F348034

General Info

Members Datasets Scaffolds Average Seq Length
235 126 235 333

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100050819|Ga0075436_1000508192
Length 383
Sequence MAWPVYKHFVPNGTVEARSRVLKQALQPTAPAAHREVCNVYSTRTLTQTRPDRGVMFAGAVVACGVTAAVLASWLPLQVSILTVFLFAGPHNWFEFRYFLMRLPARFGRSRNFFLTAFTGLALLTISYISLPFIYEHATWSSETWLTVLATWNTLLLASLVALIHLRGKQKRSRTSKLQRTFGGSQRRTSDWTWXVPXXXXLAALNWIGPEFFSLALVYVHPLIALWFLDRQLQRTRPEWVSTYRRCLSLLPVLLALMIWRLSQTTALADDNGLFWRITQHSGAQLLPQVSSHMLVSVHLFLEMLHYGVWIVALPLIAPQFWNFQTARKGFPRLTPALLMLGALAVVVLWIGFSRDYTQTRDLYFTIAIAHVLAEAPFLLKML

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
104 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
105 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
106 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
113 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
117 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
118 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
119 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.28
Rhizosphere 98.3
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_7509503 2162886012 Unclassified 1310
2 JGI24751J29686_10000013 3300002459 Bacteria 113565
3 rootH2_10065354 3300003320 Bacteria 2312
4 Ga0065704_10012513 3300005289 Bacteria 1984
5 Ga0065704_10104828 3300005289 Bacteria 2128
6 Ga0065715_10101906 3300005293 Bacteria 3160
7 Ga0065707_10000570 3300005295 Bacteria 27297
8 Ga0065707_10013226 3300005295 Bacteria 2431
9 Ga0065707_10123268 3300005295 Bacteria 2069
10 Ga0070690_100006338 3300005330 Bacteria 6708
11 Ga0070670_100006480 3300005331 Bacteria 9906
12 Ga0070670_100006547 3300005331 Bacteria 9866
13 Ga0068869_100065771 3300005334 Unclassified 2670
14 Ga0070680_100116313 3300005336 Bacteria 2229
15 Ga0070687_100114361 3300005343 Bacteria 1533
16 Ga0070669_100040594 3300005353 Bacteria 3382
17 Ga0070673_100007812 3300005364 Bacteria 7083
18 Ga0070701_10050785 3300005438 Unclassified 2149
19 Ga0070705_100045104 3300005440 Bacteria 2535
20 Ga0070705_100062789 3300005440 Bacteria 2213
21 Ga0070700_100000419 3300005441 Bacteria 21699
22 Ga0070700_100019430 3300005441 Bacteria 3921
23 Ga0070700_100029339 3300005441 Bacteria 3279
24 Ga0070694_100023849 3300005444 Unclassified 3941
25 Ga0070694_100065668 3300005444 Bacteria 2487
26 Ga0070694_100106400 3300005444 Unclassified 1992
27 Ga0070694_100132074 3300005444 Unclassified 1805
28 Ga0070662_100015822 3300005457 Bacteria 5059
29 Ga0070662_100186571 3300005457 Bacteria 1637
30 Ga0070681_10001808 3300005458 Bacteria 19247
31 Ga0070681_10010148 3300005458 Bacteria 9288
32 Ga0068867_100062920 3300005459 Bacteria 2758
33 Ga0068867_100112104 3300005459 Unclassified 2097
34 Ga0070706_100000019 3300005467 Bacteria 166483
35 Ga0070707_100061204 3300005468 Bacteria 3610
36 Ga0070707_100093701 3300005468 Bacteria 2908
37 Ga0070707_100315957 3300005468 Unclassified 1518
38 Ga0070698_100000593 3300005471 Bacteria 38912
39 Ga0070698_100024454 3300005471 Bacteria 6302
40 Ga0070698_100060268 3300005471 Bacteria 3829
41 Ga0070699_100075076 3300005518 Bacteria 2942
42 Ga0070699_100132466 3300005518 Bacteria 2198
43 Ga0070697_100207290 3300005536 Unclassified 1668
44 Ga0070686_100004406 3300005544 Bacteria 7767
45 Ga0070686_100018784 3300005544 Bacteria 4064
46 Ga0070686_100041882 3300005544 Bacteria 2865
47 Ga0070686_100078954 3300005544 Bacteria 2174
48 Ga0070695_100174619 3300005545 Unclassified 1518
49 Ga0070696_100024951 3300005546 Unclassified 4063
50 Ga0070696_100045682 3300005546 Bacteria 3035
51 Ga0070696_100124815 3300005546 Bacteria 1867
52 Ga0070693_100109884 3300005547 Bacteria 1694
53 Ga0070665_100415348 3300005548 Bacteria 1354
54 Ga0070704_100153899 3300005549 Unclassified 1811
55 Ga0070664_100006947 3300005564 Bacteria 9122
56 Ga0068857_100016002 3300005577 Bacteria 6570
57 Ga0068857_100139287 3300005577 Bacteria 2192
58 Ga0068857_100214983 3300005577 Bacteria 1755
59 Ga0068854_100083462 3300005578 Bacteria 2362
60 Ga0068854_100245619 3300005578 Unclassified 1427
61 Ga0068859_100110775 3300005617 Bacteria 2807
62 Ga0068859_100182349 3300005617 Bacteria 2182
63 Ga0068859_100475887 3300005617 Unclassified 1344
64 Ga0068864_100036963 3300005618 Unclassified 4164
65 Ga0068864_100056235 3300005618 Bacteria 3399
66 Ga0068864_100097933 3300005618 Bacteria 2597
67 Ga0068861_100041819 3300005719 Unclassified 3434
68 Ga0068861_100134178 3300005719 Unclassified 2013
69 Ga0068861_100366982 3300005719 Unclassified 1268
70 Ga0068870_10108392 3300005840 Unclassified 1581
71 Ga0068863_100169648 3300005841 Bacteria 2093
72 Ga0068863_100276735 3300005841 Bacteria 1625
73 Ga0068858_100019255 3300005842 Bacteria 6383
74 Ga0068860_100006350 3300005843 Bacteria 11864
75 Ga0068860_100043766 3300005843 Bacteria 4269
76 Ga0068860_100065071 3300005843 Bacteria 3463
77 Ga0068860_100081701 3300005843 Bacteria 3073
78 Ga0068860_100102842 3300005843 Bacteria 2726
79 Ga0068862_100008354 3300005844 Bacteria 8567
80 Ga0068862_100023682 3300005844 Bacteria 5146
81 Ga0068862_100222305 3300005844 Bacteria 1710
82 Ga0081539_10001547 3300005985 Bacteria 38393
83 Ga0070715_10000024 3300006163 Bacteria 110647
84 Ga0075430_100043108 3300006846 Bacteria 3813
85 Ga0075431_100014352 3300006847 Bacteria 8012
86 Ga0075433_10012626 3300006852 Bacteria 6833
87 Ga0075433_10034697 3300006852 Bacteria 4335
88 Ga0075433_10057081 3300006852 Bacteria 3412
89 Ga0075433_10337634 3300006852 Unclassified 1332
90 Ga0075433_10393439 3300006852 Bacteria 1223
91 Ga0075434_100046482 3300006871 Bacteria 4308
92 Ga0075434_100062433 3300006871 Bacteria 3708
93 Ga0075436_100050819 3300006914 Bacteria 2861
94 Ga0097620_100110775 3300006931 Bacteria 2807
95 Ga0097620_100182353 3300006931 Bacteria 2182
96 Ga0097620_100475899 3300006931 Unclassified 1344
97 Ga0075435_100148463 3300007076 Bacteria 1970
98 Ga0111539_10019915 3300009094 Bacteria 8265
99 Ga0111539_10033273 3300009094 Bacteria 6260
100 Ga0105247_10002352 3300009101 Bacteria 12889
101 Ga0105247_10092440 3300009101 Bacteria 1922
102 Ga0105247_10105680 3300009101 Bacteria 1805
103 Ga0114129_10007368 3300009147 Bacteria 15662
104 Ga0114129_10039728 3300009147 Bacteria 6636
105 Ga0114129_10110758 3300009147 Unclassified 3789
106 Ga0114129_10466687 3300009147 Bacteria 1654
107 Ga0114129_10523816 3300009147 Bacteria 1545
108 Ga0114129_10873505 3300009147 Bacteria 1141
109 Ga0105241_10139501 3300009174 Unclassified 1972
110 Ga0105241_10191640 3300009174 Unclassified 1702
111 Ga0105241_10253957 3300009174 Unclassified 1492
112 Ga0105242_10076306 3300009176 Bacteria 2794
113 Ga0105248_10004161 3300009177 Bacteria 16001
114 Ga0105248_10101823 3300009177 Bacteria 3237
115 Ga0105248_10292788 3300009177 Bacteria 1833
116 Ga0105238_10006165 3300009551 Bacteria 11902
117 Ga0105249_10000136 3300009553 Bacteria 96659
118 Ga0105249_10012050 3300009553 Bacteria 7612
119 Ga0105249_10080337 3300009553 Bacteria 3029
120 Ga0105249_10083552 3300009553 Bacteria 2973
121 Ga0105249_10162822 3300009553 Bacteria 2157
122 Ga0105246_10080019 3300011119 Unclassified 2325
123 Ga0105246_10119274 3300011119 Bacteria 1952
124 Ga0157373_10012282 3300013100 Bacteria 6295
125 Ga0157373_10016833 3300013100 Bacteria 5331
126 Ga0157378_10009942 3300013297 Bacteria 8295
127 Ga0157378_10145953 3300013297 Bacteria 2201
128 Ga0157378_10269635 3300013297 Unclassified 1637
129 Ga0163162_10000506 3300013306 Bacteria 36273
130 Ga0163162_10019883 3300013306 Bacteria 6595
131 Ga0163162_10039473 3300013306 Unclassified 4718
132 Ga0163162_10067397 3300013306 Bacteria 3630
133 Ga0157372_10227775 3300013307 Bacteria 2161
134 Ga0157372_10340089 3300013307 Bacteria 1748
135 Ga0157375_10258691 3300013308 Bacteria 1902
136 Ga0163163_10000979 3300014325 Bacteria 24235
137 Ga0163163_10035147 3300014325 Bacteria 4860
138 Ga0163163_10109449 3300014325 Bacteria 2790
139 Ga0163163_10243060 3300014325 Bacteria 1850
140 Ga0157380_10000611 3300014326 Bacteria 22035
141 Ga0157380_10078187 3300014326 Bacteria 2698
142 Ga0157380_10253623 3300014326 Bacteria 1594
143 Ga0157380_10273541 3300014326 Bacteria 1541
144 Ga0157379_10287662 3300014968 Bacteria 1496
145 Ga0157379_10502178 3300014968 Bacteria 1124
146 Ga0207653_10034053 3300025885 Bacteria 1654
147 Ga0207710_10002172 3300025900 Bacteria 9220
148 Ga0207685_10000018 3300025905 Bacteria 145715
149 Ga0207643_10049903 3300025908 Bacteria 2372
150 Ga0207643_10121496 3300025908 Unclassified 1548
151 Ga0207684_10256579 3300025910 Unclassified 1509
152 Ga0207707_10035906 3300025912 Bacteria 4334
153 Ga0207662_10003740 3300025918 Bacteria 7882
154 Ga0207662_10181606 3300025918 Bacteria 1354
155 Ga0207649_10005488 3300025920 Bacteria 6862
156 Ga0207646_10270750 3300025922 Unclassified 1535
157 Ga0207694_10167082 3300025924 Bacteria 1780
158 Ga0207650_10000001 3300025925 Bacteria 1545726
159 Ga0207686_10080445 3300025934 Bacteria 2124
160 Ga0207709_10012168 3300025935 Bacteria 4742
161 Ga0207670_10002900 3300025936 Bacteria 9057
162 Ga0207670_10067493 3300025936 Bacteria 2461
163 Ga0207665_10106258 3300025939 Bacteria 1967
164 Ga0207711_10008277 3300025941 Bacteria 8705
165 Ga0207711_10028780 3300025941 Bacteria 4679
166 Ga0207689_10009527 3300025942 Bacteria 8381
167 Ga0207689_10057090 3300025942 Unclassified 3212
168 Ga0207651_10004362 3300025960 Bacteria 7116
169 Ga0207651_10113691 3300025960 Bacteria 2038
170 Ga0207651_10377959 3300025960 Unclassified 1200
171 Ga0207712_10001254 3300025961 Bacteria 17532
172 Ga0207640_10178886 3300025981 Unclassified 1588
173 Ga0207703_10056113 3300026035 Bacteria 3207
174 Ga0207703_10246871 3300026035 Bacteria 1607
175 Ga0207639_10183292 3300026041 Bacteria 1783
176 Ga0207708_10007884 3300026075 Bacteria 7890
177 Ga0207708_10046561 3300026075 Bacteria 3302
178 Ga0207641_10140497 3300026088 Bacteria 2178
179 Ga0207648_10074004 3300026089 Bacteria 2969
180 Ga0207648_10110264 3300026089 Bacteria 2416
181 Ga0207648_10132732 3300026089 Unclassified 2192
182 Ga0207676_10002236 3300026095 Bacteria 13904
183 Ga0207676_10029600 3300026095 Bacteria 4102
184 Ga0207676_10084175 3300026095 Unclassified 2592
185 Ga0207676_10209173 3300026095 Bacteria 1730
186 Ga0207674_10000857 3300026116 Bacteria 39747
187 Ga0207674_10055725 3300026116 Bacteria 4017
188 Ga0207674_10192427 3300026116 Unclassified 1990
189 Ga0207675_100004268 3300026118 Bacteria 13813
190 Ga0207675_100021799 3300026118 Bacteria 5964
191 Ga0207675_100023428 3300026118 Bacteria 5743
192 Ga0207675_100047903 3300026118 Bacteria 3990
193 Ga0207675_100072792 3300026118 Bacteria 3214
194 Ga0207675_100075424 3300026118 Bacteria 3157
195 Ga0207675_100313121 3300026118 Bacteria 1531
196 Ga0207428_10022738 3300027907 Bacteria 5286
197 Ga0268265_10006457 3300028380 Bacteria 7948
198 Ga0268264_10013293 3300028381 Bacteria 6778
199 Ga0268264_10040820 3300028381 Bacteria 3834
200 Ga0268264_10074044 3300028381 Bacteria 2892
201 Ga0268264_10131789 3300028381 Bacteria 2217
202 Ga0265319_1002213 3300028563 Bacteria 10823
203 Ga0265320_10009658 3300031240 Bacteria 5800
204 Ga0307414_10032193 3300032004 Bacteria 3450
205 Ga0373951_0000390 3300035091 Bacteria 13036
206 Ga0373942_0007751 3300035207 Bacteria 2495
207 Ga0242420_004860 3300038996 Bacteria 2054
208 Ga0439458_0025113 3300042157 Bacteria 1396
209 Ga0451576_0135447 3300045051 Unclassified 2568
210 Ga0495621_0009032 3300046539 Bacteria 3011
211 Ga0496104_0078113 3300048907 Unclassified 3154
212 Ga0496106_0183877 3300048909 Unclassified 1660
213 Ga0496112_0345510 3300048915 Bacteria 1431
214 Ga0501297_003955 3300049520 Unclassified 1499
215 Ga0501298_006589 3300049521 Unclassified 1902
216 Ga0501038_0016698 3300049574 Bacteria 6651
217 Ga0501048_0177421 3300049582 Bacteria 1510
218 Ga0501250_010454 3300049680 Bacteria 1065
219 Ga0501261_013771 3300049690 Bacteria 1101
220 Ga0501272_003199 3300049769 Bacteria 1654
221 Ga0501273_010741 3300049770 Unclassified 1130
222 nmdc:mga05p37_11614_c1 3300050507 Bacteria 10495
223 nmdc:mga05p37_124906_c1 3300050507 Bacteria 2551
224 nmdc:mga05p37_320583_c1 3300050507 Bacteria 1834
225 nmdc:mga09592_211597_c1 3300050508 Bacteria 1680
226 nmdc:mga0qj67_13101_c1 3300050509 Bacteria 6262
227 nmdc:mga08y16_3263_c1 3300050511 Bacteria 16797
228 nmdc:mga0n895_48494_c1 3300050512 Bacteria 4157
229 nmdc:mga0n895_71448_c1 3300050512 Unclassified 3441
230 nmdc:mga08x19_42120_c1 3300050514 Bacteria 2910
231 nmdc:mga0a205_105747_c1 3300050515 Bacteria 2713
232 nmdc:mga0a205_141098_c1 3300050515 Bacteria 2310
233 nmdc:mga0a205_207481_c1 3300050515 Unclassified 1848
234 nmdc:mga0a205_7129_c2 3300050515 Bacteria 4017
235 nmdc:mga0a205_8229_c1 3300050515 Bacteria 9479

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049680 Ga0501250_010454 Ga0501250_010454_50_919 275
2 3300009553 Ga0105249_10012050 Ga0105249_100120507 284
3 3300009094 Ga0111539_10019915 Ga0111539_100199159 287
4 3300009553 Ga0105249_10162822 Ga0105249_101628222 287
5 3300014326 Ga0157380_10253623 Ga0157380_102536232 287
6 3300050511 nmdc:mga08y16_3263_c1 nmdc:mga08y16_3263_c1_13323_14282 287
7 3300050507 nmdc:mga05p37_124906_c1 nmdc:mga05p37_124906_c1_301_1281 288
8 3300050515 nmdc:mga0a205_7129_c2 nmdc:mga0a205_7129_c2_2510_3490 288
9 3300049520 Ga0501297_003955 Ga0501297_003955_460_1434 289
10 3300049690 Ga0501261_013771 Ga0501261_013771_23_997 289
11 3300049770 Ga0501273_010741 Ga0501273_010741_144_1118 289
12 3300005577 Ga0068857_100016002 Ga0068857_1000160026 290
13 3300013100 Ga0157373_10016833 Ga0157373_100168332 290
14 3300014325 Ga0163163_10035147 Ga0163163_100351473 290
15 3300049574 Ga0501038_0016698 Ga0501038_0016698_779_1780 294
16 3300050515 nmdc:mga0a205_141098_c1 nmdc:mga0a205_141098_c1_506_1435 295
17 3300005440 Ga0070705_100045104 Ga0070705_1000451043 296
18 3300006852 Ga0075433_10057081 Ga0075433_100570811 296
19 3300035207 Ga0373942_0007751 Ga0373942_0007751_264_1256 296
20 3300013100 Ga0157373_10012282 Ga0157373_100122826 297
21 3300014968 Ga0157379_10502178 Ga0157379_105021781 298
22 3300050514 nmdc:mga08x19_42120_c1 nmdc:mga08x19_42120_c1_859_1845 298
23 3300009101 Ga0105247_10092440 Ga0105247_100924402 299
24 3300005457 Ga0070662_100186571 Ga0070662_1001865712 300
25 3300009101 Ga0105247_10002352 Ga0105247_1000235212 301
26 3300009176 Ga0105242_10076306 Ga0105242_100763063 301
27 3300005841 Ga0068863_100169648 Ga0068863_1001696482 302
28 3300009101 Ga0105247_10105680 Ga0105247_101056803 302
29 3300009147 Ga0114129_10110758 Ga0114129_101107584 302
30 3300032004 Ga0307414_10032193 Ga0307414_100321934 303
31 3300049521 Ga0501298_006589 Ga0501298_006589_92_1111 303
32 3300049769 Ga0501272_003199 Ga0501272_003199_388_1407 303
33 3300005289 Ga0065704_10012513 Ga0065704_100125132 304
34 3300005295 Ga0065707_10000570 Ga0065707_1000057022 304
35 3300027907 Ga0207428_10022738 Ga0207428_100227386 304
36 3300013306 Ga0163162_10000506 Ga0163162_1000050624 306
37 3300013307 Ga0157372_10227775 Ga0157372_102277752 306
38 3300014968 Ga0157379_10287662 Ga0157379_102876622 306
39 3300002459 JGI24751J29686_10000013 JGI24751J29686_1000001316 307
40 3300005331 Ga0070670_100006480 Ga0070670_10000648012 307
41 3300009551 Ga0105238_10006165 Ga0105238_100061656 307
42 3300011119 Ga0105246_10119274 Ga0105246_101192742 307
43 3300048915 Ga0496112_0345510 Ga0496112_0345510_300_1265 307
44 3300005577 Ga0068857_100214983 Ga0068857_1002149832 308
45 3300026116 Ga0207674_10192427 Ga0207674_101924273 308
46 3300035091 Ga0373951_0000390 Ga0373951_0000390_6988_8013 308
47 3300005343 Ga0070687_100114361 Ga0070687_1001143611 309
48 3300005353 Ga0070669_100040594 Ga0070669_1000405942 309
49 3300005441 Ga0070700_100029339 Ga0070700_1000293392 309
50 3300005459 Ga0068867_100062920 Ga0068867_1000629203 309
51 3300005719 Ga0068861_100041819 Ga0068861_1000418192 309
52 3300005844 Ga0068862_100008354 Ga0068862_1000083546 309
53 3300009147 Ga0114129_10466687 Ga0114129_104666872 309
54 3300009177 Ga0105248_10004161 Ga0105248_1000416112 309
55 3300009553 Ga0105249_10083552 Ga0105249_100835522 309
56 3300014326 Ga0157380_10000611 Ga0157380_1000061114 309
57 3300025941 Ga0207711_10008277 Ga0207711_100082773 309
58 3300026089 Ga0207648_10074004 Ga0207648_100740043 309
59 3300026118 Ga0207675_100021799 Ga0207675_1000217995 309
60 3300028380 Ga0268265_10006457 Ga0268265_100064576 309
61 3300005471 Ga0070698_100000593 Ga0070698_10000059317 310
62 3300005458 Ga0070681_10010148 Ga0070681_100101484 311
63 3300025912 Ga0207707_10035906 Ga0207707_100359063 311
64 3300006846 Ga0075430_100043108 Ga0075430_1000431085 312
65 3300006847 Ga0075431_100014352 Ga0075431_1000143521 312
66 3300025918 Ga0207662_10181606 Ga0207662_101816061 312
67 3300050508 nmdc:mga09592_211597_c1 nmdc:mga09592_211597_c1_211_1197 312
68 3300050509 nmdc:mga0qj67_13101_c1 nmdc:mga0qj67_13101_c1_1470_2456 312
69 3300005444 Ga0070694_100023849 Ga0070694_1000238493 314
70 3300005546 Ga0070696_100024951 Ga0070696_1000249516 314
71 3300006852 Ga0075433_10012626 Ga0075433_100126266 314
72 3300006871 Ga0075434_100046482 Ga0075434_1000464822 314
73 3300009174 Ga0105241_10139501 Ga0105241_101395012 314
74 3300026118 Ga0207675_100313121 Ga0207675_1003131212 314
75 3300005471 Ga0070698_100024454 Ga0070698_1000244543 316
76 3300005547 Ga0070693_100109884 Ga0070693_1001098842 316
77 3300005577 Ga0068857_100139287 Ga0068857_1001392873 316
78 3300005618 Ga0068864_100056235 Ga0068864_1000562352 316
79 3300026095 Ga0207676_10029600 Ga0207676_100296004 316
80 3300042157 Ga0439458_0025113 Ga0439458_0025113_55_1083 317
81 3300005441 Ga0070700_100000419 Ga0070700_10000041915 318
82 3300013297 Ga0157378_10009942 Ga0157378_100099429 318
83 3300026118 Ga0207675_100004268 Ga0207675_1000042688 319
84 3300005331 Ga0070670_100006547 Ga0070670_1000065475 320
85 3300005468 Ga0070707_100315957 Ga0070707_1003159571 320
86 3300005471 Ga0070698_100060268 Ga0070698_1000602682 320
87 3300005518 Ga0070699_100132466 Ga0070699_1001324663 320
88 3300006163 Ga0070715_10000024 Ga0070715_1000002494 320
89 3300006852 Ga0075433_10034697 Ga0075433_100346974 320
90 3300009147 Ga0114129_10007368 Ga0114129_1000736813 320
91 3300014325 Ga0163163_10000979 Ga0163163_1000097913 320
92 3300025905 Ga0207685_10000018 Ga0207685_1000001890 320
93 3300025925 Ga0207650_10000001 Ga0207650_1000000166 320
94 3300050507 nmdc:mga05p37_11614_c1 nmdc:mga05p37_11614_c1_1039_2094 320
95 3300050515 nmdc:mga0a205_8229_c1 nmdc:mga0a205_8229_c1_1362_2417 320
96 3300005844 Ga0068862_100222305 Ga0068862_1002223052 321
97 3300005985 Ga0081539_10001547 Ga0081539_1000154729 321
98 3300025908 Ga0207643_10121496 Ga0207643_101214962 321
99 3300005518 Ga0070699_100075076 Ga0070699_1000750763 322
100 3300005618 Ga0068864_100036963 Ga0068864_1000369632 322
101 3300005719 Ga0068861_100366982 Ga0068861_1003669821 322
102 3300005840 Ga0068870_10108392 Ga0068870_101083921 322
103 3300005841 Ga0068863_100276735 Ga0068863_1002767351 322
104 3300005843 Ga0068860_100081701 Ga0068860_1000817013 322
105 3300006852 Ga0075433_10393439 Ga0075433_103934392 322
106 3300009147 Ga0114129_10873505 Ga0114129_108735051 322
107 3300011119 Ga0105246_10080019 Ga0105246_100800193 322
108 3300013308 Ga0157375_10258691 Ga0157375_102586912 322
109 3300014326 Ga0157380_10273541 Ga0157380_102735412 322
110 3300025908 Ga0207643_10049903 Ga0207643_100499033 322
111 3300025934 Ga0207686_10080445 Ga0207686_100804452 322
112 3300025935 Ga0207709_10012168 Ga0207709_100121682 322
113 3300025936 Ga0207670_10002900 Ga0207670_100029009 322
114 3300026035 Ga0207703_10246871 Ga0207703_102468712 322
115 3300026088 Ga0207641_10140497 Ga0207641_101404973 322
116 3300026095 Ga0207676_10002236 Ga0207676_100022369 322
117 3300026118 Ga0207675_100072792 Ga0207675_1000727922 322
118 3300028381 Ga0268264_10131789 Ga0268264_101317892 322
119 3300050515 nmdc:mga0a205_207481_c1 nmdc:mga0a205_207481_c1_460_1479 322
120 3300005467 Ga0070706_100000019 Ga0070706_10000001962 323
121 3300005617 Ga0068859_100475887 Ga0068859_1004758872 323
122 3300006914 Ga0075436_100050819 Ga0075436_1000508192 323
123 3300006931 Ga0097620_100475899 Ga0097620_1004758992 323
124 3300025900 Ga0207710_10002172 Ga0207710_1000217210 323
125 3300003320 rootH2_10065354 rootH2_100653542 324
126 3300005441 Ga0070700_100019430 Ga0070700_1000194303 324
127 3300005444 Ga0070694_100132074 Ga0070694_1001320742 324
128 3300005468 Ga0070707_100061204 Ga0070707_1000612043 324
129 3300005578 Ga0068854_100083462 Ga0068854_1000834622 324
130 3300005617 Ga0068859_100182349 Ga0068859_1001823492 324
131 3300005843 Ga0068860_100102842 Ga0068860_1001028421 324
132 3300006931 Ga0097620_100182353 Ga0097620_1001823532 324
133 3300009174 Ga0105241_10253957 Ga0105241_102539572 324
134 3300009177 Ga0105248_10292788 Ga0105248_102927881 324
135 3300013306 Ga0163162_10039473 Ga0163162_100394735 324
136 3300025922 Ga0207646_10270750 Ga0207646_102707502 324
137 3300026075 Ga0207708_10007884 Ga0207708_100078844 324
138 3300026089 Ga0207648_10110264 Ga0207648_101102643 324
139 3300026095 Ga0207676_10209173 Ga0207676_102091732 324
140 3300026116 Ga0207674_10055725 Ga0207674_100557255 324
141 3300026118 Ga0207675_100047903 Ga0207675_1000479033 324
142 3300028381 Ga0268264_10074044 Ga0268264_100740443 324
143 3300028563 Ga0265319_1002213 Ga0265319_10022133 324
144 3300031240 Ga0265320_10009658 Ga0265320_100096583 324
145 3300045051 Ga0451576_0135447 Ga0451576_0135447_254_1279 324
146 3300050507 nmdc:mga05p37_320583_c1 nmdc:mga05p37_320583_c1_58_1092 324
147 3300050512 nmdc:mga0n895_48494_c1 nmdc:mga0n895_48494_c1_2140_3216 324
148 3300009177 Ga0105248_10101823 Ga0105248_101018231 326
149 3300025936 Ga0207670_10067493 Ga0207670_100674933 326
150 3300005336 Ga0070680_100116313 Ga0070680_1001163131 327
151 3300005444 Ga0070694_100065668 Ga0070694_1000656684 327
152 3300005457 Ga0070662_100015822 Ga0070662_1000158226 327
153 3300005458 Ga0070681_10001808 Ga0070681_1000180812 327
154 3300005544 Ga0070686_100041882 Ga0070686_1000418824 327
155 3300005564 Ga0070664_100006947 Ga0070664_1000069478 327
156 3300005842 Ga0068858_100019255 Ga0068858_1000192556 327
157 3300005843 Ga0068860_100065071 Ga0068860_1000650712 327
158 3300005844 Ga0068862_100023682 Ga0068862_1000236822 327
159 3300013297 Ga0157378_10145953 Ga0157378_101459532 327
160 3300014326 Ga0157380_10078187 Ga0157380_100781873 327
161 3300025920 Ga0207649_10005488 Ga0207649_100054888 327
162 3300025981 Ga0207640_10178886 Ga0207640_101788861 327
163 3300026035 Ga0207703_10056113 Ga0207703_100561131 327
164 3300026095 Ga0207676_10084175 Ga0207676_100841754 327
165 3300026116 Ga0207674_10000857 Ga0207674_1000085713 327
166 3300026118 Ga0207675_100075424 Ga0207675_1000754242 327
167 3300005364 Ga0070673_100007812 Ga0070673_1000078127 328
168 3300005617 Ga0068859_100110775 Ga0068859_1001107753 328
169 3300005843 Ga0068860_100006350 Ga0068860_1000063502 328
170 3300006931 Ga0097620_100110775 Ga0097620_1001107753 328
171 3300013306 Ga0163162_10067397 Ga0163162_100673972 328
172 3300025960 Ga0207651_10004362 Ga0207651_100043628 328
173 3300028381 Ga0268264_10013293 Ga0268264_100132933 328
174 3300007076 Ga0075435_100148463 Ga0075435_1001484632 329
175 3300009147 Ga0114129_10039728 Ga0114129_100397286 329
176 3300009147 Ga0114129_10523816 Ga0114129_105238162 329
177 3300013297 Ga0157378_10269635 Ga0157378_102696352 329
178 3300014325 Ga0163163_10243060 Ga0163163_102430602 329
179 3300005544 Ga0070686_100078954 Ga0070686_1000789542 330
180 3300005545 Ga0070695_100174619 Ga0070695_1001746192 330
181 3300005548 Ga0070665_100415348 Ga0070665_1004153482 330
182 3300005618 Ga0068864_100097933 Ga0068864_1000979333 330
183 3300005719 Ga0068861_100134178 Ga0068861_1001341783 330
184 3300025885 Ga0207653_10034053 Ga0207653_100340532 330
185 3300025910 Ga0207684_10256579 Ga0207684_102565792 330
186 3300025939 Ga0207665_10106258 Ga0207665_101062583 330
187 3300026118 Ga0207675_100023428 Ga0207675_1000234284 330
188 3300049582 Ga0501048_0177421 Ga0501048_0177421_382_1428 330
189 3300005289 Ga0065704_10104828 Ga0065704_101048282 331
190 3300005295 Ga0065707_10123268 Ga0065707_101232682 331
191 3300005334 Ga0068869_100065771 Ga0068869_1000657713 331
192 3300005468 Ga0070707_100093701 Ga0070707_1000937012 331
193 3300005546 Ga0070696_100045682 Ga0070696_1000456823 331
194 3300006852 Ga0075433_10337634 Ga0075433_103376342 331
195 3300006871 Ga0075434_100062433 Ga0075434_1000624334 331
196 3300009174 Ga0105241_10191640 Ga0105241_101916402 331
197 3300009553 Ga0105249_10080337 Ga0105249_100803372 331
198 3300013307 Ga0157372_10340089 Ga0157372_103400892 331
199 3300025924 Ga0207694_10167082 Ga0207694_101670822 331
200 3300025942 Ga0207689_10057090 Ga0207689_100570903 331
201 3300026041 Ga0207639_10183292 Ga0207639_101832922 331
202 3300038996 Ga0242420_004860 Ga0242420_004860_266_1330 331
203 3300048907 Ga0496104_0078113 Ga0496104_0078113_1799_2860 331
204 3300048909 Ga0496106_0183877 Ga0496106_0183877_540_1601 331
205 3300050512 nmdc:mga0n895_71448_c1 nmdc:mga0n895_71448_c1_307_1368 331
206 3300050515 nmdc:mga0a205_105747_c1 nmdc:mga0a205_105747_c1_774_1835 331
207 3300025941 Ga0207711_10028780 Ga0207711_100287806 332
208 3300025960 Ga0207651_10113691 Ga0207651_101136912 332
209 3300025961 Ga0207712_10001254 Ga0207712_100012543 332
210 3300026075 Ga0207708_10046561 Ga0207708_100465613 332
211 3300009553 Ga0105249_10000136 Ga0105249_1000013630 333
212 3300005546 Ga0070696_100124815 Ga0070696_1001248152 335
213 3300005295 Ga0065707_10013226 Ga0065707_100132262 337
214 3300005438 Ga0070701_10050785 Ga0070701_100507852 337
215 3300005440 Ga0070705_100062789 Ga0070705_1000627891 337
216 3300005536 Ga0070697_100207290 Ga0070697_1002072901 337
217 3300005544 Ga0070686_100004406 Ga0070686_1000044064 337
218 3300009094 Ga0111539_10033273 Ga0111539_100332736 337
219 3300013306 Ga0163162_10019883 Ga0163162_100198836 337
220 3300014325 Ga0163163_10109449 Ga0163163_101094493 337
221 3300025942 Ga0207689_10009527 Ga0207689_100095275 337
222 3300046539 Ga0495621_0009032 Ga0495621_0009032_1759_2838 337
223 2162886012 MBSR1b_contig_7509503 MBSR1b_0664.00000150 338
224 3300005293 Ga0065715_10101906 Ga0065715_101019063 338
225 3300005330 Ga0070690_100006338 Ga0070690_1000063382 338
226 3300005444 Ga0070694_100106400 Ga0070694_1001064003 338
227 3300005459 Ga0068867_100112104 Ga0068867_1001121042 338
228 3300005544 Ga0070686_100018784 Ga0070686_1000187843 338
229 3300005549 Ga0070704_100153899 Ga0070704_1001538991 338
230 3300005578 Ga0068854_100245619 Ga0068854_1002456191 338
231 3300005843 Ga0068860_100043766 Ga0068860_1000437665 338
232 3300025918 Ga0207662_10003740 Ga0207662_100037404 338
233 3300025960 Ga0207651_10377959 Ga0207651_103779591 338
234 3300026089 Ga0207648_10132732 Ga0207648_101327322 338
235 3300028381 Ga0268264_10040820 Ga0268264_100408202 338

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ruu-assembly2.cif.gz_B-4 structure of human atp:cobalamin adenosyltransferase r190c bound to adenosylcobalamin 0.3713 151 254
7ruu-assembly2.cif.gz_C structure of human atp:cobalamin adenosyltransferase r190c bound to adenosylcobalamin 0.3692 151 254
7ruv-assembly1.cif.gz_A structure of human atp:cobalamin adenosyltransferase e193k bound to adenosylcobalamin 0.3657 153 254
7ruu-assembly1.cif.gz_A structure of human atp:cobalamin adenosyltransferase r190c bound to adenosylcobalamin 0.3451 151 254
7xad-assembly1.cif.gz_C crystal strucutre of pd-l1 and dbl2_02 designed protein binder 0.339 146 235
ID Description Score Start End Superfamily
af_P38736_1_129_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4074 151 261 1.20.1070.10
af_Q2G1N0_215_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3825 162 338 1.20.1250.20
af_A0A1D6M334_126_320_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3493 140 337 1.20.1250.20
af_A0A4V0IJT1_312_502_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3417 153 332 1.20.1250.20
af_Q9XU34_23_286_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3323 24 335 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A2V8PHB1-F1-model_v4 Acyltransferase 3 domain-containing protein 0.9727 153 259 GO:0016020
AF-A0A2V8PHB1-F1-model_v4 Acyltransferase 3 domain-containing protein 0.9468 153 259 GO:0016020
AF-A0A2V8QYF6-F1-model_v4 Uncharacterized protein 0.8833 155 338 GO:0016020
AF-A0A2V8QYF6-F1-model_v4 Uncharacterized protein 0.8651 155 338 GO:0016020
AF-A0A2V8S9P9-F1-model_v4 Beta-carotene 15,15'-monooxygenase 0.7836 15 338 GO:0016020

Feature Viewer

pLDDT pTM Quality
71.62 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map