F348398

General Info

Members Datasets Scaffolds Average Seq Length
235 140 470 174

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0774112|Ga0466958_0774112_80_598
Length 172
Sequence MALLPILEVPDPRLKVKATPVAEVDAELRKTAADMLETMYKAPGIGLAGTQVGVMRRICVVDVADRKAGEEPRPMVLVNPDITWRSEDEDTVEEGCLSLPGQYADVTRPKGVRVRYRDLEGAEQEVEADGLLARCLQHEIDHLDGVLFVDRISALKRNMILRKLAKARRARA

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
3 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
51 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
85 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
87 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
90 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
133 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
134 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
135 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
136 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
137 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
138 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
139 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
140 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 0.85
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.13
Nodule 0
Rhizoplane 1.7
Rhizosphere 87.23
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0774112 3300045836 Bacteria 626
2 Ga0070671_100124108 3300005355 Bacteria 2173
3 Ga0070673_100305016 3300005364 Bacteria 1403
4 Ga0070659_100067409 3300005366 Bacteria 2838
5 Ga0070667_100128626 3300005367 Bacteria 2209
6 Ga0070709_10126608 3300005434 Bacteria 1738
7 Ga0070714_100003461 3300005435 Bacteria 11767
8 Ga0070714_100188754 3300005435 Bacteria 1879
9 Ga0070713_100118479 3300005436 Bacteria 2318
10 Ga0070713_100126284 3300005436 Bacteria 2250
11 Ga0070711_100373190 3300005439 Bacteria 1152
12 Ga0070711_100716017 3300005439 Bacteria 844
13 Ga0070705_100147113 3300005440 Bacteria 1558
14 Ga0070708_100068247 3300005445 Bacteria 3195
15 Ga0070681_10207474 3300005458 Bacteria 1876
16 Ga0070681_10538104 3300005458 Bacteria 1082
17 Ga0070706_100058691 3300005467 Bacteria 3551
18 Ga0070706_100068666 3300005467 Bacteria 3278
19 Ga0070707_100051697 3300005468 Bacteria 3938
20 Ga0070698_100000939 3300005471 Bacteria 31911
21 Ga0070698_100045971 3300005471 Bacteria 4465
22 Ga0070698_100076158 3300005471 Bacteria 3357
23 Ga0070699_100132483 3300005518 Bacteria 2198
24 Ga0070699_100248371 3300005518 Bacteria 1589
25 Ga0070699_100690182 3300005518 Bacteria 933
26 Ga0070679_100024189 3300005530 Bacteria 5951
27 Ga0070679_100066216 3300005530 Bacteria 3601
28 Ga0070697_100403619 3300005536 Bacteria 1186
29 Ga0068855_101005775 3300005563 Bacteria 876
30 Ga0068857_100047211 3300005577 Bacteria 3823
31 Ga0068856_100439013 3300005614 Bacteria 1326
32 Ga0070702_100609277 3300005615 Bacteria 820
33 Ga0068864_101342669 3300005618 Bacteria 716
34 Ga0068863_100542179 3300005841 Bacteria 1148
35 Ga0068863_101128531 3300005841 Bacteria 789
36 Ga0081540_1011573 3300005983 Bacteria 5890
37 Ga0070717_10004350 3300006028 Bacteria 10217
38 Ga0070717_10037420 3300006028 Bacteria 3940
39 Ga0070717_10885639 3300006028 Bacteria 812
40 Ga0070716_100060725 3300006173 Bacteria 2185
41 Ga0070716_100330444 3300006173 Bacteria 1072
42 Ga0070712_100068569 3300006175 Bacteria 2528
43 Ga0070712_100168869 3300006175 Bacteria 1696
44 Ga0070712_100224877 3300006175 Bacteria 1487
45 Ga0070712_100237258 3300006175 Bacteria 1451
46 Ga0075436_100077118 3300006914 Bacteria 2308
47 Ga0099795_10040678 3300007788 Bacteria 1652
48 Ga0099795_10046207 3300007788 Bacteria 1568
49 Ga0105240_10021384 3300009093 Bacteria 8605
50 Ga0105240_10306760 3300009093 Bacteria 1814
51 Ga0105240_10403638 3300009093 Bacteria 1539
52 Ga0105240_11082958 3300009093 Bacteria 853
53 Ga0111539_10857157 3300009094 Bacteria 1057
54 Ga0105243_11421624 3300009148 Bacteria 715
55 Ga0105241_10197122 3300009174 Bacteria 1680
56 Ga0105241_10934595 3300009174 Bacteria 807
57 Ga0105248_11412569 3300009177 Bacteria 788
58 Ga0105237_10148630 3300009545 Bacteria 2338
59 Ga0105237_10607314 3300009545 Bacteria 1101
60 Ga0105238_10002689 3300009551 Bacteria 17685
61 Ga0105238_10635510 3300009551 Bacteria 1077
62 Ga0105249_10360894 3300009553 Bacteria 1474
63 Ga0105249_10776859 3300009553 Bacteria 1021
64 Ga0105249_12489134 3300009553 Bacteria 590
65 Ga0099796_10025704 3300010159 Bacteria 1862
66 Ga0105239_10892082 3300010375 Bacteria 1020
67 Ga0105239_10993170 3300010375 Bacteria 965
68 Ga0157370_10010427 3300013104 Bacteria 9795
69 Ga0157369_10033300 3300013105 Bacteria 5663
70 Ga0163162_11907051 3300013306 Bacteria 680
71 Ga0157372_10885897 3300013307 Bacteria 1036
72 Ga0157375_10862829 3300013308 Bacteria 1051
73 Ga0163163_10894496 3300014325 Bacteria 951
74 Ga0182008_10124805 3300014497 Bacteria 1281
75 Ga0157379_11365626 3300014968 Bacteria 686
76 Ga0157376_12197833 3300014969 Bacteria 591
77 Ga0182007_10299910 3300015262 Bacteria 590
78 Ga0197907_11052980 3300020069 Bacteria 819
79 Ga0154015_1266653 3300020610 Bacteria 609
80 Ga0213872_10116586 3300021361 Bacteria 1183
81 Ga0213872_10142018 3300021361 Bacteria 1053
82 Ga0213875_10000134 3300021388 Bacteria 82367
83 Ga0213875_10004900 3300021388 Bacteria 7267
84 Ga0213875_10004929 3300021388 Bacteria 7247
85 Ga0213875_10032117 3300021388 Bacteria 2482
86 Ga0213871_10126084 3300021441 Bacteria 766
87 Ga0213871_10142325 3300021441 Bacteria 726
88 Ga0207426_1012601 3300025302 Bacteria 3170
89 Ga0207692_10387910 3300025898 Bacteria 868
90 Ga0207680_10208480 3300025903 Bacteria 1335
91 Ga0207684_10072535 3300025910 Bacteria 2924
92 Ga0207654_10443503 3300025911 Bacteria 909
93 Ga0207707_10143876 3300025912 Bacteria 2084
94 Ga0207707_10300904 3300025912 Bacteria 1387
95 Ga0207707_10353067 3300025912 Bacteria 1267
96 Ga0207695_10084996 3300025913 Bacteria 3193
97 Ga0207695_10088560 3300025913 Bacteria 3115
98 Ga0207695_10166328 3300025913 Bacteria 2134
99 Ga0207695_10245852 3300025913 Bacteria 1689
100 Ga0207695_10250918 3300025913 Bacteria 1669
101 Ga0207695_10737433 3300025913 Bacteria 865
102 Ga0207671_10062542 3300025914 Bacteria 2764
103 Ga0207693_10015595 3300025915 Bacteria 6095
104 Ga0207693_10095890 3300025915 Bacteria 2325
105 Ga0207693_10393934 3300025915 Bacteria 1083
106 Ga0207663_10134774 3300025916 Bacteria 1712
107 Ga0207663_10876045 3300025916 Bacteria 717
108 Ga0207660_10268127 3300025917 Bacteria 1352
109 Ga0207652_10204825 3300025921 Bacteria 1776
110 Ga0207652_10834894 3300025921 Bacteria 817
111 Ga0207646_10024329 3300025922 Bacteria 5548
112 Ga0207681_10615067 3300025923 Bacteria 899
113 Ga0207694_10012679 3300025924 Bacteria 6351
114 Ga0207694_11233792 3300025924 Bacteria 632
115 Ga0207700_10292662 3300025928 Bacteria 1404
116 Ga0207700_10342197 3300025928 Bacteria 1301
117 Ga0207700_10416461 3300025928 Bacteria 1179
118 Ga0207700_10474553 3300025928 Bacteria 1105
119 Ga0207700_11184765 3300025928 Bacteria 682
120 Ga0207664_10005455 3300025929 Bacteria 8697
121 Ga0207664_10154811 3300025929 Bacteria 1950
122 Ga0207644_10117457 3300025931 Bacteria 2020
123 Ga0207669_11285325 3300025937 Bacteria 621
124 Ga0207665_10055996 3300025939 Bacteria 2662
125 Ga0207665_10326986 3300025939 Bacteria 1152
126 Ga0207711_11062793 3300025941 Bacteria 750
127 Ga0207667_10651784 3300025949 Bacteria 1058
128 Ga0207640_10882662 3300025981 Bacteria 780
129 Ga0207702_10226109 3300026078 Bacteria 1746
130 Ga0207674_10060513 3300026116 Bacteria 3829
131 Ga0268266_10000323 3300028379 Bacteria 75261
132 Ga0268264_10939134 3300028381 Bacteria 870
133 Ga0265338_10801338 3300028800 Bacteria 645
134 Ga0373926_0056272 3300035083 Bacteria 1427
135 Ga0373936_0154359 3300035113 Bacteria 997
136 Ga0373953_0003950 3300035117 Bacteria 4673
137 Ga0373953_0175224 3300035117 Bacteria 924
138 Ga0373954_0158685 3300035118 Bacteria 1106
139 Ga0373954_0346738 3300035118 Bacteria 733
140 Ga0373956_0019548 3300035119 Bacteria 2874
141 Ga0373956_0275357 3300035119 Bacteria 801
142 Ga0373957_0113356 3300035120 Bacteria 1093
143 Ga0373960_0224775 3300035121 Bacteria 673
144 Ga0373960_0317542 3300035121 Bacteria 583
145 Ga0373955_0019598 3300035172 Bacteria 3385
146 Ga0373955_0243826 3300035172 Bacteria 1077
147 Ga0373924_0090841 3300035410 Bacteria 1306
148 Ga0373935_0373423 3300035692 Bacteria 1020
149 Ga0373927_0173911 3300035695 Bacteria 1412
150 Ga0373947_0329800 3300035725 Bacteria 1022
151 Ga0373937_0002342 3300036401 Bacteria 15788
152 Ga0373937_0021533 3300036401 Bacteria 5786
153 Ga0373937_0051917 3300036401 Bacteria 3758
154 Ga0373937_0189178 3300036401 Bacteria 1934
155 Ga0373925_0104959 3300037068 Bacteria 2177
156 Ga0373925_0296857 3300037068 Bacteria 1304
157 Ga0373925_0486523 3300037068 Bacteria 1012
158 Ga0395899_0171782 3300037312 Bacteria 1526
159 Ga0395900_0481091 3300037418 Bacteria 1194
160 Ga0436364_0624755 3300037853 Bacteria 5636
161 Ga0436364_1043341 3300037853 Bacteria 1619
162 Ga0436364_1219807 3300037853 Bacteria 3497
163 Ga0436364_1309894 3300037853 Bacteria 49139
164 Ga0436364_1320883 3300037853 Bacteria 111220
165 Ga0436364_1514458 3300037853 Bacteria 39991
166 Ga0395901_0083197 3300038443 Bacteria 3345
167 Ga0436365_0000132 3300039437 Bacteria 868
168 Ga0436365_0114980 3300039437 Bacteria 1405
169 Ga0436365_0537282 3300039437 Bacteria 3004
170 Ga0436365_1175914 3300039437 Bacteria 1152
171 Ga0436365_1517619 3300039437 Bacteria 2951
172 Ga0436360_0108794 3300039438 Bacteria 1176
173 Ga0436360_0145118 3300039438 Bacteria 7260
174 Ga0436360_0318263 3300039438 Bacteria 2874
175 Ga0436360_0351229 3300039438 Bacteria 1087
176 Ga0436360_0766286 3300039438 Bacteria 1260
177 Ga0436360_1162788 3300039438 Bacteria 1085
178 Ga0436361_0004768 3300039447 Bacteria 4514
179 Ga0436361_0054346 3300039447 Unclassified 613
180 Ga0436361_1114573 3300039447 Bacteria 5732
181 Ga0436363_0531479 3300039450 Bacteria 853
182 Ga0436363_0573535 3300039450 Bacteria 1040
183 Ga0436363_0933684 3300039450 Bacteria 1780
184 Ga0436363_1383279 3300039450 Bacteria 791
185 Ga0436362_0008365 3300039453 Bacteria 1028
186 Ga0436362_0263828 3300039453 Bacteria 2023
187 Ga0436362_0264138 3300039453 Bacteria 590
188 Ga0436362_0551507 3300039453 Bacteria 587
189 Ga0436362_0806700 3300039453 Bacteria 1585
190 Ga0436362_0863388 3300039453 Bacteria 1553
191 Ga0436362_0912931 3300039453 Bacteria 2082
192 Ga0466968_0264711 3300044735 Bacteria 819
193 Ga0466967_0442722 3300045976 Bacteria 1269
194 Ga0466967_0659841 3300045976 Bacteria 1035
195 Ga0495629_0612379 3300046459 Bacteria 728
196 Ga0495651_0669086 3300046462 Bacteria 649
197 Ga0495662_0215117 3300046476 Bacteria 947
198 Ga0495618_0053335 3300046514 Bacteria 2557
199 Ga0495628_0247779 3300046516 Bacteria 1331
200 Ga0495628_0311711 3300046516 Bacteria 1163
201 Ga0495640_0187940 3300046533 Bacteria 1314
202 Ga0495640_0195858 3300046533 Bacteria 1283
203 Ga0495586_0080983 3300046535 Bacteria 1784
204 Ga0495587_0324495 3300046536 Bacteria 860
205 Ga0495667_0031000 3300046559 Bacteria 3591
206 Ga0495684_0292095 3300047471 Bacteria 1173
207 Ga0496110_0265344 3300048913 Bacteria 1563
208 Ga0496111_0141314 3300048914 Bacteria 1784
209 Ga0496112_0433962 3300048915 Bacteria 1252
210 Ga0496115_0202375 3300048918 Bacteria 1640
211 Ga0496126_0205820 3300048929 Bacteria 1659
212 Ga0501033_0006652 3300049570 Bacteria 9039
213 Ga0501034_0139308 3300049571 Bacteria 2406
214 Ga0501043_0071013 3300049579 Bacteria 2735
215 Ga0501043_0737585 3300049579 Bacteria 717
216 Ga0501046_0135343 3300049580 Bacteria 1866
217 Ga0501048_0731125 3300049582 Bacteria 711
218 Ga0501070_0018273 3300049586 Bacteria 5882
219 Ga0501044_0205996 3300049823 Bacteria 1923
220 Ga0501044_0293958 3300049823 Bacteria 1555
221 Ga0501044_1212086 3300049823 Bacteria 622
222 nmdc:mga08y16_879369_c1 3300050511 Bacteria 883
223 nmdc:mga08x19_74773_c1 3300050514 Bacteria 2214
224 nmdc:mga08x19_77727_c1 3300050514 Bacteria 2174
225 Ga0495601_0103155 3300053077 Bacteria 1843
226 Ga0495601_0104221 3300053077 Bacteria 1833
227 Ga0495595_0009441 3300053084 Bacteria 4036
228 Ga0495595_0031396 3300053084 Bacteria 2387
229 Ga0495619_0014082 3300053085 Bacteria 5047
230 Ga0495619_0540970 3300053085 Bacteria 799
231 Ga0500595_013569 3300053119 Bacteria 3119
232 Ga0500588_0002728 3300053146 Bacteria 3634
233 Ga0500645_055316 3300053730 Bacteria 1153
234 Ga0500609_020600 3300053731 Bacteria 899
235 2897806656 2897803580 Bacteria 7000062
236 Ga0466958_0774112
237 Ga0070671_100124108
238 Ga0070673_100305016
239 Ga0070659_100067409
240 Ga0070667_100128626
241 Ga0070709_10126608
242 Ga0070714_100003461
243 Ga0070714_100188754
244 Ga0070713_100118479
245 Ga0070713_100126284
246 Ga0070711_100373190
247 Ga0070711_100716017
248 Ga0070705_100147113
249 Ga0070708_100068247
250 Ga0070681_10207474
251 Ga0070681_10538104
252 Ga0070706_100058691
253 Ga0070706_100068666
254 Ga0070707_100051697
255 Ga0070698_100000939
256 Ga0070698_100045971
257 Ga0070698_100076158
258 Ga0070699_100132483
259 Ga0070699_100248371
260 Ga0070699_100690182
261 Ga0070679_100024189
262 Ga0070679_100066216
263 Ga0070697_100403619
264 Ga0068855_101005775
265 Ga0068857_100047211
266 Ga0068856_100439013
267 Ga0070702_100609277
268 Ga0068864_101342669
269 Ga0068863_100542179
270 Ga0068863_101128531
271 Ga0081540_1011573
272 Ga0070717_10004350
273 Ga0070717_10037420
274 Ga0070717_10885639
275 Ga0070716_100060725
276 Ga0070716_100330444
277 Ga0070712_100068569
278 Ga0070712_100168869
279 Ga0070712_100224877
280 Ga0070712_100237258
281 Ga0075436_100077118
282 Ga0099795_10040678
283 Ga0099795_10046207
284 Ga0105240_10021384
285 Ga0105240_10306760
286 Ga0105240_10403638
287 Ga0105240_11082958
288 Ga0111539_10857157
289 Ga0105243_11421624
290 Ga0105241_10197122
291 Ga0105241_10934595
292 Ga0105248_11412569
293 Ga0105237_10148630
294 Ga0105237_10607314
295 Ga0105238_10002689
296 Ga0105238_10635510
297 Ga0105249_10360894
298 Ga0105249_10776859
299 Ga0105249_12489134
300 Ga0099796_10025704
301 Ga0105239_10892082
302 Ga0105239_10993170
303 Ga0157370_10010427
304 Ga0157369_10033300
305 Ga0163162_11907051
306 Ga0157372_10885897
307 Ga0157375_10862829
308 Ga0163163_10894496
309 Ga0182008_10124805
310 Ga0157379_11365626
311 Ga0157376_12197833
312 Ga0182007_10299910
313 Ga0197907_11052980
314 Ga0154015_1266653
315 Ga0213872_10116586
316 Ga0213872_10142018
317 Ga0213875_10000134
318 Ga0213875_10004900
319 Ga0213875_10004929
320 Ga0213875_10032117
321 Ga0213871_10126084
322 Ga0213871_10142325
323 Ga0207426_1012601
324 Ga0207692_10387910
325 Ga0207680_10208480
326 Ga0207684_10072535
327 Ga0207654_10443503
328 Ga0207707_10143876
329 Ga0207707_10300904
330 Ga0207707_10353067
331 Ga0207695_10084996
332 Ga0207695_10088560
333 Ga0207695_10166328
334 Ga0207695_10245852
335 Ga0207695_10250918
336 Ga0207695_10737433
337 Ga0207671_10062542
338 Ga0207693_10015595
339 Ga0207693_10095890
340 Ga0207693_10393934
341 Ga0207663_10134774
342 Ga0207663_10876045
343 Ga0207660_10268127
344 Ga0207652_10204825
345 Ga0207652_10834894
346 Ga0207646_10024329
347 Ga0207681_10615067
348 Ga0207694_10012679
349 Ga0207694_11233792
350 Ga0207700_10292662
351 Ga0207700_10342197
352 Ga0207700_10416461
353 Ga0207700_10474553
354 Ga0207700_11184765
355 Ga0207664_10005455
356 Ga0207664_10154811
357 Ga0207644_10117457
358 Ga0207669_11285325
359 Ga0207665_10055996
360 Ga0207665_10326986
361 Ga0207711_11062793
362 Ga0207667_10651784
363 Ga0207640_10882662
364 Ga0207702_10226109
365 Ga0207674_10060513
366 Ga0268266_10000323
367 Ga0268264_10939134
368 Ga0265338_10801338
369 Ga0373926_0056272
370 Ga0373936_0154359
371 Ga0373953_0003950
372 Ga0373953_0175224
373 Ga0373954_0158685
374 Ga0373954_0346738
375 Ga0373956_0019548
376 Ga0373956_0275357
377 Ga0373957_0113356
378 Ga0373960_0224775
379 Ga0373960_0317542
380 Ga0373955_0019598
381 Ga0373955_0243826
382 Ga0373924_0090841
383 Ga0373935_0373423
384 Ga0373927_0173911
385 Ga0373947_0329800
386 Ga0373937_0002342
387 Ga0373937_0021533
388 Ga0373937_0051917
389 Ga0373937_0189178
390 Ga0373925_0104959
391 Ga0373925_0296857
392 Ga0373925_0486523
393 Ga0395899_0171782
394 Ga0395900_0481091
395 Ga0436364_0624755
396 Ga0436364_1043341
397 Ga0436364_1219807
398 Ga0436364_1309894
399 Ga0436364_1320883
400 Ga0436364_1514458
401 Ga0395901_0083197
402 Ga0436365_0000132
403 Ga0436365_0114980
404 Ga0436365_0537282
405 Ga0436365_1175914
406 Ga0436365_1517619
407 Ga0436360_0108794
408 Ga0436360_0145118
409 Ga0436360_0318263
410 Ga0436360_0351229
411 Ga0436360_0766286
412 Ga0436360_1162788
413 Ga0436361_0004768
414 Ga0436361_0054346
415 Ga0436361_1114573
416 Ga0436363_0531479
417 Ga0436363_0573535
418 Ga0436363_0933684
419 Ga0436363_1383279
420 Ga0436362_0008365
421 Ga0436362_0263828
422 Ga0436362_0264138
423 Ga0436362_0551507
424 Ga0436362_0806700
425 Ga0436362_0863388
426 Ga0436362_0912931
427 Ga0466968_0264711
428 Ga0466967_0442722
429 Ga0466967_0659841
430 Ga0495629_0612379
431 Ga0495651_0669086
432 Ga0495662_0215117
433 Ga0495618_0053335
434 Ga0495628_0247779
435 Ga0495628_0311711
436 Ga0495640_0187940
437 Ga0495640_0195858
438 Ga0495586_0080983
439 Ga0495587_0324495
440 Ga0495667_0031000
441 Ga0495684_0292095
442 Ga0496110_0265344
443 Ga0496111_0141314
444 Ga0496112_0433962
445 Ga0496115_0202375
446 Ga0496126_0205820
447 Ga0501033_0006652
448 Ga0501034_0139308
449 Ga0501043_0071013
450 Ga0501043_0737585
451 Ga0501046_0135343
452 Ga0501048_0731125
453 Ga0501070_0018273
454 Ga0501044_0205996
455 Ga0501044_0293958
456 Ga0501044_1212086
457 nmdc:mga08y16_879369_c1
458 nmdc:mga08x19_74773_c1
459 nmdc:mga08x19_77727_c1
460 Ga0495601_0103155
461 Ga0495601_0104221
462 Ga0495595_0009441
463 Ga0495595_0031396
464 Ga0495619_0014082
465 Ga0495619_0540970
466 Ga0500595_013569
467 Ga0500588_0002728
468 Ga0500645_055316
469 Ga0500609_020600
470 2897806656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

3

158

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k6l-assembly3.cif.gz_C the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9798 3 162
1lme-assembly2.cif.gz_B crystal structure of peptide deformylase from thermotoga maritima 0.9714 1 151
3fwx-assembly2.cif.gz_B the crystal structure of the peptide deformylase from vibrio cholerae o1 biovar el tor str. n16961 0.9705 3 167
3k6l-assembly1.cif.gz_A the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9704 2 167
3k6l-assembly3.cif.gz_C the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9673 3 162
ID Description Score Start End Superfamily
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9711 1 151 3.90.45.10
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.963 6 145 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9616 1 151 3.90.45.10
3u04A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9599 1 167 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9581 1 151 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A3D5RP71-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9988 1 167 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A355BX18-F1-model_v4 Peptide deformylase 0.9946 1 137 GO:0042586
GO:0043686
AF-A0A3B9DHT9-F1-model_v4 deleted 0.9929 1 168
AF-A0A3D2PFZ0-F1-model_v4 deleted 0.9924 1 129
AF-A0A2S3V3E4-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9921 1 168 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Map