F348077

General Info

Members Datasets Scaffolds Average Seq Length
235 109 470 70

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10034664|Ga0114129_100346645
Length 84
Sequence MEWQVVRLQARKTKMSFQHVENLLIRFRGQPVDIKTISGGVYEGTITDVTNDYVTLKVHGADGDTDQVIVLLHSIESILPRSND

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001426 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 Metagenome Rhizosphere
3 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
91 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
92 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
103 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
108 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
109 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.43
Rhizosphere 99.57
Stem 0
Stem Tuber 0
Unclassified 53.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10034664 3300009147 Bacteria 7130
2 JGI24030J14995_100747 3300001426 Unclassified 1084
3 JGI24034J14986_102319 3300001432 Bacteria 992
4 JGI24748J21848_1000005 3300002074 Bacteria 228924
5 JGI24034J26672_10000003 3300002239 Bacteria 501747
6 Ga0065704_10229591 3300005289 Unclassified 1047
7 Ga0065704_10294555 3300005289 Unclassified 886
8 Ga0065715_11182857 3300005293 Unclassified 502
9 Ga0065707_10196844 3300005295 Bacteria 1306
10 Ga0065707_10372702 3300005295 Unclassified 875
11 Ga0070690_100068851 3300005330 Unclassified 2296
12 Ga0070680_100902801 3300005336 Unclassified 762
13 Ga0070680_101216697 3300005336 Unclassified 652
14 Ga0068868_101067905 3300005338 Bacteria 741
15 Ga0070691_10262329 3300005341 Unclassified 930
16 Ga0070691_10723427 3300005341 Unclassified 599
17 Ga0070687_100323199 3300005343 Bacteria 986
18 Ga0070692_10332092 3300005345 Bacteria 939
19 Ga0070692_10674617 3300005345 Unclassified 692
20 Ga0070692_11019298 3300005345 Bacteria 580
21 Ga0070669_100360790 3300005353 Bacteria 1181
22 Ga0070669_101296585 3300005353 Unclassified 630
23 Ga0070671_100019107 3300005355 Bacteria 5573
24 Ga0070674_100075734 3300005356 Unclassified 2391
25 Ga0070673_100043662 3300005364 Bacteria 3465
26 Ga0070705_100589074 3300005440 Bacteria 858
27 Ga0070705_100930663 3300005440 Unclassified 701
28 Ga0070705_101411701 3300005440 Unclassified 581
29 Ga0070700_100127409 3300005441 Bacteria 1713
30 Ga0070700_101127122 3300005441 Unclassified 652
31 Ga0070700_101867364 3300005441 Unclassified 519
32 Ga0070694_100008056 3300005444 Bacteria 6435
33 Ga0070694_100444528 3300005444 Bacteria 1022
34 Ga0070694_100576540 3300005444 Bacteria 903
35 Ga0070708_100098883 3300005445 Unclassified 2668
36 Ga0070708_100208542 3300005445 Unclassified 1831
37 Ga0070708_100381889 3300005445 Bacteria 1328
38 Ga0070708_102161646 3300005445 Unclassified 514
39 Ga0068867_100334699 3300005459 Unclassified 1258
40 Ga0070706_100044324 3300005467 Unclassified 4109
41 Ga0070706_100323970 3300005467 Bacteria 1437
42 Ga0070706_100715288 3300005467 Unclassified 928
43 Ga0070706_100879165 3300005467 Bacteria 828
44 Ga0070706_101883161 3300005467 Unclassified 543
45 Ga0070707_100000295 3300005468 Bacteria 48468
46 Ga0070707_100011719 3300005468 Bacteria 8182
47 Ga0070707_100064264 3300005468 Unclassified 3524
48 Ga0070707_100153658 3300005468 Unclassified 2241
49 Ga0070707_100307551 3300005468 Unclassified 1540
50 Ga0070707_100307557 3300005468 Unclassified 1540
51 Ga0070707_100419033 3300005468 Bacteria 1299
52 Ga0070707_100880085 3300005468 Unclassified 860
53 Ga0070707_100995765 3300005468 Unclassified 803
54 Ga0070698_100003964 3300005471 Bacteria 16286
55 Ga0070698_100071632 3300005471 Unclassified 3475
56 Ga0070698_100148673 3300005471 Unclassified 2291
57 Ga0070698_100238572 3300005471 Unclassified 1751
58 Ga0070698_100281182 3300005471 Unclassified 1595
59 Ga0070698_102113780 3300005471 Unclassified 516
60 Ga0070699_100113006 3300005518 Unclassified 2386
61 Ga0070699_100201854 3300005518 Unclassified 1768
62 Ga0070699_100255805 3300005518 Bacteria 1566
63 Ga0070699_100871684 3300005518 Unclassified 824
64 Ga0070699_101336513 3300005518 Unclassified 657
65 Ga0070697_100017469 3300005536 Bacteria 5645
66 Ga0070697_100044347 3300005536 Unclassified 3601
67 Ga0070697_100044803 3300005536 Bacteria 3583
68 Ga0070697_100876916 3300005536 Unclassified 796
69 Ga0070697_101002197 3300005536 Unclassified 742
70 Ga0070686_100537359 3300005544 Bacteria 912
71 Ga0070695_100086293 3300005545 Unclassified 2085
72 Ga0070695_100434205 3300005545 Bacteria 1003
73 Ga0070695_100766737 3300005545 Unclassified 770
74 Ga0070695_101136631 3300005545 Unclassified 640
75 Ga0070695_101469652 3300005545 Unclassified 566
76 Ga0070695_101508389 3300005545 Unclassified 559
77 Ga0070695_101852062 3300005545 Unclassified 507
78 Ga0070696_101519506 3300005546 Unclassified 574
79 Ga0070696_101669419 3300005546 Unclassified 548
80 Ga0070704_100001388 3300005549 Bacteria 12876
81 Ga0070704_100021191 3300005549 Unclassified 4208
82 Ga0070704_100025524 3300005549 Bacteria 3892
83 Ga0070704_100182527 3300005549 Unclassified 1679
84 Ga0070704_101468164 3300005549 Unclassified 627
85 Ga0070704_101553508 3300005549 Bacteria 609
86 Ga0070704_101676903 3300005549 Unclassified 587
87 Ga0070704_101750858 3300005549 Unclassified 574
88 Ga0068854_100066238 3300005578 Unclassified 2628
89 Ga0070702_101325407 3300005615 Unclassified 585
90 Ga0070702_101477214 3300005615 Unclassified 558
91 Ga0068859_101622073 3300005617 Unclassified 714
92 Ga0068866_10118183 3300005718 Bacteria 1490
93 Ga0068861_100611815 3300005719 Bacteria 1001
94 Ga0068858_100000565 3300005842 Bacteria 38655
95 Ga0068858_100047624 3300005842 Bacteria 3973
96 Ga0068858_100441346 3300005842 Unclassified 1253
97 Ga0070715_10000007 3300006163 Bacteria 192075
98 Ga0070716_100000007 3300006173 Bacteria 256300
99 Ga0070716_100080366 3300006173 Bacteria 1944
100 Ga0070716_100304800 3300006173 Unclassified 1109
101 Ga0070716_100468259 3300006173 Bacteria 922
102 Ga0075433_10059193 3300006852 Bacteria 3351
103 Ga0075433_10201672 3300006852 Bacteria 1769
104 Ga0075433_10735089 3300006852 Bacteria 863
105 Ga0075434_100022674 3300006871 Bacteria 6114
106 Ga0075434_101620766 3300006871 Unclassified 655
107 Ga0075434_102336081 3300006871 Unclassified 537
108 Ga0075434_102554796 3300006871 Bacteria 511
109 Ga0068865_100447181 3300006881 Unclassified 1068
110 Ga0068865_101918523 3300006881 Bacteria 536
111 Ga0075436_100000005 3300006914 Bacteria 360336
112 Ga0075436_100134751 3300006914 Unclassified 1733
113 Ga0097620_101622073 3300006931 Unclassified 714
114 Ga0075435_100000631 3300007076 Bacteria 21613
115 Ga0075435_100897149 3300007076 Unclassified 773
116 Ga0099794_10022702 3300007265 Unclassified 2862
117 Ga0099794_10225010 3300007265 Bacteria 964
118 Ga0099794_10544475 3300007265 Bacteria 613
119 Ga0099795_10104814 3300007788 Unclassified 1114
120 Ga0105240_11352074 3300009093 Unclassified 750
121 Ga0105245_10646763 3300009098 Unclassified 1087
122 Ga0105245_13086223 3300009098 Bacteria 516
123 Ga0105247_10000003 3300009101 Bacteria 694517
124 Ga0105247_10604408 3300009101 Unclassified 814
125 Ga0114129_10039184 3300009147 Bacteria 6682
126 Ga0105243_10001797 3300009148 Bacteria 18411
127 Ga0105243_11227748 3300009148 Unclassified 764
128 Ga0105243_11336960 3300009148 Unclassified 735
129 Ga0105241_10697373 3300009174 Unclassified 926
130 Ga0105242_10005666 3300009176 Bacteria 9639
131 Ga0105242_10017530 3300009176 Bacteria 5582
132 Ga0105242_10808311 3300009176 Bacteria 929
133 Ga0105248_10199059 3300009177 Unclassified 2257
134 Ga0105248_10882314 3300009177 Bacteria 1010
135 Ga0105248_11311233 3300009177 Unclassified 819
136 Ga0105248_12013374 3300009177 Unclassified 656
137 Ga0105249_10139102 3300009553 Unclassified 2326
138 Ga0105249_12550740 3300009553 Unclassified 583
139 Ga0105239_10014155 3300010375 Bacteria 8851
140 Ga0105246_10096074 3300011119 Bacteria 2147
141 Ga0105246_12140664 3300011119 Unclassified 543
142 Ga0157371_10218431 3300013102 Unclassified 1369
143 Ga0157378_10000028 3300013297 Bacteria 128346
144 Ga0157378_10008904 3300013297 Bacteria 8737
145 Ga0157378_10045294 3300013297 Bacteria 3908
146 Ga0157378_10103987 3300013297 Unclassified 2596
147 Ga0157378_10120318 3300013297 Bacteria 2419
148 Ga0157378_10222463 3300013297 Bacteria 1795
149 Ga0157378_11028466 3300013297 Bacteria 859
150 Ga0157378_11852924 3300013297 Unclassified 652
151 Ga0157378_12121238 3300013297 Unclassified 613
152 Ga0163162_10008111 3300013306 Bacteria 10248
153 Ga0163162_10081013 3300013306 Bacteria 3316
154 Ga0163162_11336307 3300013306 Unclassified 815
155 Ga0157375_10054589 3300013308 Unclassified 3935
156 Ga0157375_10065073 3300013308 Bacteria 3633
157 Ga0157375_12250580 3300013308 Bacteria 650
158 Ga0157380_10874500 3300014326 Unclassified 923
159 Ga0157379_10348983 3300014968 Unclassified 1354
160 Ga0163161_10121677 3300017792 Unclassified 1962
161 Ga0163161_10248243 3300017792 Bacteria 1386
162 Ga0207672_1000580 3300025223 Bacteria 4440
163 Ga0207642_10029168 3300025899 Bacteria 2282
164 Ga0207710_10000001 3300025900 Bacteria 1797433
165 Ga0207685_10000007 3300025905 Bacteria 278341
166 Ga0207684_10494464 3300025910 Bacteria 1049
167 Ga0207684_11322743 3300025910 Unclassified 593
168 Ga0207660_11378223 3300025917 Unclassified 572
169 Ga0207662_10185567 3300025918 Bacteria 1340
170 Ga0207662_10352278 3300025918 Bacteria 989
171 Ga0207662_10592612 3300025918 Unclassified 771
172 Ga0207646_10001466 3300025922 Bacteria 29185
173 Ga0207646_10002401 3300025922 Bacteria 22102
174 Ga0207646_10050919 3300025922 Unclassified 3706
175 Ga0207646_10265305 3300025922 Unclassified 1552
176 Ga0207646_10349565 3300025922 Unclassified 1336
177 Ga0207646_10972597 3300025922 Unclassified 751
178 Ga0207646_11001101 3300025922 Unclassified 739
179 Ga0207681_10162905 3300025923 Bacteria 1683
180 Ga0207687_10526934 3300025927 Unclassified 989
181 Ga0207644_10000288 3300025931 Bacteria 33128
182 Ga0207686_10001003 3300025934 Bacteria 16773
183 Ga0207686_10056853 3300025934 Bacteria 2461
184 Ga0207686_11032764 3300025934 Unclassified 668
185 Ga0207709_10000677 3300025935 Bacteria 27520
186 Ga0207709_11200234 3300025935 Unclassified 625
187 Ga0207669_10803770 3300025937 Unclassified 780
188 Ga0207704_10173921 3300025938 Unclassified 1548
189 Ga0207704_11763069 3300025938 Unclassified 532
190 Ga0207665_10000699 3300025939 Bacteria 22745
191 Ga0207665_10050174 3300025939 Bacteria 2805
192 Ga0207665_10096891 3300025939 Bacteria 2053
193 Ga0207689_11182979 3300025942 Unclassified 644
194 Ga0207712_10117393 3300025961 Unclassified 2007
195 Ga0207640_10276070 3300025981 Unclassified 1317
196 Ga0207677_10493223 3300026023 Unclassified 1057
197 Ga0207703_10030082 3300026035 Bacteria 4290
198 Ga0207703_10209301 3300026035 Bacteria 1738
199 Ga0207703_10657519 3300026035 Unclassified 994
200 Ga0207675_100001608 3300026118 Bacteria 22636
201 Ga0207675_101313350 3300026118 Unclassified 744
202 Ga0207675_101937830 3300026118 Unclassified 607
203 Ga0209588_1151322 3300027671 Unclassified 735
204 Ga0209588_1222610 3300027671 Unclassified 583
205 Ga0268264_10881862 3300028381 Unclassified 897
206 Ga0268264_11733070 3300028381 Unclassified 635
207 Ga0373924_0280709 3300035410 Unclassified 739
208 Ga0242422_09478 3300038699 Bacteria 566
209 Ga0242420_074168 3300038996 Bacteria 695
210 Ga0451577_0162190 3300042876 Unclassified 2013
211 Ga0453683_0024495 3300044673 Bacteria 3838
212 Ga0453684_0147075 3300044712 Bacteria 2805
213 Ga0451576_0007883 3300045051 Bacteria 12617
214 Ga0495639_0199165 3300046475 Unclassified 980
215 Ga0495630_0705767 3300046517 Unclassified 772
216 Ga0495652_0423466 3300046529 Unclassified 938
217 Ga0495634_0414834 3300046642 Unclassified 798
218 Ga0495613_0299776 3300046689 Bacteria 1113
219 Ga0495624_0511862 3300046690 Unclassified 718
220 Ga0495636_0010070 3300047318 Bacteria 3730
221 Ga0496106_0010524 3300048909 Bacteria 6832
222 nmdc:mga05p37_1093728_c1 3300050507 Bacteria 836
223 nmdc:mga05p37_33391_c1 3300050507 Bacteria 6303
224 nmdc:mga0n895_1043244_c1 3300050512 Unclassified 797
225 nmdc:mga0n895_1780267_c1 3300050512 Unclassified 577
226 nmdc:mga0n895_611794_c1 3300050512 Bacteria 1091
227 nmdc:mga0n895_61371_c1 3300050512 Bacteria 3711
228 nmdc:mga0rr50_172_c1 3300050513 Bacteria 34462
229 nmdc:mga0rr50_619404_c1 3300050513 Bacteria 923
230 nmdc:mga0rr50_901245_c1 3300050513 Bacteria 754
231 nmdc:mga08x19_346310_c1 3300050514 Unclassified 1037
232 nmdc:mga08x19_5_c1 3300050514 Bacteria 464292
233 nmdc:mga0a205_1599829_c1 3300050515 Bacteria 500
234 nmdc:mga0a205_52021_c1 3300050515 Unclassified 3953
235 nmdc:mga0a205_640603_c1 3300050515 Bacteria 914
236 Ga0114129_10034664
237 JGI24030J14995_100747
238 JGI24034J14986_102319
239 JGI24748J21848_1000005
240 JGI24034J26672_10000003
241 Ga0065704_10229591
242 Ga0065704_10294555
243 Ga0065715_11182857
244 Ga0065707_10196844
245 Ga0065707_10372702
246 Ga0070690_100068851
247 Ga0070680_100902801
248 Ga0070680_101216697
249 Ga0068868_101067905
250 Ga0070691_10262329
251 Ga0070691_10723427
252 Ga0070687_100323199
253 Ga0070692_10332092
254 Ga0070692_10674617
255 Ga0070692_11019298
256 Ga0070669_100360790
257 Ga0070669_101296585
258 Ga0070671_100019107
259 Ga0070674_100075734
260 Ga0070673_100043662
261 Ga0070705_100589074
262 Ga0070705_100930663
263 Ga0070705_101411701
264 Ga0070700_100127409
265 Ga0070700_101127122
266 Ga0070700_101867364
267 Ga0070694_100008056
268 Ga0070694_100444528
269 Ga0070694_100576540
270 Ga0070708_100098883
271 Ga0070708_100208542
272 Ga0070708_100381889
273 Ga0070708_102161646
274 Ga0068867_100334699
275 Ga0070706_100044324
276 Ga0070706_100323970
277 Ga0070706_100715288
278 Ga0070706_100879165
279 Ga0070706_101883161
280 Ga0070707_100000295
281 Ga0070707_100011719
282 Ga0070707_100064264
283 Ga0070707_100153658
284 Ga0070707_100307551
285 Ga0070707_100307557
286 Ga0070707_100419033
287 Ga0070707_100880085
288 Ga0070707_100995765
289 Ga0070698_100003964
290 Ga0070698_100071632
291 Ga0070698_100148673
292 Ga0070698_100238572
293 Ga0070698_100281182
294 Ga0070698_102113780
295 Ga0070699_100113006
296 Ga0070699_100201854
297 Ga0070699_100255805
298 Ga0070699_100871684
299 Ga0070699_101336513
300 Ga0070697_100017469
301 Ga0070697_100044347
302 Ga0070697_100044803
303 Ga0070697_100876916
304 Ga0070697_101002197
305 Ga0070686_100537359
306 Ga0070695_100086293
307 Ga0070695_100434205
308 Ga0070695_100766737
309 Ga0070695_101136631
310 Ga0070695_101469652
311 Ga0070695_101508389
312 Ga0070695_101852062
313 Ga0070696_101519506
314 Ga0070696_101669419
315 Ga0070704_100001388
316 Ga0070704_100021191
317 Ga0070704_100025524
318 Ga0070704_100182527
319 Ga0070704_101468164
320 Ga0070704_101553508
321 Ga0070704_101676903
322 Ga0070704_101750858
323 Ga0068854_100066238
324 Ga0070702_101325407
325 Ga0070702_101477214
326 Ga0068859_101622073
327 Ga0068866_10118183
328 Ga0068861_100611815
329 Ga0068858_100000565
330 Ga0068858_100047624
331 Ga0068858_100441346
332 Ga0070715_10000007
333 Ga0070716_100000007
334 Ga0070716_100080366
335 Ga0070716_100304800
336 Ga0070716_100468259
337 Ga0075433_10059193
338 Ga0075433_10201672
339 Ga0075433_10735089
340 Ga0075434_100022674
341 Ga0075434_101620766
342 Ga0075434_102336081
343 Ga0075434_102554796
344 Ga0068865_100447181
345 Ga0068865_101918523
346 Ga0075436_100000005
347 Ga0075436_100134751
348 Ga0097620_101622073
349 Ga0075435_100000631
350 Ga0075435_100897149
351 Ga0099794_10022702
352 Ga0099794_10225010
353 Ga0099794_10544475
354 Ga0099795_10104814
355 Ga0105240_11352074
356 Ga0105245_10646763
357 Ga0105245_13086223
358 Ga0105247_10000003
359 Ga0105247_10604408
360 Ga0114129_10039184
361 Ga0105243_10001797
362 Ga0105243_11227748
363 Ga0105243_11336960
364 Ga0105241_10697373
365 Ga0105242_10005666
366 Ga0105242_10017530
367 Ga0105242_10808311
368 Ga0105248_10199059
369 Ga0105248_10882314
370 Ga0105248_11311233
371 Ga0105248_12013374
372 Ga0105249_10139102
373 Ga0105249_12550740
374 Ga0105239_10014155
375 Ga0105246_10096074
376 Ga0105246_12140664
377 Ga0157371_10218431
378 Ga0157378_10000028
379 Ga0157378_10008904
380 Ga0157378_10045294
381 Ga0157378_10103987
382 Ga0157378_10120318
383 Ga0157378_10222463
384 Ga0157378_11028466
385 Ga0157378_11852924
386 Ga0157378_12121238
387 Ga0163162_10008111
388 Ga0163162_10081013
389 Ga0163162_11336307
390 Ga0157375_10054589
391 Ga0157375_10065073
392 Ga0157375_12250580
393 Ga0157380_10874500
394 Ga0157379_10348983
395 Ga0163161_10121677
396 Ga0163161_10248243
397 Ga0207672_1000580
398 Ga0207642_10029168
399 Ga0207710_10000001
400 Ga0207685_10000007
401 Ga0207684_10494464
402 Ga0207684_11322743
403 Ga0207660_11378223
404 Ga0207662_10185567
405 Ga0207662_10352278
406 Ga0207662_10592612
407 Ga0207646_10001466
408 Ga0207646_10002401
409 Ga0207646_10050919
410 Ga0207646_10265305
411 Ga0207646_10349565
412 Ga0207646_10972597
413 Ga0207646_11001101
414 Ga0207681_10162905
415 Ga0207687_10526934
416 Ga0207644_10000288
417 Ga0207686_10001003
418 Ga0207686_10056853
419 Ga0207686_11032764
420 Ga0207709_10000677
421 Ga0207709_11200234
422 Ga0207669_10803770
423 Ga0207704_10173921
424 Ga0207704_11763069
425 Ga0207665_10000699
426 Ga0207665_10050174
427 Ga0207665_10096891
428 Ga0207689_11182979
429 Ga0207712_10117393
430 Ga0207640_10276070
431 Ga0207677_10493223
432 Ga0207703_10030082
433 Ga0207703_10209301
434 Ga0207703_10657519
435 Ga0207675_100001608
436 Ga0207675_101313350
437 Ga0207675_101937830
438 Ga0209588_1151322
439 Ga0209588_1222610
440 Ga0268264_10881862
441 Ga0268264_11733070
442 Ga0373924_0280709
443 Ga0242422_09478
444 Ga0242420_074168
445 Ga0451577_0162190
446 Ga0453683_0024495
447 Ga0453684_0147075
448 Ga0451576_0007883
449 Ga0495639_0199165
450 Ga0495630_0705767
451 Ga0495652_0423466
452 Ga0495634_0414834
453 Ga0495613_0299776
454 Ga0495624_0511862
455 Ga0495636_0010070
456 Ga0496106_0010524
457 nmdc:mga05p37_1093728_c1
458 nmdc:mga05p37_33391_c1
459 nmdc:mga0n895_1043244_c1
460 nmdc:mga0n895_1780267_c1
461 nmdc:mga0n895_611794_c1
462 nmdc:mga0n895_61371_c1
463 nmdc:mga0rr50_172_c1
464 nmdc:mga0rr50_619404_c1
465 nmdc:mga0rr50_901245_c1
466 nmdc:mga08x19_346310_c1
467 nmdc:mga08x19_5_c1
468 nmdc:mga0a205_1599829_c1
469 nmdc:mga0a205_52021_c1
470 nmdc:mga0a205_640603_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g9k-assembly1.cif.gz_B structure of the ndi1 protein from saccharomyces cerevisiae 0.9329 31 57
5gl6-assembly2.cif.gz_B msmeg rimp 0.907 7 66
5yjw-assembly1.cif.gz_A-2 structure of the ndi1 protein from saccharomyces cerevisiae in complex with the competitive inhibitor, stigmatellin. 0.9029 31 57
5yjx-assembly1.cif.gz_B structure of the ndi1 protein from saccharomyces cerevisiae in complex with myxothiazol. 0.894 31 57
4g74-assembly1.cif.gz_A crystal structure of ndh with quinone 0.8768 31 57
ID Description Score Start End Superfamily
af_O14121_86_550_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9451 32 57 3.50.50.100
af_A0A1D6QHU6_7_108_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.928 32 57 3.30.200.20
af_K7TWK5_13_113_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9087 32 57 3.30.200.20
af_Q5JNH7_6_101_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9069 32 57 3.30.200.20
af_A0A1D6QLW9_57_164_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9069 32 57 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A1R1AF86-F1-model_v4 Uncharacterized protein 0.9758 4 66
AF-A0A1G8Z5B8-F1-model_v4 Uncharacterized protein 0.9737 7 69 GO:0016020
AF-K4ZEU2-F1-model_v4 deleted 0.9684 6 47
AF-A0A1Q8TT06-F1-model_v4 deleted 0.9674 6 66
AF-A0A1G7PZ54-F1-model_v4 Uncharacterized protein 0.9672 7 64

Map