171
108 3300048905 Ga0496102_0015573 Ga0496102_0015573_2770_3360 171
109 3300048921 Ga0496118_0052234 Ga0496118_0052234_1902_2483 171
110 3300048924 Ga0496121_0009673 Ga0496121_0009673_2325_2906 171
111 3300048927 Ga0496124_0002665 Ga0496124_0002665_11195_11776 171
112 3300048928 Ga0496125_0018145 Ga0496125_0018145_5442_6023 171
113 3300048928 Ga0496125_0362099 Ga0496125_0362099_249_830 171
114 3300049161 Ga0501305_015071 Ga0501305_015071_83_700 171
115 3300050493 nmdc:mga0k408_72005_c1 nmdc:mga0k408_72005_c1_250_822 171
116 3300050493 nmdc:mga0k408_79967_c1 nmdc:mga0k408_79967_c1_583_1146 171
117 3300050496 nmdc:mga07m45_65863_c1 nmdc:mga07m45_65863_c1_38_601 171
118 3300053117 Ga0500593_000086 Ga0500593_000086_29650_30240 171
119 3300003215 JGI25153J46596_10001565 JGI25153J46596_100015652 172
120 3300003320 rootH2_10172112 rootH2_101721122 172
121 3300005355 Ga0070671_100006769 Ga0070671_1000067695 172
122 3300005618 Ga0068864_100780773 Ga0068864_1007807732 172
123 3300005841 Ga0068863_100323497 Ga0068863_1003234973 172
124 3300006177 Ga0075362_10119466 Ga0075362_101194661 172
125 3300009177 Ga0105248_10003694 Ga0105248_1000369411 172
126 3300025297 Ga0209758_1000281 Ga0209758_1000281100 172
127 3300025931 Ga0207644_10093298 Ga0207644_100932984 172
128 3300025941 Ga0207711_10032668 Ga0207711_100326686 172
129 3300026095 Ga0207676_10161003 Ga0207676_101610032 172
130 3300027866 Ga0209813_10101877 Ga0209813_101018772 172
131 3300027876 Ga0209974_10000874 Ga0209974_100008744 172
132 3300028794 Ga0307515_10001727 Ga0307515_1000172711 172
133 3300028794 Ga0307515_10002873 Ga0307515_100028733 172
134 3300028794 Ga0307515_10030061 Ga0307515_1003006111 172
135 3300028794 Ga0307515_10355230 Ga0307515_103552302 172
136 3300030522 Ga0307512_10073755 Ga0307512_100737552 172
137 3300031456 Ga0307513_10171817 Ga0307513_101718174 172
138 3300031507 Ga0307509_10103893 Ga0307509_101038934 172
139 3300031616 Ga0307508_10000007 Ga0307508_10000007178 172
140 3300031649 Ga0307514_10025723 Ga0307514_100257237 172
141 3300031730 Ga0307516_10014861 Ga0307516_100148614 172
142 3300041456 Ga0451795_1651988 Ga0451795_1651988_523_1116 172
143 3300041458 Ga0451798_0030369 Ga0451798_0030369_162_755 172
144 3300041486 Ga0451807_2294657 Ga0451807_2294657_35_628 172
145 3300041505 Ga0451849_1194449 Ga0451849_1194449_558_1151 172
146 3300041509 Ga0451843_1548019 Ga0451843_1548019_82_675 172
147 3300041512 Ga0451853_3382570 Ga0451853_3382570_743_1336 172
148 3300041997 Ga0439431_0002967 Ga0439431_0002967_1331_1930 172
149 3300042126 Ga0450888_018865 Ga0450888_018865_181_780 172
150 3300042134 Ga0450898_007606 Ga0450898_007606_576_1175 172
151 3300042156 Ga0439446_0080482 Ga0439446_0080482_169_768 172
152 3300042157 Ga0439458_0062184 Ga0439458_0062184_85_699 172
153 3300044656 Ga0466969_0000024 Ga0466969_0000024_57729_58316 172
154 3300044683 Ga0466965_0239628 Ga0466965_0239628_304_879 172
155 3300044684 Ga0466966_0003894 Ga0466966_0003894_4801_5388 172
156 3300044693 Ga0466961_0053914 Ga0466961_0053914_1575_2162 172
157 3300044765 Ga0466970_0134434 Ga0466970_0134434_669_1256 172
158 3300045049 Ga0466959_0007565 Ga0466959_0007565_1798_2385 172
159 3300046515 Ga0495620_0108721 Ga0495620_0108721_47_640 172
160 3300046519 Ga0495632_0084028 Ga0495632_0084028_108_692 172
161 3300046660 Ga0495625_0042053 Ga0495625_0042053_368_961 172
162 3300048905 Ga0496102_0005822 Ga0496102_0005822_4338_4931 172
163 3300048907 Ga0496104_0027047 Ga0496104_0027047_1110_1712 172
164 3300048908 Ga0496105_0042544 Ga0496105_0042544_1374_1976 172
165 3300048911 Ga0496108_0080689 Ga0496108_0080689_1502_2104 172
166 3300048915 Ga0496112_0004102 Ga0496112_0004102_6638_7240 172
167 3300048916 Ga0496113_0013209 Ga0496113_0013209_4132_4734 172
168 3300050489 nmdc:mga03683_242368_c1 nmdc:mga03683_242368_c1_22_615 172
169 3300050495 nmdc:mga04h51_244029_c1 nmdc:mga04h51_244029_c1_107_700 172
170 3300050496 nmdc:mga07m45_107306_c1 nmdc:mga07m45_107306_c1_47_640 172
171 3300050496 nmdc:mga07m45_320747_c1 nmdc:mga07m45_320747_c1_47_640 172
172 3300050496 nmdc:mga07m45_450170_c1 nmdc:mga07m45_450170_c1_122_715 172
173 3300053154 Ga0500619_000004 Ga0500619_000004_30898_31476 172
174 3300053739 Ga0500587_000273 Ga0500587_000273_1278_1862 172
175 iso_pu_bacteria 2585428062 2587755438 172
176 3300003320 rootH2_10223802 rootH2_102238022 173
177 3300003322 rootL2_10201648 rootL2_102016481 173
178 3300007076 Ga0075435_100364400 Ga0075435_1003644002 173
179 3300031456 Ga0307513_10415125 Ga0307513_104151252 173
180 3300050496 nmdc:mga07m45_203272_c1 nmdc:mga07m45_203272_c1_195_764 173
181 3300050513 nmdc:mga0rr50_433122_c1 nmdc:mga0rr50_433122_c1_130_738 173
182 iso_pu_bacteria 2643221660 2644340426 173
183 3300003775 Ga0055524_1000510 Ga0055524_100051028 174
184 3300003791 Ga0055530_10001567 Ga0055530_100015672 174
185 3300003792 Ga0055540_1000080 Ga0055540_100008052 174
186 3300003794 Ga0055531_10003485 Ga0055531_100034854 174
187 3300005467 Ga0070706_100060312 Ga0070706_1000603122 174
188 3300021361 Ga0213872_10000082 Ga0213872_1000008275 174
189 3300025291 Ga0209675_1004921 Ga0209675_10049218 174
190 3300025298 Ga0209050_1000739 Ga0209050_100073935 174
191 3300025298 Ga0209050_1028827 Ga0209050_10288272 174
192 3300025299 Ga0209256_1000203 Ga0209256_100020351 174
193 3300025303 Ga0209051_1000035 Ga0209051_100003551 174
194 3300025304 Ga0209257_1000346 Ga0209257_100034610 174
195 3300025910 Ga0207684_10132195 Ga0207684_101321953 174
196 3300032002 Ga0307416_100381355 Ga0307416_1003813552 174
197 3300032005 Ga0307411_10312623 Ga0307411_103126232 174
198 3300039447 Ga0436361_0848343 Ga0436361_0848343_109798_110403 174
199 3300048917 Ga0496114_0016429 Ga0496114_0016429_1642_2256 174
200 3300003575 Ga0007409J51694_1058441 Ga0007409J51694_10584412 175
201 3300005366 Ga0070659_100000319 Ga0070659_10000031925 175
202 3300005459 Ga0068867_100000800 Ga0068867_1000008003 175
203 3300005564 Ga0070664_100147020 Ga0070664_1001470203 175
204 3300006946 Ga0079104_1000267 Ga0079104_100026728 175
205 3300013297 Ga0157378_10413293 Ga0157378_104132932 175
206 3300014326 Ga0157380_10361432 Ga0157380_103614322 175
207 3300025932 Ga0207690_10001201 Ga0207690_1000120117 175
208 3300025945 Ga0207679_10000056 Ga0207679_1000005634 175
209 3300025945 Ga0207679_10090229 Ga0207679_100902294 175
210 3300027111 Ga0209281_1000076 Ga0209281_1000076137 175
211 3300042015 Ga0439462_0069961 Ga0439462_0069961_295_876 175
212 3300042435 Ga0439434_0014900 Ga0439434_0014900_469_1086 175
213 3300042531 Ga0450918_004824 Ga0450918_004824_45_662 175
214 3300049535 Ga0501319_006970 Ga0501319_006970_140_763 175
215 3300049536 Ga0501320_003796 Ga0501320_003796_139_744 175
216 3300049539 Ga0501323_007416 Ga0501323_007416_223_846 175
217 3300049539 Ga0501323_009777 Ga0501323_009777_193_789 175
218 3300049653 Ga0501206_042071 Ga0501206_042071_34_633 175
219 3300050489 nmdc:mga03683_55751_c1 nmdc:mga03683_55751_c1_119_736 175
220 iso_pu_bacteria 2643221644 2644248748 175
221 3300005354 Ga0070675_100110975 Ga0070675_1001109752 176
222 3300005459 Ga0068867_100914737 Ga0068867_1009147371 176
223 3300006846 Ga0075430_100163799 Ga0075430_1001637993 176
224 3300006880 Ga0075429_100002229 Ga0075429_10000222918 176
225 3300013296 Ga0157374_10106817 Ga0157374_101068175 176
226 3300013297 Ga0157378_10401000 Ga0157378_104010002 176
227 3300025926 Ga0207659_10150666 Ga0207659_101506661 176
228 3300026089 Ga0207648_10984129 Ga0207648_109841291 176
229 3300037471 Ga0395905_0047645 Ga0395905_0047645_135_731 176
230 3300050508 nmdc:mga09592_3000_c1 nmdc:mga09592_3000_c1_10089_10691 176
231 3300050509 nmdc:mga0qj67_97691_c1 nmdc:mga0qj67_97691_c1_70_672 176
232 3300001979 JGI24740J21852_10004956 JGI24740J21852_100049561 177
233 3300026142 Ga0207698_10383405 Ga0207698_103834052 177
234 3300031548 Ga0307408_100440695 Ga0307408_1004406952 177
235 3300032126 Ga0307415_100563346 Ga0307415_1005633462 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05239

PRC

PRC-barrel domain

136

207

0.97

PF01782

RimM

RimM N-terminal domain

35

130

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cq1-assembly1.cif.gz_A solution structure of the c-terminal domain of mycobacterium tuberculosis ribosome maturation factor protein rimm 0.8296 100 175
2dog-assembly1.cif.gz_A solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 0.8147 2 95
1pm3-assembly1.cif.gz_B mth1859 0.7639 100 173
7cq1-assembly1.cif.gz_A solution structure of the c-terminal domain of mycobacterium tuberculosis ribosome maturation factor protein rimm 0.7628 100 175
5ke3-assembly1.cif.gz_A crystal structure of setdb1 tudor domain in complex with fragment mrt0181a 0.7569 120 153
ID Description Score Start End Superfamily
af_P9WH19_99_175_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.9196 100 176 2.30.30.240
af_Q2FZ44_92_167_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.9108 96 176 2.30.30.240
af_P0A7X6_101_182_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.9063 96 177 2.30.30.240
af_P0A7X6_101_182_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8959 96 177 2.30.30.240
2f1lA02 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8922 101 177 2.30.30.240
ID Description Score Start End GO Terms
AF-A0A7C2U092-F1-model_v4 Ribosome maturation factor RimM 0.8696 1 176 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-F5YLS4-F1-model_v4 Ribosome maturation factor RimM 0.848 1 173 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A660YC78-F1-model_v4 Ribosome maturation factor RimM 0.8469 1 173 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A2M7WFE6-F1-model_v4 Ribosome maturation factor RimM 0.8451 1 172 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A2V8GSW8-F1-model_v4 Ribosome maturation factor RimM 0.8399 1 176 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022

Feature Viewer

pLDDT pTM Quality
86.48 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map