F348335

General Info

Members Datasets Scaffolds Average Seq Length
235 165 470 212

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0245375|Ga0436363_0245375_292_963
Length 223
Sequence VTAESATLRSTTVSGDPAGAGVASTERGFYDPITASWMIKVLPGKFYITRRADEVIVTVLGSCVSACIRDVETGVGGMNHFMLASDAAGQWGADQQSTRYGNFAMERLINELIKAGCPRDRMEVKVFGGGNVTDTKNQIGTQNAEFVLRYLEDEGLACSAHDLGGPYPRRIQYFPSTGRVVRKLLTGGDRDTVAHEESEYAKGLTTKTTAGEVQMFTPIRRRP

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
65 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
68 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
69 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
78 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
92 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
93 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
94 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
95 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
100 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
134 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
135 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
136 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
137 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
138 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
139 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
140 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
149 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
150 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
151 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
152 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
153 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
154 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
155 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
156 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
157 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
158 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
159 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
162 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.43
Nodule 0
Rhizoplane 3.4
Rhizosphere 74.47
Stem 0
Stem Tuber 0
Unclassified 3.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0245375 3300039450 Bacteria 1447
2 Ga0068868_100004649 3300005338 Bacteria 9633
3 Ga0070689_100372852 3300005340 Unclassified 1201
4 Ga0070675_100492135 3300005354 Bacteria 1104
5 Ga0070673_100078488 3300005364 Bacteria 2671
6 Ga0070667_100502867 3300005367 Bacteria 1111
7 Ga0070667_101037890 3300005367 Bacteria 765
8 Ga0070714_100408814 3300005435 Bacteria 1284
9 Ga0070681_10612758 3300005458 Bacteria 1003
10 Ga0070698_100031651 3300005471 Bacteria 5484
11 Ga0070679_100178558 3300005530 Bacteria 2096
12 Ga0068853_100130407 3300005539 Bacteria 2250
13 Ga0070686_100155499 3300005544 Unclassified 1605
14 Ga0070702_100047295 3300005615 Bacteria 2443
15 Ga0068859_100154553 3300005617 Bacteria 2371
16 Ga0068859_100699850 3300005617 Unclassified 1104
17 Ga0068858_100063523 3300005842 Bacteria 3416
18 Ga0068860_100470106 3300005843 Bacteria 1252
19 Ga0068860_101140667 3300005843 Unclassified 799
20 Ga0081455_10004486 3300005937 Bacteria 15617
21 Ga0081455_10072761 3300005937 Bacteria 2844
22 Ga0081540_1017048 3300005983 Bacteria 4514
23 Ga0081539_10194868 3300005985 Unclassified 940
24 Ga0075365_10082920 3300006038 Bacteria 2175
25 Ga0075365_10397812 3300006038 Bacteria 972
26 Ga0075365_10505345 3300006038 Bacteria 854
27 Ga0075365_10536683 3300006038 Bacteria 827
28 Ga0075368_10040248 3300006042 Bacteria 1835
29 Ga0075368_10092205 3300006042 Bacteria 1239
30 Ga0075363_100003351 3300006048 Bacteria 6799
31 Ga0075363_100035929 3300006048 Bacteria 2596
32 Ga0070716_100285948 3300006173 Bacteria 1140
33 Ga0075362_10054796 3300006177 Bacteria 1793
34 Ga0075369_10000831 3300006186 Bacteria 10175
35 Ga0075366_10001203 3300006195 Bacteria 12835
36 Ga0075366_10203824 3300006195 Bacteria 1203
37 Ga0068871_100134739 3300006358 Bacteria 2097
38 Ga0075428_100477457 3300006844 Bacteria 1334
39 Ga0075430_100000011 3300006846 Bacteria 99671
40 Ga0075431_100144806 3300006847 Bacteria 2448
41 Ga0075431_100186797 3300006847 Bacteria 2125
42 Ga0075431_100293185 3300006847 Bacteria 1645
43 Ga0075431_100364489 3300006847 Bacteria 1451
44 Ga0075433_10263769 3300006852 Bacteria 1527
45 Ga0075434_100003000 3300006871 Bacteria 15016
46 Ga0075429_100193341 3300006880 Bacteria 1782
47 Ga0075429_100387263 3300006880 Bacteria 1224
48 Ga0097620_100154567 3300006931 Bacteria 2371
49 Ga0097620_100699737 3300006931 Unclassified 1104
50 Ga0099795_10016762 3300007788 Bacteria 2324
51 Ga0111539_10036388 3300009094 Bacteria 5952
52 Ga0105247_10430461 3300009101 Bacteria 947
53 Ga0114129_10049564 3300009147 Bacteria 5899
54 Ga0114129_10094780 3300009147 Bacteria 4134
55 Ga0114129_10401592 3300009147 Bacteria 1806
56 Ga0114129_10408924 3300009147 Bacteria 1787
57 Ga0114129_10528417 3300009147 Unclassified 1537
58 Ga0114129_10566060 3300009147 Bacteria 1476
59 Ga0105243_10628543 3300009148 Bacteria 1038
60 Ga0105248_10014693 3300009177 Bacteria 8616
61 Ga0105248_10249205 3300009177 Bacteria 1999
62 Ga0105238_10028426 3300009551 Bacteria 5697
63 Ga0105249_10080865 3300009553 Bacteria 3019
64 Ga0105249_10285681 3300009553 Bacteria 1649
65 Ga0105249_10557891 3300009553 Bacteria 1197
66 Ga0105249_10954408 3300009553 Bacteria 925
67 Ga0099796_10048915 3300010159 Bacteria 1460
68 Ga0105246_10033495 3300011119 Bacteria 3416
69 Ga0105246_10540472 3300011119 Bacteria 997
70 Ga0157378_10124157 3300013297 Bacteria 2383
71 Ga0163162_10011813 3300013306 Bacteria 8518
72 Ga0157380_10368043 3300014326 Bacteria 1351
73 Ga0157380_10434589 3300014326 Bacteria 1256
74 Ga0157379_10001542 3300014968 Bacteria 18940
75 Ga0157379_10092624 3300014968 Bacteria 2711
76 Ga0157376_10546222 3300014969 Bacteria 1146
77 Ga0163161_10530056 3300017792 Unclassified 963
78 Ga0209233_1018703 3300025261 Bacteria 1858
79 Ga0209758_1000559 3300025297 Bacteria 58686
80 Ga0207426_1023897 3300025302 Bacteria 2080
81 Ga0207660_10229981 3300025917 Bacteria 1458
82 Ga0207652_10304658 3300025921 Bacteria 1438
83 Ga0207694_10024495 3300025924 Bacteria 4584
84 Ga0207659_10535385 3300025926 Bacteria 994
85 Ga0207711_10052607 3300025941 Bacteria 3491
86 Ga0207651_10323358 3300025960 Bacteria 1290
87 Ga0207658_10147942 3300025986 Bacteria 1910
88 Ga0207677_10014959 3300026023 Bacteria 4548
89 Ga0207703_10076799 3300026035 Bacteria 2771
90 Ga0207639_10191126 3300026041 Bacteria 1749
91 Ga0265323_10010121 3300028653 Bacteria 3828
92 Ga0265330_10030818 3300031235 Bacteria 2406
93 Ga0265332_10000010 3300031238 Bacteria 289041
94 Ga0265320_10027891 3300031240 Bacteria 2938
95 Ga0265325_10031124 3300031241 Bacteria 2858
96 Ga0265329_10027936 3300031242 Bacteria 1852
97 Ga0265340_10028970 3300031247 Bacteria 2783
98 Ga0265327_10001346 3300031251 Bacteria 31869
99 Ga0265316_10344303 3300031344 Bacteria 1080
100 Ga0307509_10000407 3300031507 Bacteria 72359
101 Ga0265314_10000093 3300031711 Bacteria 136857
102 Ga0265314_10009591 3300031711 Bacteria 8153
103 Ga0307416_100415931 3300032002 Bacteria 1387
104 Ga0307411_10190735 3300032005 Bacteria 1565
105 Ga0316583_10006764 3300032133 Bacteria 4130
106 Ga0373928_0004832 3300035084 Bacteria 2569
107 Ga0373955_0168516 3300035172 Bacteria 1295
108 Ga0373931_0200782 3300035691 Bacteria 1191
109 Ga0373927_0044880 3300035695 Bacteria 2859
110 Ga0373937_0000549 3300036401 Bacteria 33333
111 Ga0373925_0047418 3300037068 Bacteria 3198
112 Ga0451577_0015009 3300042876 Bacteria 7207
113 Ga0451577_0090904 3300042876 Bacteria 2725
114 Ga0451577_0328452 3300042876 Bacteria 1387
115 Ga0466963_0015069 3300044694 Bacteria 4779
116 Ga0453684_0028184 3300044712 Bacteria 8025
117 Ga0466971_0114099 3300044719 Bacteria 1248
118 Ga0466959_0297371 3300045049 Bacteria 1106
119 Ga0451576_0012411 3300045051 Bacteria 9569
120 Ga0451576_0044556 3300045051 Bacteria 4677
121 Ga0466958_0281611 3300045836 Bacteria 1066
122 Ga0495582_0067028 3300046473 Bacteria 1983
123 Ga0495584_0066816 3300046491 Bacteria 1808
124 Ga0495609_0094121 3300046538 Bacteria 1302
125 Ga0495609_0124477 3300046538 Bacteria 1107
126 Ga0495611_0352019 3300046648 Bacteria 676
127 Ga0495659_0076494 3300046664 Bacteria 1263
128 Ga0495658_0011366 3300046683 Bacteria 4476
129 Ga0495669_0183178 3300046684 Bacteria 999
130 Ga0495613_0403489 3300046689 Bacteria 932
131 Ga0495671_0381864 3300046692 Bacteria 675
132 Ga0495581_0155448 3300047315 Bacteria 1337
133 Ga0495674_0262094 3300047319 Bacteria 1420
134 Ga0495672_0239187 3300047320 Bacteria 887
135 Ga0495684_0300159 3300047471 Bacteria 1154
136 Ga0495626_0131332 3300048091 Bacteria 1069
137 Ga0496102_0951482 3300048905 Bacteria 780
138 Ga0496104_0045344 3300048907 Bacteria 4134
139 Ga0496105_0584326 3300048908 Bacteria 869
140 Ga0496109_0067443 3300048912 Bacteria 3278
141 Ga0496112_0544194 3300048915 Bacteria 1095
142 Ga0496114_0780662 3300048917 Bacteria 834
143 Ga0496115_0223812 3300048918 Bacteria 1552
144 Ga0496115_0375580 3300048918 Bacteria 1157
145 Ga0496126_0076653 3300048929 Bacteria 2966
146 Ga0501031_0026637 3300049568 Bacteria 3768
147 Ga0501031_0204119 3300049568 Bacteria 1289
148 Ga0501032_0020702 3300049569 Bacteria 4579
149 Ga0501033_0005428 3300049570 Bacteria 10104
150 Ga0501033_0009903 3300049570 Bacteria 7318
151 Ga0501034_0022769 3300049571 Bacteria 6382
152 Ga0501034_0022891 3300049571 Bacteria 6365
153 Ga0501034_0163383 3300049571 Bacteria 2196
154 Ga0501034_0480144 3300049571 Bacteria 1158
155 Ga0501036_0011956 3300049572 Bacteria 7197
156 Ga0501036_0051561 3300049572 Bacteria 3484
157 Ga0501036_0118938 3300049572 Bacteria 2231
158 Ga0501037_0002313 3300049573 Bacteria 13767
159 Ga0501037_0122026 3300049573 Bacteria 1873
160 Ga0501038_0001971 3300049574 Bacteria 18956
161 Ga0501038_0010010 3300049574 Bacteria 8683
162 Ga0501038_0100148 3300049574 Bacteria 2415
163 Ga0501039_0022563 3300049575 Bacteria 4832
164 Ga0501043_0068608 3300049579 Bacteria 2784
165 Ga0501043_0101657 3300049579 Bacteria 2259
166 Ga0501046_0133468 3300049580 Bacteria 1882
167 Ga0501046_0467642 3300049580 Bacteria 906
168 Ga0501047_0004375 3300049581 Bacteria 13295
169 Ga0501047_0015954 3300049581 Bacteria 7162
170 Ga0501047_0039840 3300049581 Bacteria 4544
171 Ga0501047_0103659 3300049581 Bacteria 2725
172 Ga0501067_0029299 3300049583 Bacteria 3051
173 Ga0501068_0215910 3300049584 Bacteria 1218
174 Ga0501070_0000817 3300049586 Bacteria 28270
175 Ga0501070_0043373 3300049586 Bacteria 3743
176 Ga0501070_0280134 3300049586 Bacteria 1360
177 Ga0501070_0382131 3300049586 Bacteria 1141
178 Ga0501071_0164396 3300049587 Bacteria 1660
179 Ga0501073_0008249 3300049589 Bacteria 7726
180 Ga0501073_0025239 3300049589 Bacteria 4264
181 Ga0501080_0447940 3300049742 Bacteria 1158
182 Ga0501080_0677187 3300049742 Bacteria 911
183 Ga0501083_0002755 3300049744 Bacteria 12142
184 Ga0501083_0055279 3300049744 Bacteria 2662
185 Ga0501035_0001877 3300049822 Bacteria 21162
186 Ga0501035_0018077 3300049822 Bacteria 6496
187 Ga0501035_0059510 3300049822 Bacteria 3402
188 Ga0501044_0002322 3300049823 Bacteria 21677
189 nmdc:mga03683_939_c1 3300050489 Bacteria 8445
190 nmdc:mga03n38_4224_c1 3300050490 Bacteria 4726
191 nmdc:mga00v17_391631_c1 3300050491 Bacteria 903
192 nmdc:mga00v17_430790_c1 3300050491 Bacteria 857
193 nmdc:mga0yw44_255876_c1 3300050492 Bacteria 1166
194 nmdc:mga0yw44_258822_c1 3300050492 Bacteria 1159
195 nmdc:mga0yw44_58009_c1 3300050492 Bacteria 2364
196 nmdc:mga0yw44_65503_c1 3300050492 Bacteria 2239
197 nmdc:mga0k408_411310_c1 3300050493 Bacteria 805
198 nmdc:mga06z11_2069_c1 3300050494 Bacteria 7617
199 nmdc:mga06z11_400056_c1 3300050494 Bacteria 826
200 nmdc:mga04h51_252807_c1 3300050495 Bacteria 707
201 nmdc:mga07m45_318118_c1 3300050496 Bacteria 905
202 nmdc:mga05p37_76440_c1 3300050507 Bacteria 4123
203 nmdc:mga05p37_8436_c1 3300050507 Bacteria 12185
204 nmdc:mga09592_563378_c1 3300050508 Bacteria 978
205 nmdc:mga09592_590439_c1 3300050508 Bacteria 952
206 nmdc:mga0qj67_497_c1 3300050509 Bacteria 26795
207 nmdc:mga06r32_161301_c1 3300050510 Bacteria 2224
208 nmdc:mga08y16_150436_c1 3300050511 Bacteria 2420
209 nmdc:mga08y16_337857_c1 3300050511 Bacteria 1548
210 nmdc:mga0n895_17903_c1 3300050512 Bacteria 6545
211 nmdc:mga0a205_239503_c1 3300050515 Bacteria 1695
212 nmdc:mga0a205_89217_c1 3300050515 Bacteria 2980
213 nmdc:mga0sz30_9722_c1 3300050516 Bacteria 3667
214 Ga0500643_003604 3300053087 Bacteria 7354
215 Ga0500644_0001761 3300053088 Bacteria 5602
216 Ga0500651_0008230 3300053093 Bacteria 6123
217 Ga0500566_0016332 3300053094 Bacteria 4360
218 Ga0500641_0002769 3300053096 Bacteria 6200
219 Ga0500595_000006 3300053119 Bacteria 300857
220 Ga0500595_003760 3300053119 Bacteria 6990
221 Ga0500595_034317 3300053119 Bacteria 1679
222 Ga0500597_038636 3300053120 Bacteria 1999
223 Ga0500652_000004 3300053131 Bacteria 173428
224 Ga0500652_008509 3300053131 Bacteria 3424
225 Ga0500652_091558 3300053131 Bacteria 1270
226 Ga0500658_0013648 3300053134 Bacteria 3003
227 Ga0500568_0008955 3300053139 Bacteria 4786
228 Ga0500588_0186781 3300053146 Bacteria 764
229 Ga0500616_0000001 3300053153 Bacteria 1986011
230 Ga0500616_0040432 3300053153 Bacteria 2508
231 Ga0500636_0014381 3300053177 Bacteria 4655
232 Ga0500645_000650 3300053730 Bacteria 21950
233 Ga0501084_0115547 3300054114 Bacteria 2256
234 Ga0501082_0015112 3300060353 Bacteria 6651
235 2643757756 2643221547 Bacteria 4740017
236 Ga0436363_0245375
237 Ga0068868_100004649
238 Ga0070689_100372852
239 Ga0070675_100492135
240 Ga0070673_100078488
241 Ga0070667_100502867
242 Ga0070667_101037890
243 Ga0070714_100408814
244 Ga0070681_10612758
245 Ga0070698_100031651
246 Ga0070679_100178558
247 Ga0068853_100130407
248 Ga0070686_100155499
249 Ga0070702_100047295
250 Ga0068859_100154553
251 Ga0068859_100699850
252 Ga0068858_100063523
253 Ga0068860_100470106
254 Ga0068860_101140667
255 Ga0081455_10004486
256 Ga0081455_10072761
257 Ga0081540_1017048
258 Ga0081539_10194868
259 Ga0075365_10082920
260 Ga0075365_10397812
261 Ga0075365_10505345
262 Ga0075365_10536683
263 Ga0075368_10040248
264 Ga0075368_10092205
265 Ga0075363_100003351
266 Ga0075363_100035929
267 Ga0070716_100285948
268 Ga0075362_10054796
269 Ga0075369_10000831
270 Ga0075366_10001203
271 Ga0075366_10203824
272 Ga0068871_100134739
273 Ga0075428_100477457
274 Ga0075430_100000011
275 Ga0075431_100144806
276 Ga0075431_100186797
277 Ga0075431_100293185
278 Ga0075431_100364489
279 Ga0075433_10263769
280 Ga0075434_100003000
281 Ga0075429_100193341
282 Ga0075429_100387263
283 Ga0097620_100154567
284 Ga0097620_100699737
285 Ga0099795_10016762
286 Ga0111539_10036388
287 Ga0105247_10430461
288 Ga0114129_10049564
289 Ga0114129_10094780
290 Ga0114129_10401592
291 Ga0114129_10408924
292 Ga0114129_10528417
293 Ga0114129_10566060
294 Ga0105243_10628543
295 Ga0105248_10014693
296 Ga0105248_10249205
297 Ga0105238_10028426
298 Ga0105249_10080865
299 Ga0105249_10285681
300 Ga0105249_10557891
301 Ga0105249_10954408
302 Ga0099796_10048915
303 Ga0105246_10033495
304 Ga0105246_10540472
305 Ga0157378_10124157
306 Ga0163162_10011813
307 Ga0157380_10368043
308 Ga0157380_10434589
309 Ga0157379_10001542
310 Ga0157379_10092624
311 Ga0157376_10546222
312 Ga0163161_10530056
313 Ga0209233_1018703
314 Ga0209758_1000559
315 Ga0207426_1023897
316 Ga0207660_10229981
317 Ga0207652_10304658
318 Ga0207694_10024495
319 Ga0207659_10535385
320 Ga0207711_10052607
321 Ga0207651_10323358
322 Ga0207658_10147942
323 Ga0207677_10014959
324 Ga0207703_10076799
325 Ga0207639_10191126
326 Ga0265323_10010121
327 Ga0265330_10030818
328 Ga0265332_10000010
329 Ga0265320_10027891
330 Ga0265325_10031124
331 Ga0265329_10027936
332 Ga0265340_10028970
333 Ga0265327_10001346
334 Ga0265316_10344303
335 Ga0307509_10000407
336 Ga0265314_10000093
337 Ga0265314_10009591
338 Ga0307416_100415931
339 Ga0307411_10190735
340 Ga0316583_10006764
341 Ga0373928_0004832
342 Ga0373955_0168516
343 Ga0373931_0200782
344 Ga0373927_0044880
345 Ga0373937_0000549
346 Ga0373925_0047418
347 Ga0451577_0015009
348 Ga0451577_0090904
349 Ga0451577_0328452
350 Ga0466963_0015069
351 Ga0453684_0028184
352 Ga0466971_0114099
353 Ga0466959_0297371
354 Ga0451576_0012411
355 Ga0451576_0044556
356 Ga0466958_0281611
357 Ga0495582_0067028
358 Ga0495584_0066816
359 Ga0495609_0094121
360 Ga0495609_0124477
361 Ga0495611_0352019
362 Ga0495659_0076494
363 Ga0495658_0011366
364 Ga0495669_0183178
365 Ga0495613_0403489
366 Ga0495671_0381864
367 Ga0495581_0155448
368 Ga0495674_0262094
369 Ga0495672_0239187
370 Ga0495684_0300159
371 Ga0495626_0131332
372 Ga0496102_0951482
373 Ga0496104_0045344
374 Ga0496105_0584326
375 Ga0496109_0067443
376 Ga0496112_0544194
377 Ga0496114_0780662
378 Ga0496115_0223812
379 Ga0496115_0375580
380 Ga0496126_0076653
381 Ga0501031_0026637
382 Ga0501031_0204119
383 Ga0501032_0020702
384 Ga0501033_0005428
385 Ga0501033_0009903
386 Ga0501034_0022769
387 Ga0501034_0022891
388 Ga0501034_0163383
389 Ga0501034_0480144
390 Ga0501036_0011956
391 Ga0501036_0051561
392 Ga0501036_0118938
393 Ga0501037_0002313
394 Ga0501037_0122026
395 Ga0501038_0001971
396 Ga0501038_0010010
397 Ga0501038_0100148
398 Ga0501039_0022563
399 Ga0501043_0068608
400 Ga0501043_0101657
401 Ga0501046_0133468
402 Ga0501046_0467642
403 Ga0501047_0004375
404 Ga0501047_0015954
405 Ga0501047_0039840
406 Ga0501047_0103659
407 Ga0501067_0029299
408 Ga0501068_0215910
409 Ga0501070_0000817
410 Ga0501070_0043373
411 Ga0501070_0280134
412 Ga0501070_0382131
413 Ga0501071_0164396
414 Ga0501073_0008249
415 Ga0501073_0025239
416 Ga0501080_0447940
417 Ga0501080_0677187
418 Ga0501083_0002755
419 Ga0501083_0055279
420 Ga0501035_0001877
421 Ga0501035_0018077
422 Ga0501035_0059510
423 Ga0501044_0002322
424 nmdc:mga03683_939_c1
425 nmdc:mga03n38_4224_c1
426 nmdc:mga00v17_391631_c1
427 nmdc:mga00v17_430790_c1
428 nmdc:mga0yw44_255876_c1
429 nmdc:mga0yw44_258822_c1
430 nmdc:mga0yw44_58009_c1
431 nmdc:mga0yw44_65503_c1
432 nmdc:mga0k408_411310_c1
433 nmdc:mga06z11_2069_c1
434 nmdc:mga06z11_400056_c1
435 nmdc:mga04h51_252807_c1
436 nmdc:mga07m45_318118_c1
437 nmdc:mga05p37_76440_c1
438 nmdc:mga05p37_8436_c1
439 nmdc:mga09592_563378_c1
440 nmdc:mga09592_590439_c1
441 nmdc:mga0qj67_497_c1
442 nmdc:mga06r32_161301_c1
443 nmdc:mga08y16_150436_c1
444 nmdc:mga08y16_337857_c1
445 nmdc:mga0n895_17903_c1
446 nmdc:mga0a205_239503_c1
447 nmdc:mga0a205_89217_c1
448 nmdc:mga0sz30_9722_c1
449 Ga0500643_003604
450 Ga0500644_0001761
451 Ga0500651_0008230
452 Ga0500566_0016332
453 Ga0500641_0002769
454 Ga0500595_000006
455 Ga0500595_003760
456 Ga0500595_034317
457 Ga0500597_038636
458 Ga0500652_000004
459 Ga0500652_008509
460 Ga0500652_091558
461 Ga0500658_0013648
462 Ga0500568_0008955
463 Ga0500588_0186781
464 Ga0500616_0000001
465 Ga0500616_0040432
466 Ga0500636_0014381
467 Ga0500645_000650
468 Ga0501084_0115547
469 Ga0501082_0015112
470 2643757756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03975

CheD

CheD chemotactic sensory transduction

82

184

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9z-assembly2.cif.gz_D complex between the chemotaxis deamidase ched and the chemotaxis phosphatase chec from thermotoga maritima 0.8598 35 181
2f9z-assembly2.cif.gz_D complex between the chemotaxis deamidase ched and the chemotaxis phosphatase chec from thermotoga maritima 0.7922 35 181
3d0k-assembly2.cif.gz_B crystal structure of the lpqc, poly(3-hydroxybutyrate) depolymerase from bordetella parapertussis 0.6762 130 161
6a0h-assembly1.cif.gz_A crystal structure of human protein n-terminal asparagine amidohydrolase (ntan1) c75s mutant with asn-leu-ala-ala-arg peptide 0.6664 35 179
5ye4-assembly1.cif.gz_A crystal structure of the complex of di-acetylated histone h4 and 1a9d7 fab fragment 0.6537 163 184
ID Description Score Start End Superfamily
2f9zD00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;; 0.8598 35 181 3.30.1330.200
2f9zD00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;; 0.7922 35 181 3.30.1330.200
af_A0A0R0J7J9_104_364_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7849 164 183 2.120.10.80
af_A0A0R0F0L9_52_338_2.120.10.10 Mainly Beta;6 Propeller;Neuraminidase; 0.7459 164 190 2.120.10.10
af_K7MSS4_18_146_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7095 163 182 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A850QA06-F1-model_v4 Probable chemoreceptor glutamine deamidase CheD (EC 3.5.1.44) 0.947 35 184 GO:0006935
GO:0050568
AF-A0A2N4YCL4-F1-model_v4 Probable chemoreceptor glutamine deamidase CheD (EC 3.5.1.44) 0.9386 35 183 GO:0006935
GO:0050568
AF-A0A5Q4DNC3-F1-model_v4 Probable chemoreceptor glutamine deamidase CheD (EC 3.5.1.44) 0.9336 35 183 GO:0006935
GO:0050568
AF-A0A4Z0LN61-F1-model_v4 deleted 0.9317 35 183
AF-A0A6N1VIQ1-F1-model_v4 Probable chemoreceptor glutamine deamidase CheD (EC 3.5.1.44) 0.9312 35 183 GO:0006935
GO:0050568

Map