F348368

General Info

Members Datasets Scaffolds Average Seq Length
235 172 233 99

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0015259|Ga0451577_0015259_1117_1473
Length 118
Sequence MAACDDRQAMIYKFKSKAAGDVIMLQPTGDKVLGLIGKDVTPKGIIEPAQMAAAIQALADAVAVDDAARARAASGGQADTEEAAAGARDKISLRQRVWPLVEMMKRAQGADEPITWGV

Samples

Sample ID Description Type Environment
1 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
2 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
106 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
107 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
108 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
109 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
148 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
149 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
150 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
151 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
152 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
153 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
154 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
155 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
156 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
157 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
166 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
167 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
168 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
169 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
170 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
171 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.91
Nodule 0
Rhizoplane 2.13
Rhizosphere 81.7
Stem 0
Stem Tuber 0
Unclassified 4.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10097385 3300003316 Bacteria 1221
2 rootH2_10038579 3300003320 Bacteria 1240
3 rootL2_10176069 3300003322 Bacteria 2021
4 Ga0070676_10257501 3300005328 Bacteria 1167
5 Ga0070690_100528914 3300005330 Bacteria 886
6 Ga0068869_100217947 3300005334 Bacteria 1511
7 Ga0070661_100362790 3300005344 Bacteria 1139
8 Ga0070668_100082817 3300005347 Bacteria 2517
9 Ga0070675_101706590 3300005354 Bacteria 581
10 Ga0070671_100593016 3300005355 Bacteria 957
11 Ga0070674_100231167 3300005356 Bacteria 1443
12 Ga0070674_101082722 3300005356 Bacteria 707
13 Ga0070667_100479063 3300005367 Bacteria 1139
14 Ga0070700_100014555 3300005441 Bacteria 4443
15 Ga0070708_101587103 3300005445 Bacteria 609
16 Ga0070663_100760177 3300005455 Bacteria 828
17 Ga0070678_100102186 3300005456 Bacteria 2224
18 Ga0070678_100821807 3300005456 Bacteria 845
19 Ga0068867_100020712 3300005459 Bacteria 4687
20 Ga0068867_100052071 3300005459 Bacteria 3020
21 Ga0068867_100160757 3300005459 Bacteria 1771
22 Ga0068867_101017821 3300005459 Bacteria 752
23 Ga0068867_101582546 3300005459 Bacteria 612
24 Ga0070706_100031098 3300005467 Bacteria 4923
25 Ga0070707_100531452 3300005468 Bacteria 1138
26 Ga0070699_101481392 3300005518 Bacteria 622
27 Ga0070686_100845098 3300005544 Bacteria 741
28 Ga0070665_101540692 3300005548 Bacteria 673
29 Ga0068854_100133072 3300005578 Bacteria 1901
30 Ga0068859_101490370 3300005617 Bacteria 747
31 Ga0068866_10002740 3300005718 Bacteria 7264
32 Ga0068866_10490360 3300005718 Bacteria 811
33 Ga0068866_10906702 3300005718 Bacteria 620
34 Ga0068861_100005508 3300005719 Bacteria 8577
35 Ga0068861_100635358 3300005719 Bacteria 984
36 Ga0068863_100099353 3300005841 Bacteria 2765
37 Ga0068858_100520024 3300005842 Bacteria 1151
38 Ga0068860_100017835 3300005843 Bacteria 6913
39 Ga0068860_100166371 3300005843 Bacteria 2129
40 Ga0068862_100002626 3300005844 Bacteria 15828
41 Ga0068862_100032603 3300005844 Bacteria 4402
42 Ga0068862_100035259 3300005844 Bacteria 4235
43 Ga0075368_10105209 3300006042 Bacteria 1161
44 Ga0075363_100221748 3300006048 Bacteria 1084
45 Ga0075366_10010694 3300006195 Bacteria 5158
46 Ga0075366_10025447 3300006195 Bacteria 3457
47 Ga0075366_10049812 3300006195 Bacteria 2486
48 Ga0075366_10068193 3300006195 Bacteria 2117
49 Ga0075366_10324781 3300006195 Bacteria 943
50 Ga0075366_10990908 3300006195 Bacteria 524
51 Ga0097621_101626954 3300006237 Bacteria 614
52 Ga0075370_10040634 3300006353 Bacteria 2624
53 Ga0075370_10263242 3300006353 Bacteria 1023
54 Ga0075370_10826070 3300006353 Bacteria 565
55 Ga0068871_101057102 3300006358 Bacteria 758
56 Ga0075430_100449790 3300006846 Bacteria 1063
57 Ga0075429_100006177 3300006880 Bacteria 10353
58 Ga0068865_100050852 3300006881 Bacteria 2865
59 Ga0097620_101490308 3300006931 Bacteria 747
60 Ga0105245_12748401 3300009098 Bacteria 545
61 Ga0105247_10423116 3300009101 Bacteria 954
62 Ga0105243_10014728 3300009148 Bacteria 5915
63 Ga0105243_10020108 3300009148 Bacteria 5061
64 Ga0105243_10353300 3300009148 Bacteria 1350
65 Ga0105242_10337409 3300009176 Bacteria 1388
66 Ga0105242_11024136 3300009176 Bacteria 835
67 Ga0105249_10017892 3300009553 Bacteria 6297
68 Ga0105249_10293441 3300009553 Bacteria 1628
69 Ga0105249_10623052 3300009553 Bacteria 1135
70 Ga0157374_10010932 3300013296 Bacteria 7836
71 Ga0157378_10003330 3300013297 Bacteria 14290
72 Ga0157378_10141586 3300013297 Bacteria 2234
73 Ga0163162_10005003 3300013306 Bacteria 12767
74 Ga0157375_10062210 3300013308 Bacteria 3708
75 Ga0157380_10061404 3300014326 Bacteria 3007
76 Ga0157380_10063579 3300014326 Bacteria 2960
77 Ga0157379_10029042 3300014968 Bacteria 4917
78 Ga0157379_10532529 3300014968 Bacteria 1091
79 Ga0157376_11225180 3300014969 Bacteria 779
80 Ga0163161_10080670 3300017792 Bacteria 2395
81 Ga0207682_10266201 3300025893 Bacteria 800
82 Ga0207642_10016280 3300025899 Bacteria 2796
83 Ga0207642_10610665 3300025899 Bacteria 680
84 Ga0207680_10573993 3300025903 Bacteria 806
85 Ga0207645_10270625 3300025907 Bacteria 1126
86 Ga0207684_10033806 3300025910 Bacteria 4349
87 Ga0207681_10303439 3300025923 Bacteria 1264
88 Ga0207659_11324653 3300025926 Bacteria 618
89 Ga0207687_10696352 3300025927 Bacteria 862
90 Ga0207686_10211559 3300025934 Bacteria 1394
91 Ga0207686_11031640 3300025934 Bacteria 668
92 Ga0207709_10014331 3300025935 Bacteria 4376
93 Ga0207709_10076087 3300025935 Bacteria 2148
94 Ga0207709_10229289 3300025935 Bacteria 1344
95 Ga0207669_10197093 3300025937 Bacteria 1458
96 Ga0207669_11284442 3300025937 Bacteria 621
97 Ga0207669_11407238 3300025937 Bacteria 594
98 Ga0207704_10003481 3300025938 Bacteria 7159
99 Ga0207691_10044864 3300025940 Bacteria 4067
100 Ga0207689_10533235 3300025942 Bacteria 985
101 Ga0207712_10165533 3300025961 Bacteria 1723
102 Ga0207712_10334836 3300025961 Bacteria 1253
103 Ga0207712_10713194 3300025961 Bacteria 876
104 Ga0207640_10277022 3300025981 Bacteria 1315
105 Ga0207658_10347072 3300025986 Bacteria 1291
106 Ga0207677_11088399 3300026023 Bacteria 728
107 Ga0207703_10623719 3300026035 Bacteria 1021
108 Ga0207703_10685778 3300026035 Bacteria 974
109 Ga0207678_10984854 3300026067 Bacteria 746
110 Ga0207708_10013014 3300026075 Bacteria 6207
111 Ga0207648_10000419 3300026089 Bacteria 46680
112 Ga0207648_10134465 3300026089 Bacteria 2178
113 Ga0207648_10414866 3300026089 Bacteria 1222
114 Ga0207648_11360362 3300026089 Bacteria 667
115 Ga0207675_100000693 3300026118 Bacteria 33301
116 Ga0207675_100516870 3300026118 Bacteria 1190
117 Ga0207683_10124817 3300026121 Bacteria 2313
118 Ga0209813_10100745 3300027866 Bacteria 982
119 Ga0268266_11656676 3300028379 Bacteria 615
120 Ga0268265_10013134 3300028380 Bacteria 5626
121 Ga0268265_10014510 3300028380 Bacteria 5370
122 Ga0268265_10163438 3300028380 Bacteria 1894
123 Ga0268264_10039249 3300028381 Bacteria 3912
124 Ga0268264_10102470 3300028381 Bacteria 2491
125 Ga0307515_10016911 3300028794 Bacteria 13333
126 Ga0307509_10330607 3300031507 Bacteria 1256
127 Ga0307408_100323312 3300031548 Bacteria 1300
128 Ga0307516_10000952 3300031730 Bacteria 39918
129 Ga0307516_10048497 3300031730 Bacteria 4179
130 Ga0307413_10603175 3300031824 Bacteria 899
131 Ga0307410_10168777 3300031852 Bacteria 1647
132 Ga0307406_10195078 3300031901 Bacteria 1486
133 Ga0307407_10419920 3300031903 Bacteria 964
134 Ga0307409_102216214 3300031995 Bacteria 579
135 Ga0307416_100090220 3300032002 Bacteria 2627
136 Ga0307414_10777918 3300032004 Bacteria 872
137 Ga0307415_101885323 3300032126 Bacteria 580
138 Ga0307510_10001950 3300033180 Bacteria 23220
139 Ga0373960_0440518 3300035121 Bacteria 509
140 Ga0373931_0788624 3300035691 Bacteria 633
141 Ga0373927_0231267 3300035695 Bacteria 1215
142 Ga0373937_0076404 3300036401 Bacteria 3093
143 Ga0373925_0014382 3300037068 Bacteria 5723
144 Ga0395900_0001308 3300037418 Bacteria 30266
145 Ga0395898_0002912 3300037466 Bacteria 19475
146 Ga0395898_0732779 3300037466 Bacteria 930
147 Ga0395905_0005907 3300037471 Bacteria 12410
148 Ga0395905_0283609 3300037471 Bacteria 1543
149 Ga0395905_1701497 3300037471 Bacteria 536
150 Ga0439461_0093152 3300041410 Bacteria 725
151 Ga0450919_000090 3300042121 Bacteria 8867
152 Ga0450920_010130 3300042122 Bacteria 1745
153 Ga0439446_0128593 3300042156 Bacteria 820
154 Ga0450918_000050 3300042531 Bacteria 24454
155 Ga0451577_0015259 3300042876 Bacteria 7149
156 Ga0451577_0112030 3300042876 Bacteria 2442
157 Ga0451577_0737522 3300042876 Bacteria 891
158 Ga0466969_0059329 3300044656 Bacteria 1860
159 Ga0466965_0008073 3300044683 Bacteria 4862
160 Ga0466966_0002245 3300044684 Bacteria 12580
161 Ga0466966_0240923 3300044684 Bacteria 1090
162 Ga0466961_0001917 3300044693 Bacteria 12957
163 Ga0466961_0055885 3300044693 Bacteria 2515
164 Ga0466963_0809731 3300044694 Bacteria 660
165 Ga0466964_0014157 3300044706 Bacteria 3030
166 Ga0466964_0065099 3300044706 Bacteria 1526
167 Ga0453684_0227398 3300044712 Bacteria 2156
168 Ga0453684_0634857 3300044712 Unclassified 1167
169 Ga0466971_0262389 3300044719 Bacteria 824
170 Ga0466968_0095284 3300044735 Bacteria 1324
171 Ga0466970_0100048 3300044765 Bacteria 1578
172 Ga0466957_0121783 3300044842 Bacteria 1663
173 Ga0466957_0462501 3300044842 Bacteria 875
174 Ga0466959_0000132 3300045049 Bacteria 48490
175 Ga0466959_0055489 3300045049 Bacteria 2892
176 Ga0451576_0000114 3300045051 Bacteria 208462
177 Ga0451576_0071004 3300045051 Bacteria 3624
178 Ga0466958_0101781 3300045836 Bacteria 1786
179 Ga0466967_0185061 3300045976 Bacteria 1967
180 Ga0495650_0004342 3300046471 Bacteria 9773
181 Ga0495618_0113019 3300046514 Bacteria 1739
182 Ga0495643_0062955 3300046522 Bacteria 1963
183 Ga0495658_0019652 3300046683 Bacteria 3529
184 Ga0495686_0001272 3300047472 Bacteria 28580
185 Ga0495686_0114721 3300047472 Bacteria 1612
186 Ga0496102_0027006 3300048905 Bacteria 5126
187 Ga0496104_0142657 3300048907 Bacteria 2301
188 Ga0496105_0371325 3300048908 Unclassified 1139
189 Ga0496106_0040494 3300048909 Bacteria 3490
190 Ga0496113_0112344 3300048916 Bacteria 2122
191 Ga0501298_083485 3300049521 Bacteria 706
192 Ga0501032_0291326 3300049569 Bacteria 1056
193 Ga0501034_1664300 3300049571 Bacteria 511
194 Ga0501042_1355612 3300049578 Bacteria 519
195 Ga0501043_0000277 3300049579 Bacteria 46284
196 Ga0501046_0000345 3300049580 Bacteria 46730
197 Ga0501047_0000395 3300049581 Bacteria 48969
198 Ga0501048_0000111 3300049582 Bacteria 46009
199 Ga0501067_0383960 3300049583 Bacteria 783
200 Ga0501071_0653799 3300049587 Bacteria 809
201 Ga0501075_0455401 3300049591 Bacteria 976
202 Ga0501198_000023 3300049649 Bacteria 69100
203 Ga0501206_004296 3300049653 Bacteria 1811
204 Ga0501207_014093 3300049654 Bacteria 1217
205 Ga0501222_000031 3300049662 Bacteria 56867
206 Ga0501239_077718 3300049672 Bacteria 527
207 Ga0501253_013192 3300049683 Bacteria 1311
208 Ga0501257_016938 3300049686 Bacteria 1693
209 Ga0501221_259582 3300049704 Bacteria 502
210 Ga0501262_013596 3300049759 Bacteria 1051
211 Ga0501265_010813 3300049762 Bacteria 1119
212 Ga0501276_006621 3300049773 Bacteria 915
213 Ga0501045_0025746 3300049824 Bacteria 4230
214 nmdc:mga03n38_133599_c1 3300050490 Bacteria 1232
215 nmdc:mga0k408_249378_c1 3300050493 Bacteria 1060
216 nmdc:mga0k408_28834_c1 3300050493 Bacteria 3157
217 nmdc:mga0k408_43192_c1 3300050493 Bacteria 2597
218 nmdc:mga0k408_739661_c1 3300050493 Unclassified 575
219 nmdc:mga0k408_9843_c1 3300050493 Bacteria 5161
220 nmdc:mga04h51_119250_c1 3300050495 Bacteria 981
221 nmdc:mga07m45_31539_c1 3300050496 Bacteria 2937
222 nmdc:mga07m45_42791_c1 3300050496 Bacteria 2540
223 nmdc:mga07m45_70231_c1 3300050496 Bacteria 1992
224 nmdc:mga09592_1109_c1 3300050508 Bacteria 21409
225 nmdc:mga0qj67_1019411_c1 3300050509 Bacteria 649
226 Ga0500578_0033348 3300053086 Bacteria 3309
227 Ga0500593_000267 3300053117 Bacteria 21261
228 Ga0500652_281474 3300053131 Bacteria 649
229 Ga0500559_0001012 3300053136 Bacteria 17282
230 Ga0500636_0499980 3300053177 Bacteria 537
231 Ga0500645_001890 3300053730 Bacteria 9999
232 Ga0590075_058455 3300059424 Bacteria 993
233 Ga0466962_0003827 3300061719 Bacteria 7192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046514 Ga0495618_0113019 Ga0495618_0113019_870_1133 64
2 3300006353 Ga0075370_10263242 Ga0075370_102632422 79
3 3300050496 nmdc:mga07m45_70231_c1 nmdc:mga07m45_70231_c1_1012_1350 79
4 3300044656 Ga0466969_0059329 Ga0466969_0059329_912_1238 82
5 3300044683 Ga0466965_0008073 Ga0466965_0008073_4395_4721 82
6 3300044684 Ga0466966_0240923 Ga0466966_0240923_347_673 82
7 3300044693 Ga0466961_0055885 Ga0466961_0055885_958_1284 82
8 3300044706 Ga0466964_0065099 Ga0466964_0065099_892_1218 82
9 3300044719 Ga0466971_0262389 Ga0466971_0262389_242_568 82
10 3300044735 Ga0466968_0095284 Ga0466968_0095284_803_1129 82
11 3300044842 Ga0466957_0462501 Ga0466957_0462501_408_734 82
12 3300045049 Ga0466959_0055489 Ga0466959_0055489_1136_1462 82
13 3300045051 Ga0451576_0000114 Ga0451576_0000114_23677_23985 82
14 3300045976 Ga0466967_0185061 Ga0466967_0185061_696_1022 82
15 3300061719 Ga0466962_0003827 Ga0466962_0003827_6478_6804 82
16 3300005328 Ga0070676_10257501 Ga0070676_102575012 84
17 3300005330 Ga0070690_100528914 Ga0070690_1005289141 84
18 3300005334 Ga0068869_100217947 Ga0068869_1002179471 84
19 3300005347 Ga0070668_100082817 Ga0070668_1000828173 84
20 3300005355 Ga0070671_100593016 Ga0070671_1005930162 84
21 3300005356 Ga0070674_101082722 Ga0070674_1010827222 84
22 3300005367 Ga0070667_100479063 Ga0070667_1004790632 84
23 3300005441 Ga0070700_100014555 Ga0070700_1000145552 84
24 3300005455 Ga0070663_100760177 Ga0070663_1007601772 84
25 3300005456 Ga0070678_100102186 Ga0070678_1001021862 84
26 3300005456 Ga0070678_100821807 Ga0070678_1008218072 84
27 3300005459 Ga0068867_100020712 Ga0068867_1000207122 84
28 3300005459 Ga0068867_100160757 Ga0068867_1001607571 84
29 3300005459 Ga0068867_101017821 Ga0068867_1010178212 84
30 3300005518 Ga0070699_101481392 Ga0070699_1014813921 84
31 3300005544 Ga0070686_100845098 Ga0070686_1008450982 84
32 3300005617 Ga0068859_101490370 Ga0068859_1014903702 84
33 3300005718 Ga0068866_10002740 Ga0068866_100027409 84
34 3300005718 Ga0068866_10906702 Ga0068866_109067022 84
35 3300005719 Ga0068861_100005508 Ga0068861_1000055087 84
36 3300005719 Ga0068861_100635358 Ga0068861_1006353582 84
37 3300005841 Ga0068863_100099353 Ga0068863_1000993532 84
38 3300005842 Ga0068858_100520024 Ga0068858_1005200242 84
39 3300005843 Ga0068860_100017835 Ga0068860_1000178353 84
40 3300005843 Ga0068860_100166371 Ga0068860_1001663713 84
41 3300005844 Ga0068862_100002626 Ga0068862_1000026262 84
42 3300005844 Ga0068862_100032603 Ga0068862_1000326032 84
43 3300005844 Ga0068862_100035259 Ga0068862_1000352593 84
44 3300006195 Ga0075366_10025447 Ga0075366_100254473 84
45 3300006195 Ga0075366_10324781 Ga0075366_103247812 84
46 3300006195 Ga0075366_10990908 Ga0075366_109909082 84
47 3300006237 Ga0097621_101626954 Ga0097621_1016269541 84
48 3300006358 Ga0068871_101057102 Ga0068871_1010571022 84
49 3300006846 Ga0075430_100449790 Ga0075430_1004497902 84
50 3300006881 Ga0068865_100050852 Ga0068865_1000508522 84
51 3300006931 Ga0097620_101490308 Ga0097620_1014903082 84
52 3300009098 Ga0105245_12748401 Ga0105245_127484012 84
53 3300009101 Ga0105247_10423116 Ga0105247_104231162 84
54 3300009148 Ga0105243_10020108 Ga0105243_100201086 84
55 3300009148 Ga0105243_10353300 Ga0105243_103533003 84
56 3300009176 Ga0105242_10337409 Ga0105242_103374093 84
57 3300009553 Ga0105249_10017892 Ga0105249_100178923 84
58 3300009553 Ga0105249_10293441 Ga0105249_102934412 84
59 3300009553 Ga0105249_10623052 Ga0105249_106230522 84
60 3300013297 Ga0157378_10003330 Ga0157378_100033302 84
61 3300013306 Ga0163162_10005003 Ga0163162_100050039 84
62 3300013308 Ga0157375_10062210 Ga0157375_100622102 84
63 3300014326 Ga0157380_10061404 Ga0157380_100614042 84
64 3300014968 Ga0157379_10029042 Ga0157379_100290423 84
65 3300014968 Ga0157379_10532529 Ga0157379_105325292 84
66 3300014969 Ga0157376_11225180 Ga0157376_112251802 84
67 3300017792 Ga0163161_10080670 Ga0163161_100806703 84
68 3300025899 Ga0207642_10016280 Ga0207642_100162803 84
69 3300025899 Ga0207642_10610665 Ga0207642_106106652 84
70 3300025903 Ga0207680_10573993 Ga0207680_105739932 84
71 3300025907 Ga0207645_10270625 Ga0207645_102706252 84
72 3300025923 Ga0207681_10303439 Ga0207681_103034392 84
73 3300025927 Ga0207687_10696352 Ga0207687_106963522 84
74 3300025934 Ga0207686_10211559 Ga0207686_102115592 84
75 3300025935 Ga0207709_10076087 Ga0207709_100760871 84
76 3300025935 Ga0207709_10229289 Ga0207709_102292892 84
77 3300025937 Ga0207669_11284442 Ga0207669_112844422 84
78 3300025938 Ga0207704_10003481 Ga0207704_100034818 84
79 3300025940 Ga0207691_10044864 Ga0207691_100448641 84
80 3300025942 Ga0207689_10533235 Ga0207689_105332352 84
81 3300025961 Ga0207712_10165533 Ga0207712_101655333 84
82 3300025961 Ga0207712_10334836 Ga0207712_103348362 84
83 3300025961 Ga0207712_10713194 Ga0207712_107131942 84
84 3300025986 Ga0207658_10347072 Ga0207658_103470722 84
85 3300026035 Ga0207703_10623719 Ga0207703_106237192 84
86 3300026035 Ga0207703_10685778 Ga0207703_106857782 84
87 3300026067 Ga0207678_10984854 Ga0207678_109848542 84
88 3300026075 Ga0207708_10013014 Ga0207708_100130143 84
89 3300026089 Ga0207648_10000419 Ga0207648_1000041935 84
90 3300026089 Ga0207648_10134465 Ga0207648_101344652 84
91 3300026118 Ga0207675_100000693 Ga0207675_10000069313 84
92 3300026118 Ga0207675_100516870 Ga0207675_1005168702 84
93 3300026121 Ga0207683_10124817 Ga0207683_101248172 84
94 3300028380 Ga0268265_10013134 Ga0268265_100131343 84
95 3300028380 Ga0268265_10014510 Ga0268265_100145108 84
96 3300028380 Ga0268265_10163438 Ga0268265_101634382 84
97 3300028381 Ga0268264_10039249 Ga0268264_100392494 84
98 3300028381 Ga0268264_10102470 Ga0268264_101024702 84
99 3300031824 Ga0307413_10603175 Ga0307413_106031752 84
100 3300031903 Ga0307407_10419920 Ga0307407_104199201 84
101 3300035691 Ga0373931_0788624 Ga0373931_0788624_51_338 84
102 3300041410 Ga0439461_0093152 Ga0439461_0093152_291_599 84
103 3300046471 Ga0495650_0004342 Ga0495650_0004342_5332_5631 84
104 3300049578 Ga0501042_1355612 Ga0501042_1355612_171_461 84
105 3300049583 Ga0501067_0383960 Ga0501067_0383960_159_446 84
106 3300049587 Ga0501071_0653799 Ga0501071_0653799_117_407 84
107 3300049591 Ga0501075_0455401 Ga0501075_0455401_383_673 84
108 3300050493 nmdc:mga0k408_249378_c1 nmdc:mga0k408_249378_c1_732_1019 84
109 3300050493 nmdc:mga0k408_28834_c1 nmdc:mga0k408_28834_c1_1509_1796 84
110 3300050509 nmdc:mga0qj67_1019411_c1 nmdc:mga0qj67_1019411_c1_221_505 84
111 3300005468 Ga0070707_100531452 Ga0070707_1005314522 85
112 3300028794 Ga0307515_10016911 Ga0307515_100169115 85
113 3300031730 Ga0307516_10000952 Ga0307516_1000095212 85
114 3300042156 Ga0439446_0128593 Ga0439446_0128593_281_589 85
115 3300042876 Ga0451577_0015259 Ga0451577_0015259_1117_1473 85
116 3300044712 Ga0453684_0634857 Ga0453684_0634857_703_1059 85
117 3300048916 Ga0496113_0112344 Ga0496113_0112344_1270_1602 85
118 iso_pu_bacteria 2643221644 2644247264 85
119 iso_pu_bacteria 2643221654 2644303521 85
120 3300003322 rootL2_10176069 rootL2_101760692 86
121 3300003320 rootH2_10038579 rootH2_100385792 87
122 3300006195 Ga0075366_10068193 Ga0075366_100681932 87
123 3300050493 nmdc:mga0k408_739661_c1 nmdc:mga0k408_739661_c1_57_365 87
124 3300005354 Ga0070675_101706590 Ga0070675_1017065902 88
125 3300005356 Ga0070674_100231167 Ga0070674_1002311672 88
126 3300005445 Ga0070708_101587103 Ga0070708_1015871032 88
127 3300005459 Ga0068867_101582546 Ga0068867_1015825461 88
128 3300013296 Ga0157374_10010932 Ga0157374_100109327 88
129 3300025926 Ga0207659_11324653 Ga0207659_113246532 88
130 3300025937 Ga0207669_10197093 Ga0207669_101970932 88
131 3300026089 Ga0207648_11360362 Ga0207648_113603622 88
132 3300031730 Ga0307516_10048497 Ga0307516_100484973 88
133 3300037471 Ga0395905_1701497 Ga0395905_1701497_76_402 88
134 3300042121 Ga0450919_000090 Ga0450919_000090_3630_3950 88
135 3300042122 Ga0450920_010130 Ga0450920_010130_157_477 88
136 3300042531 Ga0450918_000050 Ga0450918_000050_17748_18068 88
137 3300042876 Ga0451577_0112030 Ga0451577_0112030_1550_1864 88
138 3300042876 Ga0451577_0737522 Ga0451577_0737522_486_812 88
139 3300044712 Ga0453684_0227398 Ga0453684_0227398_546_860 88
140 3300045051 Ga0451576_0071004 Ga0451576_0071004_1039_1353 88
141 3300047472 Ga0495686_0001272 Ga0495686_0001272_22062_22385 88
142 3300048907 Ga0496104_0142657 Ga0496104_0142657_25_342 88
143 3300048908 Ga0496105_0371325 Ga0496105_0371325_61_378 88
144 3300049571 Ga0501034_1664300 Ga0501034_1664300_110_436 88
145 3300059424 Ga0590075_058455 Ga0590075_058455_208_528 88
146 3300003316 rootH1_10097385 rootH1_100973852 89
147 3300005344 Ga0070661_100362790 Ga0070661_1003627901 89
148 3300005459 Ga0068867_100052071 Ga0068867_1000520713 89
149 3300005467 Ga0070706_100031098 Ga0070706_1000310982 89
150 3300005548 Ga0070665_101540692 Ga0070665_1015406922 89
151 3300005578 Ga0068854_100133072 Ga0068854_1001330722 89
152 3300005718 Ga0068866_10490360 Ga0068866_104903602 89
153 3300006042 Ga0075368_10105209 Ga0075368_101052092 89
154 3300006048 Ga0075363_100221748 Ga0075363_1002217482 89
155 3300006195 Ga0075366_10010694 Ga0075366_100106944 89
156 3300006195 Ga0075366_10049812 Ga0075366_100498123 89
157 3300006353 Ga0075370_10040634 Ga0075370_100406344 89
158 3300006353 Ga0075370_10826070 Ga0075370_108260702 89
159 3300006880 Ga0075429_100006177 Ga0075429_1000061775 89
160 3300009148 Ga0105243_10014728 Ga0105243_100147284 89
161 3300009176 Ga0105242_11024136 Ga0105242_110241362 89
162 3300013297 Ga0157378_10141586 Ga0157378_101415862 89
163 3300014326 Ga0157380_10063579 Ga0157380_100635792 89
164 3300025893 Ga0207682_10266201 Ga0207682_102662012 89
165 3300025910 Ga0207684_10033806 Ga0207684_100338061 89
166 3300025934 Ga0207686_11031640 Ga0207686_110316402 89
167 3300025935 Ga0207709_10014331 Ga0207709_100143314 89
168 3300025937 Ga0207669_11407238 Ga0207669_114072382 89
169 3300025981 Ga0207640_10277022 Ga0207640_102770222 89
170 3300026023 Ga0207677_11088399 Ga0207677_110883992 89
171 3300026089 Ga0207648_10414866 Ga0207648_104148662 89
172 3300027866 Ga0209813_10100745 Ga0209813_101007452 89
173 3300028379 Ga0268266_11656676 Ga0268266_116566762 89
174 3300031507 Ga0307509_10330607 Ga0307509_103306072 89
175 3300031548 Ga0307408_100323312 Ga0307408_1003233122 89
176 3300031852 Ga0307410_10168777 Ga0307410_101687773 89
177 3300031901 Ga0307406_10195078 Ga0307406_101950783 89
178 3300031995 Ga0307409_102216214 Ga0307409_1022162142 89
179 3300032002 Ga0307416_100090220 Ga0307416_1000902202 89
180 3300032004 Ga0307414_10777918 Ga0307414_107779182 89
181 3300032126 Ga0307415_101885323 Ga0307415_1018853231 89
182 3300033180 Ga0307510_10001950 Ga0307510_100019507 89
183 3300035121 Ga0373960_0440518 Ga0373960_0440518_170_493 89
184 3300035695 Ga0373927_0231267 Ga0373927_0231267_413_742 89
185 3300036401 Ga0373937_0076404 Ga0373937_0076404_1319_1642 89
186 3300037068 Ga0373925_0014382 Ga0373925_0014382_1678_2007 89
187 3300037418 Ga0395900_0001308 Ga0395900_0001308_18058_18384 89
188 3300037466 Ga0395898_0002912 Ga0395898_0002912_6946_7272 89
189 3300037466 Ga0395898_0732779 Ga0395898_0732779_337_660 89
190 3300037471 Ga0395905_0005907 Ga0395905_0005907_4665_4988 89
191 3300037471 Ga0395905_0283609 Ga0395905_0283609_743_1066 89
192 3300044684 Ga0466966_0002245 Ga0466966_0002245_11891_12217 89
193 3300044693 Ga0466961_0001917 Ga0466961_0001917_1929_2255 89
194 3300044694 Ga0466963_0809731 Ga0466963_0809731_267_593 89
195 3300044706 Ga0466964_0014157 Ga0466964_0014157_910_1236 89
196 3300044765 Ga0466970_0100048 Ga0466970_0100048_338_664 89
197 3300044842 Ga0466957_0121783 Ga0466957_0121783_1209_1535 89
198 3300045049 Ga0466959_0000132 Ga0466959_0000132_9709_10035 89
199 3300045836 Ga0466958_0101781 Ga0466958_0101781_810_1136 89
200 3300046522 Ga0495643_0062955 Ga0495643_0062955_998_1321 89
201 3300046683 Ga0495658_0019652 Ga0495658_0019652_695_1018 89
202 3300047472 Ga0495686_0114721 Ga0495686_0114721_968_1291 89
203 3300048905 Ga0496102_0027006 Ga0496102_0027006_439_750 89
204 3300048909 Ga0496106_0040494 Ga0496106_0040494_1741_2064 89
205 3300049521 Ga0501298_083485 Ga0501298_083485_301_624 89
206 3300049569 Ga0501032_0291326 Ga0501032_0291326_273_596 89
207 3300049579 Ga0501043_0000277 Ga0501043_0000277_12276_12599 89
208 3300049580 Ga0501046_0000345 Ga0501046_0000345_34132_34455 89
209 3300049581 Ga0501047_0000395 Ga0501047_0000395_12276_12599 89
210 3300049582 Ga0501048_0000111 Ga0501048_0000111_12226_12549 89
211 3300049649 Ga0501198_000023 Ga0501198_000023_41834_42157 89
212 3300049653 Ga0501206_004296 Ga0501206_004296_549_872 89
213 3300049654 Ga0501207_014093 Ga0501207_014093_194_517 89
214 3300049662 Ga0501222_000031 Ga0501222_000031_26960_27283 89
215 3300049672 Ga0501239_077718 Ga0501239_077718_40_363 89
216 3300049683 Ga0501253_013192 Ga0501253_013192_838_1161 89
217 3300049686 Ga0501257_016938 Ga0501257_016938_1225_1548 89
218 3300049704 Ga0501221_259582 Ga0501221_259582_39_362 89
219 3300049759 Ga0501262_013596 Ga0501262_013596_681_1004 89
220 3300049762 Ga0501265_010813 Ga0501265_010813_671_994 89
221 3300049773 Ga0501276_006621 Ga0501276_006621_68_391 89
222 3300049824 Ga0501045_0025746 Ga0501045_0025746_3588_3911 89
223 3300050490 nmdc:mga03n38_133599_c1 nmdc:mga03n38_133599_c1_477_800 89
224 3300050493 nmdc:mga0k408_43192_c1 nmdc:mga0k408_43192_c1_574_897 89
225 3300050493 nmdc:mga0k408_9843_c1 nmdc:mga0k408_9843_c1_1213_1536 89
226 3300050495 nmdc:mga04h51_119250_c1 nmdc:mga04h51_119250_c1_465_788 89
227 3300050496 nmdc:mga07m45_31539_c1 nmdc:mga07m45_31539_c1_1911_2234 89
228 3300050496 nmdc:mga07m45_42791_c1 nmdc:mga07m45_42791_c1_2136_2459 89
229 3300050508 nmdc:mga09592_1109_c1 nmdc:mga09592_1109_c1_6404_6727 89
230 3300053086 Ga0500578_0033348 Ga0500578_0033348_2894_3217 89
231 3300053117 Ga0500593_000267 Ga0500593_000267_7806_8123 89
232 3300053131 Ga0500652_281474 Ga0500652_281474_280_603 89
233 3300053136 Ga0500559_0001012 Ga0500559_0001012_14438_14761 89
234 3300053177 Ga0500636_0499980 Ga0500636_0499980_49_372 89
235 3300053730 Ga0500645_001890 Ga0500645_001890_3343_3666 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08895

DUF1840

Domain of unknown function (DUF1840)

10

116

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jax-assembly1.cif.gz_A cryo-em structure of holo form of scbfr with o symmetry 0.8011 39 81
5hjf-assembly1.cif.gz_D the apo form of dps4 from nostoc punctiforme 0.7719 39 81
3qky-assembly1.cif.gz_A crystal structure of rhodothermus marinus bamd 0.7486 39 81
7dgu-assembly1.cif.gz_A de novo designed protein h4a1r 0.7186 39 82
3o4x-assembly2.cif.gz_F crystal structure of complex between amino and carboxy terminal fragments of mdia1 0.7002 39 81
ID Description Score Start End Superfamily
2w2uB00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8083 39 81 1.20.58.80
af_Q9BL83_2_86_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8008 39 81 1.20.58.80
af_A0A0R4IPK7_4_76_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.7989 39 81 1.20.58.80
af_Q9VKK1_1266_1354_1.10.220.100 Mainly Alpha;Orthogonal Bundle;Annexin V; domain 1;conserved c-terminal region of ge- 1 0.7935 39 81 1.10.220.100
af_P77453_7_135_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.783 33 89 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A6N8ITW3-F1-model_v4 DUF1840 family protein 0.9273 1 89
AF-A0A4S5BR63-F1-model_v4 DUF1840 domain-containing protein 0.9273 2 89
AF-A0A2T6JIU8-F1-model_v4 Cyclopropane-fatty-acyl-phospholipid synthase 0.927 1 89
AF-A0A177RKW2-F1-model_v4 deleted 0.9249 3 89
AF-A0A1Y0NBI2-F1-model_v4 DUF1840 domain-containing protein 0.9181 1 89

Feature Viewer

pLDDT pTM Quality
87.31 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map