F348314

General Info

Members Datasets Scaffolds Average Seq Length
235 161 470 319

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0068440|Ga0395899_0068440_134_1213
Length 359
Sequence LERRWLQGVQSLRGFLLEQPDKKRIRELRKLSRIESIAYDVMPMAKTIPGLHHVTAIASDPQRNLDFYVGLLGLRFVKRTVNFDDPGTYHFYFGDRRGTPGTILTFFPWPGVRRGIRGTGQIEATAFAISPDSIGYWLKRFKQQHVTAERIASRFGEEVIRFVDPDGLLLELIASNSLAPVEQWPDNPIPPEHALHGFHGVSAALEGYEKTARLLTDTFGYRLVEESGNRFRFGSPDDSAPGRIVDLLCLPDSGVGRVAAGSVHHIAFRARDEQEQLQWREQLVDFGYNVTPVIDRIYFHSIYFREPGGVLLEVATEPPGFTLDETIEELGTGLRLPPWLESARSQIEKILPAIQVPHQ

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
119 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
120 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
158 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
160 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
161 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 0.43
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.11
Rhizosphere 90.64
Stem 0
Stem Tuber 0
Unclassified 8.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0068440 3300037312 Bacteria 2603
2 Ga0065712_10009253 3300005290 Bacteria 3491
3 Ga0065712_10016720 3300005290 Bacteria 2093
4 Ga0065712_10077843 3300005290 Unclassified 3426
5 Ga0065715_10010993 3300005293 Bacteria 3383
6 Ga0065715_10203277 3300005293 Bacteria 1339
7 Ga0070658_10103857 3300005327 Unclassified 2350
8 Ga0070658_10130080 3300005327 Bacteria 2097
9 Ga0070676_10040243 3300005328 Bacteria 2706
10 Ga0070683_100046502 3300005329 Bacteria 4010
11 Ga0070683_100124192 3300005329 Bacteria 2439
12 Ga0070682_100098540 3300005337 Bacteria 1926
13 Ga0070682_100150497 3300005337 Bacteria 1596
14 Ga0070682_100249639 3300005337 Bacteria 1278
15 Ga0070660_100010183 3300005339 Bacteria 6636
16 Ga0070660_100199696 3300005339 Unclassified 1622
17 Ga0070687_100004449 3300005343 Bacteria 5590
18 Ga0070668_100017209 3300005347 Bacteria 5410
19 Ga0070669_100009242 3300005353 Bacteria 7022
20 Ga0070675_100065462 3300005354 Bacteria 3005
21 Ga0070675_100113546 3300005354 Bacteria 2294
22 Ga0070675_100143069 3300005354 Bacteria 2045
23 Ga0070673_100009311 3300005364 Bacteria 6590
24 Ga0070659_100029668 3300005366 Bacteria 4228
25 Ga0070659_100099034 3300005366 Bacteria 2345
26 Ga0070667_100016690 3300005367 Bacteria 6077
27 Ga0070714_100192543 3300005435 Bacteria 1862
28 Ga0070713_100035280 3300005436 Bacteria 4026
29 Ga0070694_100087814 3300005444 Bacteria 2176
30 Ga0070708_100140441 3300005445 Bacteria 2240
31 Ga0070678_100118059 3300005456 Unclassified 2087
32 Ga0070662_100014789 3300005457 Bacteria 5217
33 Ga0070662_100091691 3300005457 Bacteria 2282
34 Ga0070681_10022992 3300005458 Bacteria 6266
35 Ga0070681_10146891 3300005458 Bacteria 2286
36 Ga0070706_100000511 3300005467 Bacteria 45508
37 Ga0070706_100008279 3300005467 Bacteria 9692
38 Ga0070706_100040614 3300005467 Bacteria 4295
39 Ga0070706_100119924 3300005467 Bacteria 2452
40 Ga0070707_100018094 3300005468 Bacteria 6629
41 Ga0070707_100180148 3300005468 Bacteria 2060
42 Ga0070707_100304991 3300005468 Bacteria 1547
43 Ga0070698_100005292 3300005471 Bacteria 14123
44 Ga0070698_100057032 3300005471 Bacteria 3953
45 Ga0070679_100087749 3300005530 Bacteria 3098
46 Ga0070684_100020836 3300005535 Bacteria 5441
47 Ga0070684_100117557 3300005535 Bacteria 2389
48 Ga0070697_100015793 3300005536 Bacteria 5930
49 Ga0070697_100093333 3300005536 Bacteria 2492
50 Ga0070697_100125510 3300005536 Bacteria 2150
51 Ga0068853_100071635 3300005539 Bacteria 3019
52 Ga0068853_100105784 3300005539 Bacteria 2493
53 Ga0070665_100056148 3300005548 Bacteria 3949
54 Ga0070665_100075551 3300005548 Unclassified 3376
55 Ga0070664_100115450 3300005564 Unclassified 2346
56 Ga0068856_100042624 3300005614 Bacteria 4464
57 Ga0068856_100157426 3300005614 Bacteria 2282
58 Ga0068861_100285324 3300005719 Bacteria 1423
59 Ga0068863_100320841 3300005841 Bacteria 1505
60 Ga0068858_100019895 3300005842 Bacteria 6275
61 Ga0068860_100032811 3300005843 Bacteria 4987
62 Ga0068860_100319352 3300005843 Bacteria 1524
63 Ga0068862_100068173 3300005844 Bacteria 3068
64 Ga0081455_10000501 3300005937 Bacteria 50802
65 Ga0081455_10002178 3300005937 Bacteria 23355
66 Ga0081455_10139150 3300005937 Unclassified 1888
67 Ga0081455_10157257 3300005937 Bacteria 1746
68 Ga0081540_1001600 3300005983 Bacteria 19304
69 Ga0081540_1002472 3300005983 Bacteria 15046
70 Ga0081540_1050980 3300005983 Bacteria 2050
71 Ga0081539_10073669 3300005985 Bacteria 1821
72 Ga0070717_10033845 3300006028 Bacteria 4125
73 Ga0070717_10155746 3300006028 Bacteria 1979
74 Ga0070712_100009507 3300006175 Bacteria 6129
75 Ga0070712_100112728 3300006175 Unclassified 2032
76 Ga0075428_100326117 3300006844 Bacteria 1649
77 Ga0075430_100077064 3300006846 Bacteria 2794
78 Ga0075433_10335028 3300006852 Bacteria 1338
79 Ga0075434_100043248 3300006871 Bacteria 4467
80 Ga0075429_100270540 3300006880 Bacteria 1488
81 Ga0111539_10188663 3300009094 Bacteria 2406
82 Ga0111539_10318794 3300009094 Bacteria 1809
83 Ga0105245_10041621 3300009098 Bacteria 4095
84 Ga0105245_10147384 3300009098 Bacteria 2222
85 Ga0114129_10038028 3300009147 Bacteria 6789
86 Ga0114129_10102220 3300009147 Bacteria 3964
87 Ga0114129_10572613 3300009147 Bacteria 1466
88 Ga0105243_10131300 3300009148 Bacteria 2125
89 Ga0105249_10019832 3300009553 Bacteria 6003
90 Ga0105239_10055686 3300010375 Bacteria 4338
91 Ga0157369_10050547 3300013105 Bacteria 4502
92 Ga0157374_10108531 3300013296 Bacteria 2668
93 Ga0157374_10227203 3300013296 Bacteria 1833
94 Ga0157374_10270536 3300013296 Bacteria 1675
95 Ga0157374_10493671 3300013296 Bacteria 1228
96 Ga0163162_10110247 3300013306 Bacteria 2849
97 Ga0157372_10049286 3300013307 Bacteria 4683
98 Ga0157372_10355211 3300013307 Bacteria 1708
99 Ga0157375_10016687 3300013308 Bacteria 6605
100 Ga0163163_10213086 3300014325 Bacteria 1981
101 Ga0182008_10101775 3300014497 Bacteria 1420
102 Ga0157376_10023588 3300014969 Bacteria 4817
103 Ga0157376_10123603 3300014969 Bacteria 2298
104 Ga0157376_10139328 3300014969 Bacteria 2174
105 Ga0163161_10411582 3300017792 Unclassified 1086
106 Ga0213872_10009040 3300021361 Bacteria 4790
107 Ga0213876_10014644 3300021384 Bacteria 4155
108 Ga0213875_10000611 3300021388 Bacteria 28894
109 Ga0224712_10118962 3300022467 Bacteria 1142
110 Ga0207673_1004257 3300025290 Bacteria 1704
111 Ga0207697_10004267 3300025315 Bacteria 6859
112 Ga0207697_10005185 3300025315 Bacteria 6082
113 Ga0207697_10006387 3300025315 Bacteria 5337
114 Ga0207647_10033083 3300025904 Bacteria 3315
115 Ga0207645_10002865 3300025907 Bacteria 13362
116 Ga0207705_10209449 3300025909 Bacteria 1478
117 Ga0207684_10000186 3300025910 Bacteria 98342
118 Ga0207684_10011061 3300025910 Bacteria 7903
119 Ga0207684_10020514 3300025910 Bacteria 5648
120 Ga0207684_10093538 3300025910 Bacteria 2563
121 Ga0207684_10137845 3300025910 Bacteria 2096
122 Ga0207654_10032046 3300025911 Bacteria 2900
123 Ga0207707_10035267 3300025912 Bacteria 4375
124 Ga0207693_10020526 3300025915 Bacteria 5254
125 Ga0207693_10023424 3300025915 Bacteria 4903
126 Ga0207693_10035606 3300025915 Bacteria 3924
127 Ga0207693_10042841 3300025915 Bacteria 3563
128 Ga0207693_10104745 3300025915 Bacteria 2218
129 Ga0207663_10162918 3300025916 Bacteria 1576
130 Ga0207662_10009101 3300025918 Bacteria 5457
131 Ga0207657_10026942 3300025919 Bacteria 5271
132 Ga0207649_10014995 3300025920 Bacteria 4351
133 Ga0207652_10235725 3300025921 Bacteria 1649
134 Ga0207646_10066422 3300025922 Unclassified 3220
135 Ga0207646_10218322 3300025922 Bacteria 1722
136 Ga0207659_10323021 3300025926 Bacteria 1274
137 Ga0207687_10208539 3300025927 Bacteria 1532
138 Ga0207687_10358755 3300025927 Bacteria 1189
139 Ga0207690_10048479 3300025932 Bacteria 2825
140 Ga0207690_10073520 3300025932 Bacteria 2365
141 Ga0207690_10106087 3300025932 Bacteria 2015
142 Ga0207706_10016204 3300025933 Bacteria 6735
143 Ga0207670_10060510 3300025936 Bacteria 2580
144 Ga0207691_10060688 3300025940 Bacteria 3436
145 Ga0207661_10104006 3300025944 Bacteria 2390
146 Ga0207661_10203526 3300025944 Bacteria 1741
147 Ga0207679_10103938 3300025945 Bacteria 2227
148 Ga0207651_10173213 3300025960 Unclassified 1704
149 Ga0207712_10022802 3300025961 Bacteria 4126
150 Ga0207668_10231860 3300025972 Unclassified 1489
151 Ga0207658_10109427 3300025986 Bacteria 2181
152 Ga0207639_10223544 3300026041 Bacteria 1627
153 Ga0207678_10205969 3300026067 Bacteria 1682
154 Ga0207708_10085338 3300026075 Bacteria 2428
155 Ga0207702_10423806 3300026078 Bacteria 1287
156 Ga0207674_10142227 3300026116 Bacteria 2358
157 Ga0207675_100636194 3300026118 Bacteria 1072
158 Ga0207683_10058220 3300026121 Bacteria 3393
159 Ga0209974_10044582 3300027876 Bacteria 1480
160 Ga0268266_10074604 3300028379 Unclassified 2945
161 Ga0268266_10153811 3300028379 Bacteria 2076
162 Ga0268265_10084180 3300028380 Bacteria 2520
163 Ga0268264_10019057 3300028381 Bacteria 5610
164 Ga0268264_10057493 3300028381 Bacteria 3254
165 Ga0307406_10365301 3300031901 Bacteria 1133
166 Ga0373954_0111919 3300035118 Unclassified 1321
167 Ga0373947_0140038 3300035725 Bacteria 1551
168 Ga0373937_0637559 3300036401 Bacteria 1011
169 Ga0395900_0002931 3300037418 Bacteria 18585
170 Ga0395898_0010885 3300037466 Bacteria 9495
171 Ga0395898_0229883 3300037466 Bacteria 1769
172 Ga0395905_0068685 3300037471 Bacteria 3319
173 Ga0436364_1200640 3300037853 Bacteria 136867
174 Ga0395901_0069465 3300038443 Bacteria 3668
175 Ga0395901_0189821 3300038443 Bacteria 2155
176 Ga0436365_0777808 3300039437 Bacteria 4374
177 Ga0436365_0937656 3300039437 Bacteria 1307
178 Ga0436365_1890690 3300039437 Bacteria 3731
179 Ga0436360_1036687 3300039438 Bacteria 2800
180 Ga0436361_0034353 3300039447 Bacteria 17185
181 Ga0436363_1306841 3300039450 Bacteria 13356
182 Ga0436363_1697276 3300039450 Bacteria 1721
183 Ga0436362_0925698 3300039453 Bacteria 2530
184 Ga0436362_1041703 3300039453 Bacteria 5051
185 Ga0451835_0174116 3300041492 Bacteria 1253
186 Ga0439446_0022309 3300042156 Bacteria 1794
187 Ga0466966_0000896 3300044684 Bacteria 19018
188 Ga0466961_0028161 3300044693 Bacteria 3613
189 Ga0466963_0002480 3300044694 Bacteria 10320
190 Ga0466971_0045976 3300044719 Bacteria 1961
191 Ga0466957_0003573 3300044842 Bacteria 8567
192 Ga0466960_0150736 3300044901 Bacteria 1242
193 Ga0466959_0045228 3300045049 Bacteria 3242
194 Ga0451576_0052098 3300045051 Bacteria 4289
195 Ga0466958_0000970 3300045836 Bacteria 12948
196 Ga0495592_0004150 3300046454 Bacteria 10560
197 Ga0495628_0057347 3300046516 Bacteria 3063
198 Ga0495630_0064510 3300046517 Bacteria 2752
199 Ga0495640_0089866 3300046533 Bacteria 2028
200 Ga0495586_0012119 3300046535 Bacteria 4578
201 Ga0495645_0011137 3300046543 Bacteria 6324
202 Ga0495634_0081365 3300046642 Bacteria 2118
203 Ga0495599_0034595 3300046678 Bacteria 3173
204 Ga0495623_0198258 3300046679 Unclassified 1155
205 Ga0495646_0040473 3300046680 Bacteria 2870
206 Ga0495669_0026849 3300046684 Bacteria 2517
207 Ga0495604_0033241 3300047317 Bacteria 4084
208 Ga0495674_0211965 3300047319 Bacteria 1604
209 Ga0495680_0210780 3300047322 Bacteria 1391
210 Ga0495675_0089661 3300047444 Unclassified 1930
211 Ga0496104_0151810 3300048907 Bacteria 2223
212 Ga0496104_0382987 3300048907 Unclassified 1319
213 Ga0496105_0163131 3300048908 Bacteria 1829
214 Ga0496105_0399151 3300048908 Bacteria 1092
215 Ga0496107_0180627 3300048910 Bacteria 1567
216 Ga0496109_0067993 3300048912 Unclassified 3265
217 Ga0496109_0075676 3300048912 Bacteria 3095
218 Ga0496112_0076589 3300048915 Bacteria 3308
219 Ga0496114_0029720 3300048917 Bacteria 4493
220 Ga0496114_0207831 3300048917 Bacteria 1716
221 Ga0496115_0074041 3300048918 Unclassified 2765
222 Ga0496115_0109597 3300048918 Bacteria 2267
223 nmdc:mga05p37_126338_c1 3300050507 Bacteria 3140
224 nmdc:mga05p37_41626_c1 3300050507 Bacteria 5641
225 nmdc:mga05p37_46612_c1 3300050507 Bacteria 5329
226 nmdc:mga0qj67_71566_c1 3300050509 Bacteria 2768
227 nmdc:mga08y16_150277_c1 3300050511 Bacteria 2421
228 nmdc:mga0n895_392671_c1 3300050512 Unclassified 1403
229 nmdc:mga0a205_233167_c1 3300050515 Bacteria 1723
230 Ga0495601_0092171 3300053077 Bacteria 1951
231 Ga0495655_0007120 3300053083 Bacteria 2065
232 Ga0466962_0000912 3300061719 Bacteria 13420
233 Ga0466962_0138109 3300061719 Bacteria 1180
234 2816424107 2816332119 Bacteria 8120218
235 2837184582 2837183177 Bacteria 4637169
236 Ga0395899_0068440
237 Ga0065712_10009253
238 Ga0065712_10016720
239 Ga0065712_10077843
240 Ga0065715_10010993
241 Ga0065715_10203277
242 Ga0070658_10103857
243 Ga0070658_10130080
244 Ga0070676_10040243
245 Ga0070683_100046502
246 Ga0070683_100124192
247 Ga0070682_100098540
248 Ga0070682_100150497
249 Ga0070682_100249639
250 Ga0070660_100010183
251 Ga0070660_100199696
252 Ga0070687_100004449
253 Ga0070668_100017209
254 Ga0070669_100009242
255 Ga0070675_100065462
256 Ga0070675_100113546
257 Ga0070675_100143069
258 Ga0070673_100009311
259 Ga0070659_100029668
260 Ga0070659_100099034
261 Ga0070667_100016690
262 Ga0070714_100192543
263 Ga0070713_100035280
264 Ga0070694_100087814
265 Ga0070708_100140441
266 Ga0070678_100118059
267 Ga0070662_100014789
268 Ga0070662_100091691
269 Ga0070681_10022992
270 Ga0070681_10146891
271 Ga0070706_100000511
272 Ga0070706_100008279
273 Ga0070706_100040614
274 Ga0070706_100119924
275 Ga0070707_100018094
276 Ga0070707_100180148
277 Ga0070707_100304991
278 Ga0070698_100005292
279 Ga0070698_100057032
280 Ga0070679_100087749
281 Ga0070684_100020836
282 Ga0070684_100117557
283 Ga0070697_100015793
284 Ga0070697_100093333
285 Ga0070697_100125510
286 Ga0068853_100071635
287 Ga0068853_100105784
288 Ga0070665_100056148
289 Ga0070665_100075551
290 Ga0070664_100115450
291 Ga0068856_100042624
292 Ga0068856_100157426
293 Ga0068861_100285324
294 Ga0068863_100320841
295 Ga0068858_100019895
296 Ga0068860_100032811
297 Ga0068860_100319352
298 Ga0068862_100068173
299 Ga0081455_10000501
300 Ga0081455_10002178
301 Ga0081455_10139150
302 Ga0081455_10157257
303 Ga0081540_1001600
304 Ga0081540_1002472
305 Ga0081540_1050980
306 Ga0081539_10073669
307 Ga0070717_10033845
308 Ga0070717_10155746
309 Ga0070712_100009507
310 Ga0070712_100112728
311 Ga0075428_100326117
312 Ga0075430_100077064
313 Ga0075433_10335028
314 Ga0075434_100043248
315 Ga0075429_100270540
316 Ga0111539_10188663
317 Ga0111539_10318794
318 Ga0105245_10041621
319 Ga0105245_10147384
320 Ga0114129_10038028
321 Ga0114129_10102220
322 Ga0114129_10572613
323 Ga0105243_10131300
324 Ga0105249_10019832
325 Ga0105239_10055686
326 Ga0157369_10050547
327 Ga0157374_10108531
328 Ga0157374_10227203
329 Ga0157374_10270536
330 Ga0157374_10493671
331 Ga0163162_10110247
332 Ga0157372_10049286
333 Ga0157372_10355211
334 Ga0157375_10016687
335 Ga0163163_10213086
336 Ga0182008_10101775
337 Ga0157376_10023588
338 Ga0157376_10123603
339 Ga0157376_10139328
340 Ga0163161_10411582
341 Ga0213872_10009040
342 Ga0213876_10014644
343 Ga0213875_10000611
344 Ga0224712_10118962
345 Ga0207673_1004257
346 Ga0207697_10004267
347 Ga0207697_10005185
348 Ga0207697_10006387
349 Ga0207647_10033083
350 Ga0207645_10002865
351 Ga0207705_10209449
352 Ga0207684_10000186
353 Ga0207684_10011061
354 Ga0207684_10020514
355 Ga0207684_10093538
356 Ga0207684_10137845
357 Ga0207654_10032046
358 Ga0207707_10035267
359 Ga0207693_10020526
360 Ga0207693_10023424
361 Ga0207693_10035606
362 Ga0207693_10042841
363 Ga0207693_10104745
364 Ga0207663_10162918
365 Ga0207662_10009101
366 Ga0207657_10026942
367 Ga0207649_10014995
368 Ga0207652_10235725
369 Ga0207646_10066422
370 Ga0207646_10218322
371 Ga0207659_10323021
372 Ga0207687_10208539
373 Ga0207687_10358755
374 Ga0207690_10048479
375 Ga0207690_10073520
376 Ga0207690_10106087
377 Ga0207706_10016204
378 Ga0207670_10060510
379 Ga0207691_10060688
380 Ga0207661_10104006
381 Ga0207661_10203526
382 Ga0207679_10103938
383 Ga0207651_10173213
384 Ga0207712_10022802
385 Ga0207668_10231860
386 Ga0207658_10109427
387 Ga0207639_10223544
388 Ga0207678_10205969
389 Ga0207708_10085338
390 Ga0207702_10423806
391 Ga0207674_10142227
392 Ga0207675_100636194
393 Ga0207683_10058220
394 Ga0209974_10044582
395 Ga0268266_10074604
396 Ga0268266_10153811
397 Ga0268265_10084180
398 Ga0268264_10019057
399 Ga0268264_10057493
400 Ga0307406_10365301
401 Ga0373954_0111919
402 Ga0373947_0140038
403 Ga0373937_0637559
404 Ga0395900_0002931
405 Ga0395898_0010885
406 Ga0395898_0229883
407 Ga0395905_0068685
408 Ga0436364_1200640
409 Ga0395901_0069465
410 Ga0395901_0189821
411 Ga0436365_0777808
412 Ga0436365_0937656
413 Ga0436365_1890690
414 Ga0436360_1036687
415 Ga0436361_0034353
416 Ga0436363_1306841
417 Ga0436363_1697276
418 Ga0436362_0925698
419 Ga0436362_1041703
420 Ga0451835_0174116
421 Ga0439446_0022309
422 Ga0466966_0000896
423 Ga0466961_0028161
424 Ga0466963_0002480
425 Ga0466971_0045976
426 Ga0466957_0003573
427 Ga0466960_0150736
428 Ga0466959_0045228
429 Ga0451576_0052098
430 Ga0466958_0000970
431 Ga0495592_0004150
432 Ga0495628_0057347
433 Ga0495630_0064510
434 Ga0495640_0089866
435 Ga0495586_0012119
436 Ga0495645_0011137
437 Ga0495634_0081365
438 Ga0495599_0034595
439 Ga0495623_0198258
440 Ga0495646_0040473
441 Ga0495669_0026849
442 Ga0495604_0033241
443 Ga0495674_0211965
444 Ga0495680_0210780
445 Ga0495675_0089661
446 Ga0496104_0151810
447 Ga0496104_0382987
448 Ga0496105_0163131
449 Ga0496105_0399151
450 Ga0496107_0180627
451 Ga0496109_0067993
452 Ga0496109_0075676
453 Ga0496112_0076589
454 Ga0496114_0029720
455 Ga0496114_0207831
456 Ga0496115_0074041
457 Ga0496115_0109597
458 nmdc:mga05p37_126338_c1
459 nmdc:mga05p37_41626_c1
460 nmdc:mga05p37_46612_c1
461 nmdc:mga0qj67_71566_c1
462 nmdc:mga08y16_150277_c1
463 nmdc:mga0n895_392671_c1
464 nmdc:mga0a205_233167_c1
465 Ga0495601_0092171
466 Ga0495655_0007120
467 Ga0466962_0000912
468 Ga0466962_0138109
469 2816424107
470 2837184582

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

50

172

0.77

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

192

314

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oaj-assembly1.cif.gz_A crystal structure of putative dioxygenase from bacillus subtilis subsp. subtilis str. 168 0.9273 3 309
3oaj-assembly1.cif.gz_A crystal structure of putative dioxygenase from bacillus subtilis subsp. subtilis str. 168 0.9129 3 309
1zsw-assembly1.cif.gz_A crystal structure of bacillus cereus metallo protein from glyoxalase family 0.9036 1 308
4huz-assembly1.cif.gz_A-2 2,6-dichloro-p-hydroquinone 1,2-dioxygenase 0.8961 4 302
1zsw-assembly1.cif.gz_A crystal structure of bacillus cereus metallo protein from glyoxalase family 0.8844 1 308
ID Description Score Start End Superfamily
3oajB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9658 3 309 3.10.180.10
1zswA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9601 1 308 3.10.180.10
3oajB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9375 3 309 3.10.180.10
af_Q2G137_30_308_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.915 32 307 3.10.180.10
af_Q2G137_30_308_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9025 32 307 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7X5WMY8-F1-model_v4 Ring-cleaving dioxygenase 0.9824 214 310 GO:0051213
AF-A0A519WWB5-F1-model_v4 Ring-cleaving dioxygenase 0.9818 216 308 GO:0051213
AF-A0A838NQS1-F1-model_v4 VOC family protein 0.9801 217 308
AF-A0A4Q5YRF2-F1-model_v4 Ring-cleaving dioxygenase 0.9788 220 308 GO:0051213
AF-A0A6L5B315-F1-model_v4 deleted 0.9779 214 309

Map