F348179

General Info

Members Datasets Scaffolds Average Seq Length
235 193 470 324

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10056452|Ga0213876_100564522
Length 357
Sequence MTPFQYRRAADAGDAVRLASGLQGAQFIAGGTSQVDLMKEGVQRPSALVEILRIGLDEITETAAGGLSIGANVRNSTASDDCVVRERYTAIAEALHAGASQQIRNMATMAGNLLQRTRCPYLRDPVQPCNKRDPGSGCAAVRGFNRLHAIFGQTDEGPDSPHTCIAVHPSDMAVAMAAFEAVIVVRGRDGERRIAFEELHRLPGEDPSRDTNLQPDDLIVAMELPHFRGASHYLKVRDRASYAYALVSCATTLEMDGGRIAKARIALGSVAHKPWRLLRAEAMLEGERPSEELFRRAAAVGLEGVRTYSMNAYKPVLARALVARGLAETTGLSPRQGPAGTAFAASVGGIAGVRAGA

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
58 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
62 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
104 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
105 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
106 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
107 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
108 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
109 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
137 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
149 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
156 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
157 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
158 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
159 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
160 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
161 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
162 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
163 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
164 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
165 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
166 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
167 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
168 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
169 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
170 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
171 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
172 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
173 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
174 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
175 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
176 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
177 2922554459 Rhodococcus sp. 66b Isolate Unclassified
178 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
179 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
180 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
181 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
182 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
183 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
184 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
185 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
186 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
187 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
188 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
189 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
190 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
191 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
192 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
193 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.4
Metatranscriptomes 0
Isolates 16.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.49
Nodule 4.68
Rhizoplane 4.68
Rhizosphere 61.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10056452 3300021384 Bacteria 2073
2 JGI24738J21930_10000759 3300002075 Bacteria 9234
3 Ga0055540_1001949 3300003792 Bacteria 11539
4 Ga0055540_1002666 3300003792 Bacteria 9221
5 Ga0055540_1015818 3300003792 Bacteria 2176
6 Ga0065165_1000035 3300005262 Bacteria 214086
7 Ga0065712_10075433 3300005290 Bacteria 3864
8 Ga0070683_100001640 3300005329 Bacteria 17318
9 Ga0070670_100000354 3300005331 Bacteria 38502
10 Ga0070677_10006284 3300005333 Bacteria 3940
11 Ga0070661_100009561 3300005344 Bacteria 6716
12 Ga0070675_100003514 3300005354 Bacteria 11882
13 Ga0070671_100001638 3300005355 Bacteria 16912
14 Ga0070673_100006007 3300005364 Bacteria 7858
15 Ga0070667_100000059 3300005367 Bacteria 147078
16 Ga0070713_100000271 3300005436 Bacteria 34038
17 Ga0070711_100219289 3300005439 Bacteria 1478
18 Ga0070678_100000010 3300005456 Bacteria 58577
19 Ga0070662_100073643 3300005457 Bacteria 2524
20 Ga0068867_100023090 3300005459 Bacteria 4452
21 Ga0070684_100013765 3300005535 Bacteria 6529
22 Ga0070672_100000815 3300005543 Bacteria 18627
23 Ga0070665_100473545 3300005548 Bacteria 1263
24 Ga0070664_100000179 3300005564 Bacteria 44681
25 Ga0068854_100001230 3300005578 Bacteria 15351
26 Ga0068856_100009761 3300005614 Bacteria 9327
27 Ga0070702_100016130 3300005615 Bacteria 3827
28 Ga0068852_100000347 3300005616 Bacteria 31132
29 Ga0068859_100023913 3300005617 Bacteria 6131
30 Ga0068864_100021000 3300005618 Bacteria 5468
31 Ga0068864_100362928 3300005618 Bacteria 1369
32 Ga0068851_10014158 3300005834 Bacteria 3784
33 Ga0068870_10043367 3300005840 Bacteria 2346
34 Ga0068858_100081982 3300005842 Bacteria 2998
35 Ga0068860_100000048 3300005843 Bacteria 209375
36 Ga0081455_10000278 3300005937 Bacteria 67808
37 Ga0081539_10000493 3300005985 Bacteria 83122
38 Ga0075365_10022615 3300006038 Bacteria 3943
39 Ga0075363_100018801 3300006048 Bacteria 3446
40 Ga0075363_100033069 3300006048 Bacteria 2691
41 Ga0075364_10008320 3300006051 Bacteria 6193
42 Ga0075364_10015670 3300006051 Bacteria 4705
43 Ga0075369_10002450 3300006186 Bacteria 6621
44 Ga0075369_10064631 3300006186 Bacteria 1602
45 Ga0097621_100000056 3300006237 Bacteria 59138
46 Ga0075370_10014331 3300006353 Bacteria 4227
47 Ga0075370_10127393 3300006353 Bacteria 1484
48 Ga0068871_100000488 3300006358 Bacteria 27109
49 Ga0075430_100144667 3300006846 Bacteria 1980
50 Ga0068865_100059209 3300006881 Bacteria 2678
51 Ga0097620_100023913 3300006931 Bacteria 6131
52 Ga0079104_1003059 3300006946 Bacteria 8178
53 Ga0105244_10002242 3300009036 Bacteria 14721
54 Ga0105243_10000203 3300009148 Bacteria 69484
55 Ga0105242_10420599 3300009176 Bacteria 1252
56 Ga0105248_10000098 3300009177 Bacteria 96532
57 Ga0105248_10227681 3300009177 Bacteria 2099
58 Ga0105237_10245677 3300009545 Bacteria 1791
59 Ga0105246_10000088 3300011119 Bacteria 39136
60 Ga0157374_10000816 3300013296 Bacteria 27323
61 Ga0157375_10000608 3300013308 Bacteria 31811
62 Ga0182008_10005495 3300014497 Bacteria 7213
63 Ga0157376_10027868 3300014969 Bacteria 4483
64 Ga0182006_1000512 3300015261 Bacteria 29558
65 Ga0182005_1001455 3300015265 Bacteria 9536
66 Ga0214542_1018842 3300021321 Bacteria 5674
67 Ga0213872_10000217 3300021361 Bacteria 50746
68 Ga0213872_10022850 3300021361 Bacteria 2877
69 Ga0213876_10089872 3300021384 Bacteria 1626
70 Ga0213875_10009560 3300021388 Bacteria 4906
71 Ga0228711_1024785 3300022739 Bacteria 4169
72 Ga0209674_100357 3300025226 Bacteria 25905
73 Ga0209565_1001827 3300025263 Bacteria 8550
74 Ga0209051_1000485 3300025303 Bacteria 51308
75 Ga0209051_1000595 3300025303 Bacteria 42760
76 Ga0209051_1007095 3300025303 Bacteria 6192
77 Ga0207655_1002275 3300025728 Bacteria 15824
78 Ga0207680_10037451 3300025903 Bacteria 2800
79 Ga0207649_10008716 3300025920 Bacteria 5538
80 Ga0207650_10018458 3300025925 Bacteria 4895
81 Ga0207659_10001573 3300025926 Bacteria 13545
82 Ga0207664_10293465 3300025929 Bacteria 1429
83 Ga0207644_10001572 3300025931 Bacteria 14755
84 Ga0207709_10000011 3300025935 Bacteria 552881
85 Ga0207711_10002636 3300025941 Bacteria 15877
86 Ga0207661_10004827 3300025944 Bacteria 9444
87 Ga0207679_10004741 3300025945 Bacteria 8466
88 Ga0207651_10000114 3300025960 Bacteria 34868
89 Ga0207640_10001484 3300025981 Bacteria 12651
90 Ga0207658_10000228 3300025986 Bacteria 58995
91 Ga0207648_10020036 3300026089 Bacteria 6034
92 Ga0207676_10009544 3300026095 Bacteria 6908
93 Ga0207676_10273681 3300026095 Bacteria 1530
94 Ga0207683_10000810 3300026121 Bacteria 28613
95 Ga0207698_10005070 3300026142 Bacteria 8084
96 Ga0209281_1000188 3300027111 Bacteria 141823
97 Ga0268266_10171816 3300028379 Bacteria 1968
98 Ga0268264_10000005 3300028381 Bacteria 934972
99 Ga0265337_1009759 3300028556 Bacteria 3407
100 Ga0265338_10007869 3300028800 Bacteria 13090
101 Ga0307513_10040791 3300031456 Bacteria 5130
102 Ga0307513_10046758 3300031456 Bacteria 4714
103 Ga0307405_10060714 3300031731 Bacteria 2387
104 Ga0307405_10080166 3300031731 Bacteria 2131
105 Ga0307405_10262212 3300031731 Bacteria 1291
106 Ga0307413_10050866 3300031824 Bacteria 2493
107 Ga0307413_10054693 3300031824 Bacteria 2424
108 Ga0307412_10001482 3300031911 Bacteria 13051
109 Ga0307412_10052457 3300031911 Bacteria 2701
110 Ga0307416_100187634 3300032002 Bacteria 1946
111 Ga0373923_0018021 3300035111 Bacteria 2710
112 Ga0373946_0024702 3300035171 Bacteria 2358
113 Ga0373937_0038158 3300036401 Bacteria 4378
114 Ga0395900_0067949 3300037418 Bacteria 3662
115 Ga0395898_0116248 3300037466 Bacteria 2563
116 Ga0395905_0000594 3300037471 Bacteria 48383
117 Ga0395905_0001008 3300037471 Bacteria 35984
118 Ga0395905_0017458 3300037471 Bacteria 6813
119 Ga0395905_0224367 3300037471 Bacteria 1758
120 Ga0436364_0020672 3300037853 Bacteria 1291
121 Ga0436364_0618299 3300037853 Bacteria 1596
122 Ga0436364_0662482 3300037853 Bacteria 3927
123 Ga0436364_0868957 3300037853 Bacteria 10426
124 Ga0436364_1328598 3300037853 Bacteria 2599
125 Ga0436364_1526685 3300037853 Bacteria 1739
126 Ga0436365_0101992 3300039437 Bacteria 8961
127 Ga0436365_1678077 3300039437 Bacteria 2082
128 Ga0436360_0883853 3300039438 Bacteria 16325
129 Ga0436361_0238361 3300039447 Bacteria 15794
130 Ga0436361_0616410 3300039447 Bacteria 7091
131 Ga0436361_0931365 3300039447 Bacteria 36892
132 Ga0439436_0000046 3300041404 Bacteria 36987
133 Ga0439461_0003029 3300041410 Bacteria 2738
134 Ga0439466_0000135 3300041411 Bacteria 29163
135 Ga0439466_0000541 3300041411 Bacteria 14286
136 Ga0439465_0000157 3300041413 Bacteria 16967
137 Ga0439465_0002418 3300041413 Bacteria 6115
138 Ga0439465_0004589 3300041413 Bacteria 4460
139 Ga0439431_0009152 3300041997 Bacteria 2233
140 Ga0439445_0003991 3300042004 Bacteria 3330
141 Ga0450908_000067 3300042184 Bacteria 20606
142 Ga0466969_0052451 3300044656 Bacteria 2004
143 Ga0466982_0000088 3300044672 Bacteria 23126
144 Ga0466965_0004778 3300044683 Bacteria 6040
145 Ga0466965_0070376 3300044683 Bacteria 1758
146 Ga0466965_0094676 3300044683 Bacteria 1522
147 Ga0466966_0043065 3300044684 Bacteria 2895
148 Ga0466961_0022941 3300044693 Bacteria 4015
149 Ga0466961_0059914 3300044693 Bacteria 2421
150 Ga0453684_0240703 3300044712 Bacteria 2083
151 Ga0466970_0006952 3300044765 Bacteria 5666
152 Ga0466970_0274220 3300044765 Bacteria 948
153 Ga0466960_0001619 3300044901 Bacteria 8233
154 Ga0466959_0050436 3300045049 Bacteria 3055
155 Ga0466967_0553067 3300045976 Bacteria 1133
156 Ga0495590_0004386 3300046457 Bacteria 5701
157 Ga0495606_0000104 3300046507 Bacteria 143973
158 Ga0495588_0010647 3300046674 Bacteria 4286
159 Ga0495670_0000998 3300046691 Bacteria 13756
160 Ga0495649_0008472 3300046694 Bacteria 6187
161 Ga0496100_0097293 3300048903 Bacteria 2021
162 Ga0496102_0000167 3300048905 Bacteria 88562
163 Ga0496103_0000756 3300048906 Bacteria 23844
164 Ga0496104_0294387 3300048907 Bacteria 1536
165 Ga0496108_0002535 3300048911 Bacteria 14619
166 Ga0496109_0002343 3300048912 Bacteria 15800
167 Ga0496110_0000037 3300048913 Bacteria 64495
168 Ga0496111_0190833 3300048914 Bacteria 1523
169 Ga0496112_0520531 3300048915 Bacteria 1124
170 Ga0496113_0127776 3300048916 Bacteria 1992
171 Ga0496114_0203535 3300048917 Bacteria 1734
172 Ga0496116_0013479 3300048919 Bacteria 6587
173 Ga0496117_0000447 3300048920 Bacteria 68541
174 Ga0496118_0000286 3300048921 Bacteria 88166
175 Ga0496119_0012559 3300048922 Bacteria 6863
176 Ga0496119_0017635 3300048922 Bacteria 5362
177 Ga0496121_0024636 3300048924 Bacteria 5746
178 Ga0496124_0003542 3300048927 Bacteria 18989
179 Ga0496124_0004325 3300048927 Bacteria 16651
180 Ga0496125_0001004 3300048928 Bacteria 43910
181 Ga0496126_0001691 3300048929 Bacteria 32861
182 Ga0501047_0510504 3300049581 Bacteria 1028
183 Ga0501070_0008085 3300049586 Bacteria 8904
184 Ga0501073_0134368 3300049589 Bacteria 1714
185 Ga0501080_0062908 3300049742 Bacteria 3454
186 Ga0501279_000339 3300049775 Bacteria 6238
187 nmdc:mga03n38_2778_c1 3300050490 Bacteria 5497
188 nmdc:mga00v17_133336_c1 3300050491 Bacteria 1589
189 nmdc:mga00v17_71077_c1 3300050491 Bacteria 2157
190 nmdc:mga06z11_136342_c1 3300050494 Bacteria 1383
191 nmdc:mga07m45_16321_c1 3300050496 Bacteria 3975
192 nmdc:mga07m45_9051_c2 3300050496 Bacteria 4220
193 nmdc:mga0sz30_31233_c1 3300050516 Bacteria 2203
194 nmdc:mga0sz30_478_c1 3300050516 Bacteria 15095
195 Ga0495601_0143010 3300053077 Bacteria 1561
196 Ga0500616_0008421 3300053153 Bacteria 6406
197 2509110078 2508501122 Bacteria 6292184
198 2515612568 2515154107 Bacteria 6795637
199 2537899325 2537561592 Bacteria 4348607
200 2552113000 2551306166 Bacteria 9731570
201 2566996423 2565956761 Bacteria 6601618
202 2585555274 2585427530 Bacteria 7383882
203 2617918584 2617270889 Bacteria 9064343
204 2644636124 2643221715 Bacteria 6671032
205 2786675454 2786546132 Bacteria 10419719
206 2792640683 2791355094 Bacteria 7011481
207 2819689814 2818991462 Bacteria 4320267
208 2819726633 2818991469 Bacteria 4644110
209 2834645277 2834641062 Bacteria 5559922
210 2842921114 2842918807 Bacteria 4289178
211 2857485417 2857481737 Bacteria 4761446
212 2867352473 2867346516 Bacteria 7608576
213 2886629162 2886627955 Bacteria 7618130
214 2902815639 2902810491 Bacteria 6794147
215 2902817099 2902810491 Bacteria 6794147
216 2913852199 2913844669 Bacteria 8381711
217 2913916577 2913912277 Bacteria 9037797
218 2913946918 2913939268 Bacteria 8559644
219 2922557941 2922554459 Bacteria 6683962
220 2929215768 2929212328 Bacteria 7708288
221 2933022491 2933016740 Bacteria 6355406
222 2937001952 2936996657 Bacteria 6298727
223 2937828012 2937822353 Bacteria 7290551
224 2939585569 2939582691 Bacteria 7088898
225 2953996390 2953994433 Bacteria 4303959
226 2954711603 2954711539 Bacteria 10867210
227 2954740430 2954740390 Bacteria 10229294
228 2954759130 2954749733 Bacteria 10366972
229 2954759456 2954759201 Bacteria 9358192
230 2970053214 2970047711 Bacteria 7088379
231 642601396 642555144 Bacteria 9059191
232 8003403517 8003400568 Bacteria 5535898
233 8033690670 8033684223 Bacteria 6906479
234 8054474246 8054472261 Bacteria 7464355
235 8056453868 8056447290 Bacteria 7680491
236 Ga0213876_10056452
237 JGI24738J21930_10000759
238 Ga0055540_1001949
239 Ga0055540_1002666
240 Ga0055540_1015818
241 Ga0065165_1000035
242 Ga0065712_10075433
243 Ga0070683_100001640
244 Ga0070670_100000354
245 Ga0070677_10006284
246 Ga0070661_100009561
247 Ga0070675_100003514
248 Ga0070671_100001638
249 Ga0070673_100006007
250 Ga0070667_100000059
251 Ga0070713_100000271
252 Ga0070711_100219289
253 Ga0070678_100000010
254 Ga0070662_100073643
255 Ga0068867_100023090
256 Ga0070684_100013765
257 Ga0070672_100000815
258 Ga0070665_100473545
259 Ga0070664_100000179
260 Ga0068854_100001230
261 Ga0068856_100009761
262 Ga0070702_100016130
263 Ga0068852_100000347
264 Ga0068859_100023913
265 Ga0068864_100021000
266 Ga0068864_100362928
267 Ga0068851_10014158
268 Ga0068870_10043367
269 Ga0068858_100081982
270 Ga0068860_100000048
271 Ga0081455_10000278
272 Ga0081539_10000493
273 Ga0075365_10022615
274 Ga0075363_100018801
275 Ga0075363_100033069
276 Ga0075364_10008320
277 Ga0075364_10015670
278 Ga0075369_10002450
279 Ga0075369_10064631
280 Ga0097621_100000056
281 Ga0075370_10014331
282 Ga0075370_10127393
283 Ga0068871_100000488
284 Ga0075430_100144667
285 Ga0068865_100059209
286 Ga0097620_100023913
287 Ga0079104_1003059
288 Ga0105244_10002242
289 Ga0105243_10000203
290 Ga0105242_10420599
291 Ga0105248_10000098
292 Ga0105248_10227681
293 Ga0105237_10245677
294 Ga0105246_10000088
295 Ga0157374_10000816
296 Ga0157375_10000608
297 Ga0182008_10005495
298 Ga0157376_10027868
299 Ga0182006_1000512
300 Ga0182005_1001455
301 Ga0214542_1018842
302 Ga0213872_10000217
303 Ga0213872_10022850
304 Ga0213876_10089872
305 Ga0213875_10009560
306 Ga0228711_1024785
307 Ga0209674_100357
308 Ga0209565_1001827
309 Ga0209051_1000485
310 Ga0209051_1000595
311 Ga0209051_1007095
312 Ga0207655_1002275
313 Ga0207680_10037451
314 Ga0207649_10008716
315 Ga0207650_10018458
316 Ga0207659_10001573
317 Ga0207664_10293465
318 Ga0207644_10001572
319 Ga0207709_10000011
320 Ga0207711_10002636
321 Ga0207661_10004827
322 Ga0207679_10004741
323 Ga0207651_10000114
324 Ga0207640_10001484
325 Ga0207658_10000228
326 Ga0207648_10020036
327 Ga0207676_10009544
328 Ga0207676_10273681
329 Ga0207683_10000810
330 Ga0207698_10005070
331 Ga0209281_1000188
332 Ga0268266_10171816
333 Ga0268264_10000005
334 Ga0265337_1009759
335 Ga0265338_10007869
336 Ga0307513_10040791
337 Ga0307513_10046758
338 Ga0307405_10060714
339 Ga0307405_10080166
340 Ga0307405_10262212
341 Ga0307413_10050866
342 Ga0307413_10054693
343 Ga0307412_10001482
344 Ga0307412_10052457
345 Ga0307416_100187634
346 Ga0373923_0018021
347 Ga0373946_0024702
348 Ga0373937_0038158
349 Ga0395900_0067949
350 Ga0395898_0116248
351 Ga0395905_0000594
352 Ga0395905_0001008
353 Ga0395905_0017458
354 Ga0395905_0224367
355 Ga0436364_0020672
356 Ga0436364_0618299
357 Ga0436364_0662482
358 Ga0436364_0868957
359 Ga0436364_1328598
360 Ga0436364_1526685
361 Ga0436365_0101992
362 Ga0436365_1678077
363 Ga0436360_0883853
364 Ga0436361_0238361
365 Ga0436361_0616410
366 Ga0436361_0931365
367 Ga0439436_0000046
368 Ga0439461_0003029
369 Ga0439466_0000135
370 Ga0439466_0000541
371 Ga0439465_0000157
372 Ga0439465_0002418
373 Ga0439465_0004589
374 Ga0439431_0009152
375 Ga0439445_0003991
376 Ga0450908_000067
377 Ga0466969_0052451
378 Ga0466982_0000088
379 Ga0466965_0004778
380 Ga0466965_0070376
381 Ga0466965_0094676
382 Ga0466966_0043065
383 Ga0466961_0022941
384 Ga0466961_0059914
385 Ga0453684_0240703
386 Ga0466970_0006952
387 Ga0466970_0274220
388 Ga0466960_0001619
389 Ga0466959_0050436
390 Ga0466967_0553067
391 Ga0495590_0004386
392 Ga0495606_0000104
393 Ga0495588_0010647
394 Ga0495670_0000998
395 Ga0495649_0008472
396 Ga0496100_0097293
397 Ga0496102_0000167
398 Ga0496103_0000756
399 Ga0496104_0294387
400 Ga0496108_0002535
401 Ga0496109_0002343
402 Ga0496110_0000037
403 Ga0496111_0190833
404 Ga0496112_0520531
405 Ga0496113_0127776
406 Ga0496114_0203535
407 Ga0496116_0013479
408 Ga0496117_0000447
409 Ga0496118_0000286
410 Ga0496119_0012559
411 Ga0496119_0017635
412 Ga0496121_0024636
413 Ga0496124_0003542
414 Ga0496124_0004325
415 Ga0496125_0001004
416 Ga0496126_0001691
417 Ga0501047_0510504
418 Ga0501070_0008085
419 Ga0501073_0134368
420 Ga0501080_0062908
421 Ga0501279_000339
422 nmdc:mga03n38_2778_c1
423 nmdc:mga00v17_133336_c1
424 nmdc:mga00v17_71077_c1
425 nmdc:mga06z11_136342_c1
426 nmdc:mga07m45_16321_c1
427 nmdc:mga07m45_9051_c2
428 nmdc:mga0sz30_31233_c1
429 nmdc:mga0sz30_478_c1
430 Ga0495601_0143010
431 Ga0500616_0008421
432 2509110078
433 2515612568
434 2537899325
435 2552113000
436 2566996423
437 2585555274
438 2617918584
439 2644636124
440 2786675454
441 2792640683
442 2819689814
443 2819726633
444 2834645277
445 2842921114
446 2857485417
447 2867352473
448 2886629162
449 2902815639
450 2902817099
451 2913852199
452 2913916577
453 2913946918
454 2922557941
455 2929215768
456 2933022491
457 2937001952
458 2937828012
459 2939585569
460 2953996390
461 2954711603
462 2954740430
463 2954759130
464 2954759456
465 2970053214
466 642601396
467 8003403517
468 8033690670
469 8054474246
470 8056453868

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

2

227

0.98

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

232

329

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5g5h-assembly1.cif.gz_B escherichia coli periplasmic aldehyde oxidase r440h mutant 0.9892 1 315
5g5h-assembly1.cif.gz_B escherichia coli periplasmic aldehyde oxidase r440h mutant 0.983 1 315
5y6q-assembly1.cif.gz_B crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9337 1 316
5y6q-assembly1.cif.gz_B crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9224 1 316
1t3q-assembly1.cif.gz_F crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 0.845 4 317
ID Description Score Start End Superfamily
5g5hB02 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.9766 223 315 3.30.390.50
af_P77324_1_53_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9642 1 53 3.30.43.10
5g5hB02 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.9564 223 315 3.30.390.50
af_P77324_1_53_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9467 1 53 3.30.43.10
4zohB01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.917 4 51 3.30.43.10
ID Description Score Start End GO Terms
AF-A0A3A5JKA5-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9995 76 205 GO:0016491
GO:0050660
AF-F3FVU5-F1-model_v4 Molybdopterin dehydrogenase, FAD-binding:CO dehydrogenase 0.9987 70 172 GO:0016491
GO:0050660
AF-A0A531K3U3-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9985 89 216 GO:0016491
GO:0050660
AF-A0A526YID4-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9983 36 186 GO:0016491
GO:0071949
AF-A0A2A2M394-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.9982 38 210 GO:0016491
GO:0071949

Map