F347632
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 234 | 169 | 214 | 380 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2929297113|2929298689 |
| Length | 418 |
| Sequence | APLRLGWTIYVHVPFCVAKCSYCDFYSHRADPAERLAYGEALRRHLAALPADPGGDGRPPASLFFGGGTPSLLPPSMLVGLVGTVAERFGMPAEVTVEANPGTVSPDDLATWVAGGIRRLSFGAQAFQGRLLHLLGRCHDQAAIGQAVAMAQQAGIEDINLDLIYGIPGQTLEDWRESLQAAVALAPTHLSLYNLKLEVGTPLERQAAAGHVALCPEEDEVAMYEWACAYLAAHGFDQYELSNFARPGYQCRHNLNYWRRGDYLGIGSGAASNWGHYRWTWCLDSRRYSQAWQQGEACALPSMLGGGSNDNVLRSSGGAERPAGVGPAQTVEMIDDFEALAPEVAAGEAIFLGLRRMVGVDLTAVAAEYQVVPSVLTRWQREAEKLRQQGWVTWDGRHLTLTPKAYLLSNEIMERFLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 3 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 4 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 5 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 6 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 7 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 8 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 9 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 10 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 11 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 12 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 13 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 14 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 15 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 16 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 17 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 18 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 19 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 20 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 21 | 2929297113 | Heliophilum fasciatum MTM | Isolate | Rhizosphere |
| 22 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 53 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 54 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 55 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 93 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 94 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 95 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 96 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 97 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 98 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 99 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 100 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 101 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 102 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 103 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 104 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 105 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 106 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 107 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 108 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 109 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 110 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 111 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 131 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 132 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 133 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 134 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 135 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 136 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 137 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 138 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 139 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 140 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 141 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 142 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 143 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 144 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 145 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 146 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 147 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 148 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 149 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 151 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 154 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 155 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 156 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 157 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 158 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 159 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 160 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 161 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 162 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 163 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 164 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 165 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 166 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 167 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 168 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 169 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.45 |
| Metatranscriptomes | 0 |
| Isolates | 8.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.67 |
| Nodule | 0 |
| Rhizoplane | 5.98 |
| Rhizosphere | 64.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_825531 | 2162886007 | Bacteria | 5071 |
| 2 | JGI24751J29686_10000341 | 3300002459 | Bacteria | 16857 |
| 3 | Ga0065704_10000864 | 3300005289 | Bacteria | 15301 |
| 4 | Ga0065704_10007859 | 3300005289 | Bacteria | 2473 |
| 5 | Ga0070658_10000494 | 3300005327 | Bacteria | 34238 |
| 6 | Ga0070658_10006358 | 3300005327 | Bacteria | 9573 |
| 7 | Ga0070658_10030277 | 3300005327 | Bacteria | 4350 |
| 8 | Ga0070658_10092167 | 3300005327 | Bacteria | 2498 |
| 9 | Ga0070666_10042787 | 3300005335 | Bacteria | 3031 |
| 10 | Ga0070661_100000189 | 3300005344 | Bacteria | 51018 |
| 11 | Ga0070668_100009143 | 3300005347 | Bacteria | 7352 |
| 12 | Ga0070669_100000446 | 3300005353 | Bacteria | 31546 |
| 13 | Ga0070669_100003745 | 3300005353 | Bacteria | 10979 |
| 14 | Ga0070671_100000052 | 3300005355 | Bacteria | 78614 |
| 15 | Ga0070671_100000232 | 3300005355 | Bacteria | 37343 |
| 16 | Ga0070671_100013374 | 3300005355 | Bacteria | 6616 |
| 17 | Ga0070671_100145413 | 3300005355 | Bacteria | 2001 |
| 18 | Ga0070667_100002216 | 3300005367 | Bacteria | 17087 |
| 19 | Ga0070667_100009037 | 3300005367 | Bacteria | 8248 |
| 20 | Ga0070667_100011190 | 3300005367 | Bacteria | 7422 |
| 21 | Ga0070663_100035608 | 3300005455 | Bacteria | 3454 |
| 22 | Ga0070662_100001989 | 3300005457 | Bacteria | 12527 |
| 23 | Ga0070707_100012581 | 3300005468 | Bacteria | 7904 |
| 24 | Ga0070698_100201603 | 3300005471 | Bacteria | 1925 |
| 25 | Ga0070699_100306421 | 3300005518 | Bacteria | 1425 |
| 26 | Ga0068853_100057681 | 3300005539 | Bacteria | 3351 |
| 27 | Ga0070686_100066589 | 3300005544 | Bacteria | 2344 |
| 28 | Ga0070665_100032131 | 3300005548 | Bacteria | 5283 |
| 29 | Ga0070665_100077613 | 3300005548 | Bacteria | 3328 |
| 30 | Ga0068855_100025347 | 3300005563 | Bacteria | 7096 |
| 31 | Ga0068855_100040201 | 3300005563 | Bacteria | 5551 |
| 32 | Ga0068855_100116913 | 3300005563 | Bacteria | 3056 |
| 33 | Ga0068857_100025453 | 3300005577 | Bacteria | 5211 |
| 34 | Ga0068854_100000453 | 3300005578 | Bacteria | 25275 |
| 35 | Ga0068854_100003179 | 3300005578 | Bacteria | 10251 |
| 36 | Ga0068856_100140114 | 3300005614 | Bacteria | 2425 |
| 37 | Ga0068852_100000317 | 3300005616 | Bacteria | 32757 |
| 38 | Ga0068859_100103742 | 3300005617 | Bacteria | 2902 |
| 39 | Ga0068859_100189870 | 3300005617 | Bacteria | 2139 |
| 40 | Ga0068864_100076844 | 3300005618 | Bacteria | 2919 |
| 41 | Ga0068863_100000005 | 3300005841 | Bacteria | 269757 |
| 42 | Ga0068863_100011089 | 3300005841 | Bacteria | 8740 |
| 43 | Ga0068858_100038296 | 3300005842 | Bacteria | 4448 |
| 44 | Ga0068860_100000192 | 3300005843 | Bacteria | 97363 |
| 45 | Ga0068860_100059338 | 3300005843 | Bacteria | 3638 |
| 46 | Ga0068860_100374290 | 3300005843 | Bacteria | 1405 |
| 47 | Ga0068862_100015532 | 3300005844 | Bacteria | 6323 |
| 48 | Ga0075363_100006360 | 3300006048 | Bacteria | 5351 |
| 49 | Ga0075363_100088377 | 3300006048 | Bacteria | 1703 |
| 50 | Ga0075364_10057962 | 3300006051 | Bacteria | 2537 |
| 51 | Ga0075432_10001348 | 3300006058 | Bacteria | 7961 |
| 52 | Ga0075362_10000001 | 3300006177 | Bacteria | 215983 |
| 53 | Ga0075362_10002520 | 3300006177 | Bacteria | 6169 |
| 54 | Ga0075367_10007729 | 3300006178 | Bacteria | 5528 |
| 55 | Ga0075369_10014399 | 3300006186 | Bacteria | 3159 |
| 56 | Ga0075369_10037935 | 3300006186 | Bacteria | 2054 |
| 57 | Ga0075366_10000420 | 3300006195 | Bacteria | 19887 |
| 58 | Ga0075366_10011688 | 3300006195 | Bacteria | 4961 |
| 59 | Ga0075366_10022760 | 3300006195 | Bacteria | 3648 |
| 60 | Ga0075370_10006385 | 3300006353 | Bacteria | 5924 |
| 61 | Ga0075370_10039137 | 3300006353 | Bacteria | 2671 |
| 62 | Ga0097620_100103737 | 3300006931 | Bacteria | 2902 |
| 63 | Ga0097620_100189878 | 3300006931 | Bacteria | 2139 |
| 64 | Ga0105250_10005347 | 3300009092 | Bacteria | 5766 |
| 65 | Ga0105243_10218102 | 3300009148 | Bacteria | 1684 |
| 66 | Ga0105246_10001236 | 3300011119 | Bacteria | 14986 |
| 67 | Ga0157372_10019088 | 3300013307 | Bacteria | 7381 |
| 68 | Ga0163161_10022106 | 3300017792 | Bacteria | 4477 |
| 69 | Ga0207696_1001700 | 3300025711 | Bacteria | 11426 |
| 70 | Ga0207680_10095739 | 3300025903 | Bacteria | 1898 |
| 71 | Ga0207647_10028538 | 3300025904 | Bacteria | 3622 |
| 72 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 73 | Ga0207695_10023097 | 3300025913 | Bacteria | 7038 |
| 74 | Ga0207657_10000763 | 3300025919 | Bacteria | 34137 |
| 75 | Ga0207652_10001167 | 3300025921 | Bacteria | 23590 |
| 76 | Ga0207646_10000051 | 3300025922 | Bacteria | 170502 |
| 77 | Ga0207681_10000203 | 3300025923 | Bacteria | 47389 |
| 78 | Ga0207681_10000207 | 3300025923 | Bacteria | 46953 |
| 79 | Ga0207644_10000003 | 3300025931 | Bacteria | 585905 |
| 80 | Ga0207644_10049306 | 3300025931 | Bacteria | 3014 |
| 81 | Ga0207706_10003120 | 3300025933 | Bacteria | 15935 |
| 82 | Ga0207706_10032430 | 3300025933 | Bacteria | 4652 |
| 83 | Ga0207679_10123672 | 3300025945 | Bacteria | 2064 |
| 84 | Ga0207667_10032623 | 3300025949 | Bacteria | 5609 |
| 85 | Ga0207667_10068059 | 3300025949 | Bacteria | 3709 |
| 86 | Ga0207667_10084995 | 3300025949 | Bacteria | 3275 |
| 87 | Ga0207640_10000675 | 3300025981 | Bacteria | 19912 |
| 88 | Ga0207640_10001572 | 3300025981 | Bacteria | 12263 |
| 89 | Ga0207658_10002073 | 3300025986 | Bacteria | 14924 |
| 90 | Ga0207658_10005982 | 3300025986 | Bacteria | 8317 |
| 91 | Ga0207658_10013849 | 3300025986 | Bacteria | 5518 |
| 92 | Ga0207703_10005791 | 3300026035 | Bacteria | 9904 |
| 93 | Ga0207639_10065648 | 3300026041 | Bacteria | 2818 |
| 94 | Ga0207678_10021294 | 3300026067 | Bacteria | 5684 |
| 95 | Ga0207702_10004299 | 3300026078 | Bacteria | 12693 |
| 96 | Ga0207641_10000064 | 3300026088 | Bacteria | 156652 |
| 97 | Ga0207641_10054312 | 3300026088 | Bacteria | 3398 |
| 98 | Ga0207676_10106096 | 3300026095 | Bacteria | 2340 |
| 99 | Ga0207698_10000192 | 3300026142 | Bacteria | 38082 |
| 100 | Ga0207698_10045543 | 3300026142 | Bacteria | 3306 |
| 101 | Ga0209813_10000088 | 3300027866 | Bacteria | 34192 |
| 102 | Ga0209974_10034510 | 3300027876 | Bacteria | 1680 |
| 103 | Ga0209974_10049548 | 3300027876 | Bacteria | 1409 |
| 104 | Ga0207428_10163363 | 3300027907 | Bacteria | 1690 |
| 105 | Ga0268266_10024358 | 3300028379 | Bacteria | 5148 |
| 106 | Ga0268266_10047313 | 3300028379 | Bacteria | 3685 |
| 107 | Ga0268266_10056671 | 3300028379 | Bacteria | 3371 |
| 108 | Ga0268265_10003108 | 3300028380 | Bacteria | 12110 |
| 109 | Ga0268265_10009551 | 3300028380 | Bacteria | 6552 |
| 110 | Ga0268265_10045457 | 3300028380 | Bacteria | 3276 |
| 111 | Ga0268264_10000018 | 3300028381 | Bacteria | 495324 |
| 112 | Ga0268264_10028649 | 3300028381 | Bacteria | 4558 |
| 113 | Ga0268264_10372820 | 3300028381 | Bacteria | 1365 |
| 114 | Ga0307508_10076764 | 3300031616 | Bacteria | 2919 |
| 115 | Ga0316576_10160193 | 3300031727 | Bacteria | 1697 |
| 116 | Ga0307405_10006159 | 3300031731 | Bacteria | 5876 |
| 117 | Ga0307413_10016703 | 3300031824 | Bacteria | 3801 |
| 118 | Ga0307413_10147767 | 3300031824 | Bacteria | 1634 |
| 119 | Ga0307410_10140042 | 3300031852 | Bacteria | 1789 |
| 120 | Ga0307412_10012575 | 3300031911 | Bacteria | 4939 |
| 121 | Ga0307409_100161171 | 3300031995 | Bacteria | 1962 |
| 122 | Ga0307414_10010835 | 3300032004 | Bacteria | 5317 |
| 123 | Ga0307411_10012543 | 3300032005 | Bacteria | 4632 |
| 124 | Ga0307411_10209305 | 3300032005 | Bacteria | 1505 |
| 125 | Ga0316574_0083107 | 3300035398 | Bacteria | 2036 |
| 126 | Ga0395899_0102877 | 3300037312 | Bacteria | 2060 |
| 127 | Ga0395900_0318723 | 3300037418 | Bacteria | 1535 |
| 128 | Ga0400484_21377 | 3300038725 | Bacteria | 8879 |
| 129 | Ga0400490_50119 | 3300038726 | Bacteria | 4054 |
| 130 | Ga0439432_021448 | 3300042006 | Bacteria | 2141 |
| 131 | Ga0439462_0000932 | 3300042015 | Bacteria | 6199 |
| 132 | Ga0439464_0022050 | 3300042439 | Bacteria | 1752 |
| 133 | Ga0453684_0472888 | 3300044712 | Bacteria | 1392 |
| 134 | Ga0451576_0000007 | 3300045051 | Bacteria | 782228 |
| 135 | Ga0495617_007276 | 3300046452 | Bacteria | 3849 |
| 136 | Ga0495627_000099 | 3300046453 | Bacteria | 107062 |
| 137 | Ga0495627_000156 | 3300046453 | Bacteria | 78784 |
| 138 | Ga0495638_0029038 | 3300046460 | Bacteria | 3567 |
| 139 | Ga0495650_0001801 | 3300046471 | Bacteria | 19318 |
| 140 | Ga0495583_0000242 | 3300046506 | Bacteria | 90367 |
| 141 | Ga0495606_0085412 | 3300046507 | Bacteria | 1952 |
| 142 | Ga0495610_0000018 | 3300046512 | Bacteria | 355044 |
| 143 | Ga0495610_0005633 | 3300046512 | Bacteria | 8836 |
| 144 | Ga0495632_0000007 | 3300046519 | Bacteria | 343246 |
| 145 | Ga0495637_0023794 | 3300046520 | Bacteria | 2776 |
| 146 | Ga0495643_0000070 | 3300046522 | Bacteria | 170879 |
| 147 | Ga0495648_0038657 | 3300046524 | Bacteria | 3048 |
| 148 | Ga0495663_0000005 | 3300046525 | Bacteria | 342265 |
| 149 | Ga0495633_0000307 | 3300046558 | Bacteria | 55767 |
| 150 | Ga0495633_0003263 | 3300046558 | Bacteria | 10931 |
| 151 | Ga0495661_0079738 | 3300046665 | Bacteria | 1891 |
| 152 | Ga0495671_0000039 | 3300046692 | Bacteria | 170879 |
| 153 | Ga0495681_0000020 | 3300047470 | Bacteria | 170007 |
| 154 | Ga0495681_0000098 | 3300047470 | Bacteria | 75809 |
| 155 | Ga0495681_0009624 | 3300047470 | Bacteria | 5934 |
| 156 | Ga0495686_0035337 | 3300047472 | Bacteria | 3213 |
| 157 | Ga0495686_0038386 | 3300047472 | Bacteria | 3063 |
| 158 | Ga0496100_0005289 | 3300048903 | Bacteria | 6933 |
| 159 | Ga0496101_0004647 | 3300048904 | Bacteria | 8685 |
| 160 | Ga0496101_0012870 | 3300048904 | Bacteria | 5596 |
| 161 | Ga0496102_0000162 | 3300048905 | Bacteria | 89746 |
| 162 | Ga0496103_0000328 | 3300048906 | Bacteria | 43483 |
| 163 | Ga0496104_0000083 | 3300048907 | Bacteria | 91698 |
| 164 | Ga0496105_0000086 | 3300048908 | Bacteria | 66447 |
| 165 | Ga0496106_0010890 | 3300048909 | Bacteria | 6718 |
| 166 | Ga0496106_0108149 | 3300048909 | Bacteria | 2163 |
| 167 | Ga0496108_0240351 | 3300048911 | Bacteria | 1575 |
| 168 | Ga0496112_0195024 | 3300048915 | Bacteria | 1986 |
| 169 | Ga0496113_0000776 | 3300048916 | Bacteria | 16491 |
| 170 | Ga0496114_0006267 | 3300048917 | Bacteria | 9365 |
| 171 | Ga0496114_0021863 | 3300048917 | Bacteria | 5207 |
| 172 | Ga0496117_0000323 | 3300048920 | Bacteria | 83916 |
| 173 | Ga0496117_0037702 | 3300048920 | Bacteria | 3597 |
| 174 | Ga0496118_0012140 | 3300048921 | Bacteria | 8311 |
| 175 | Ga0496119_0000180 | 3300048922 | Bacteria | 88339 |
| 176 | Ga0496120_0000342 | 3300048923 | Bacteria | 77136 |
| 177 | Ga0496121_0000168 | 3300048924 | Bacteria | 144896 |
| 178 | Ga0496121_0000206 | 3300048924 | Bacteria | 130071 |
| 179 | Ga0496121_0002474 | 3300048924 | Bacteria | 28166 |
| 180 | Ga0496122_0000918 | 3300048925 | Bacteria | 53963 |
| 181 | Ga0496123_0001257 | 3300048926 | Bacteria | 36453 |
| 182 | Ga0496124_0014949 | 3300048927 | Bacteria | 7472 |
| 183 | Ga0496125_0004290 | 3300048928 | Bacteria | 16559 |
| 184 | Ga0496126_0000044 | 3300048929 | Bacteria | 335904 |
| 185 | Ga0496126_0030454 | 3300048929 | Bacteria | 5112 |
| 186 | Ga0501047_0097264 | 3300049581 | Bacteria | 2822 |
| 187 | Ga0501235_003370 | 3300049669 | Bacteria | 3455 |
| 188 | Ga0501035_0078145 | 3300049822 | Bacteria | 2924 |
| 189 | Ga0501044_0001194 | 3300049823 | Bacteria | 30781 |
| 190 | nmdc:mga03683_334_c1 | 3300050489 | Bacteria | 13821 |
| 191 | nmdc:mga03683_48_c1 | 3300050489 | Bacteria | 53827 |
| 192 | nmdc:mga03n38_3617_c1 | 3300050490 | Bacteria | 4993 |
| 193 | nmdc:mga00v17_10475_c1 | 3300050491 | Bacteria | 5064 |
| 194 | nmdc:mga00v17_47432_c1 | 3300050491 | Bacteria | 2602 |
| 195 | nmdc:mga0k408_10002_c1 | 3300050493 | Bacteria | 5122 |
| 196 | nmdc:mga0k408_93_c1 | 3300050493 | Bacteria | 42678 |
| 197 | nmdc:mga06z11_636_c1 | 3300050494 | Bacteria | 12763 |
| 198 | nmdc:mga04h51_287_c1 | 3300050495 | Bacteria | 12948 |
| 199 | nmdc:mga07m45_46_c1 | 3300050496 | Bacteria | 18747 |
| 200 | nmdc:mga07m45_4_c1 | 3300050496 | Bacteria | 409607 |
| 201 | nmdc:mga0sz30_19386_c1 | 3300050516 | Bacteria | 2735 |
| 202 | nmdc:mga0sz30_2566_c1 | 3300050516 | Bacteria | 6464 |
| 203 | nmdc:mga0sz30_35133_c1 | 3300050516 | Bacteria | 2090 |
| 204 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 205 | Ga0500607_000082 | 3300053121 | Bacteria | 70790 |
| 206 | Ga0500618_002760 | 3300053125 | Bacteria | 6385 |
| 207 | Ga0500564_002319 | 3300053138 | Bacteria | 7001 |
| 208 | Ga0500564_062159 | 3300053138 | Bacteria | 1693 |
| 209 | Ga0500573_0127948 | 3300053140 | Bacteria | 1409 |
| 210 | Ga0500637_0032240 | 3300053178 | Bacteria | 2921 |
| 211 | Ga0500567_003006 | 3300053723 | Bacteria | 7393 |
| 212 | Ga0500625_000018 | 3300053729 | Bacteria | 94860 |
| 213 | Ga0500645_002566 | 3300053730 | Bacteria | 7999 |
| 214 | Ga0500645_051760 | 3300053730 | Bacteria | 1197 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031852 | Ga0307410_10140042 | Ga0307410_101400423 | 316 |
| 2 | 3300042015 | Ga0439462_0000932 | Ga0439462_0000932_2888_3841 | 316 |
| 3 | 3300050516 | nmdc:mga0sz30_19386_c1 | nmdc:mga0sz30_19386_c1_1771_2724 | 316 |
| 4 | 3300053730 | Ga0500645_051760 | Ga0500645_051760_229_1182 | 316 |
| 5 | 3300044712 | Ga0453684_0472888 | Ga0453684_0472888_71_1126 | 343 |
| 6 | iso_pu_bacteria | 2808606401 | 2809063021 | 344 |
| 7 | iso_pu_bacteria | 2808606404 | 2809078985 | 344 |
| 8 | iso_pu_bacteria | 2808606405 | 2809083640 | 344 |
| 9 | iso_pu_bacteria | 2880518877 | 2880520276 | 344 |
| 10 | 3300046452 | Ga0495617_007276 | Ga0495617_007276_1997_3049 | 350 |
| 11 | 3300046453 | Ga0495627_000156 | Ga0495627_000156_34501_35553 | 350 |
| 12 | 3300046512 | Ga0495610_0005633 | Ga0495610_0005633_2318_3370 | 350 |
| 13 | 3300046519 | Ga0495632_0000007 | Ga0495632_0000007_242300_243352 | 350 |
| 14 | 3300046520 | Ga0495637_0023794 | Ga0495637_0023794_22_1074 | 350 |
| 15 | 3300046522 | Ga0495643_0000070 | Ga0495643_0000070_138502_139554 | 350 |
| 16 | 3300046524 | Ga0495648_0038657 | Ga0495648_0038657_1985_3037 | 350 |
| 17 | 3300046525 | Ga0495663_0000005 | Ga0495663_0000005_241319_242371 | 350 |
| 18 | 3300046558 | Ga0495633_0000307 | Ga0495633_0000307_6217_7269 | 350 |
| 19 | 3300046558 | Ga0495633_0003263 | Ga0495633_0003263_3487_4539 | 350 |
| 20 | 3300046665 | Ga0495661_0079738 | Ga0495661_0079738_191_1243 | 350 |
| 21 | 3300046692 | Ga0495671_0000039 | Ga0495671_0000039_31326_32378 | 350 |
| 22 | 3300047470 | Ga0495681_0000098 | Ga0495681_0000098_15128_16180 | 350 |
| 23 | 3300047470 | Ga0495681_0009624 | Ga0495681_0009624_3136_4188 | 350 |
| 24 | 3300047472 | Ga0495686_0035337 | Ga0495686_0035337_1684_2736 | 350 |
| 25 | 3300047472 | Ga0495686_0038386 | Ga0495686_0038386_1096_2148 | 350 |
| 26 | 3300035398 | Ga0316574_0083107 | Ga0316574_0083107_554_1720 | 358 |
| 27 | 3300005468 | Ga0070707_100012581 | Ga0070707_1000125819 | 359 |
| 28 | 3300005471 | Ga0070698_100201603 | Ga0070698_1002016031 | 359 |
| 29 | 3300005518 | Ga0070699_100306421 | Ga0070699_1003064211 | 359 |
| 30 | 3300025922 | Ga0207646_10000051 | Ga0207646_1000005158 | 359 |
| 31 | 3300031727 | Ga0316576_10160193 | Ga0316576_101601932 | 360 |
| 32 | 3300046506 | Ga0495583_0000242 | Ga0495583_0000242_73338_74579 | 365 |
| 33 | 3300038725 | Ga0400484_21377 | Ga0400484_21377_701_1867 | 375 |
| 34 | 3300038726 | Ga0400490_50119 | Ga0400490_50119_686_1852 | 375 |
| 35 | 3300042006 | Ga0439432_021448 | Ga0439432_021448_825_2048 | 375 |
| 36 | 3300031995 | Ga0307409_100161171 | Ga0307409_1001611712 | 376 |
| 37 | 3300049669 | Ga0501235_003370 | Ga0501235_003370_1611_2741 | 376 |
| 38 | iso_pu_bacteria | 2929297113 | 2929298689 | 376 |
| 39 | 3300042439 | Ga0439464_0022050 | Ga0439464_0022050_214_1440 | 377 |
| 40 | iso_pu_bacteria | 2643221588 | 2643949230 | 378 |
| 41 | iso_pu_bacteria | 2739367664 | 2739650083 | 378 |
| 42 | iso_pu_bacteria | 2739367865 | 2740028556 | 378 |
| 43 | iso_pu_bacteria | 2848297114 | 2848299854 | 378 |
| 44 | iso_pu_bacteria | 2882806704 | 2882807787 | 378 |
| 45 | iso_pu_bacteria | 2895880812 | 2895886148 | 378 |
| 46 | iso_pu_bacteria | 2896253425 | 2896255199 | 378 |
| 47 | 3300025919 | Ga0207657_10000763 | Ga0207657_100007639 | 379 |
| 48 | 3300053087 | Ga0500643_000001 | Ga0500643_000001_1406762_1407901 | 379 |
| 49 | iso_pu_bacteria | 2738541275 | 2738711849 | 379 |
| 50 | iso_pu_bacteria | 2738541301 | 2738850274 | 379 |
| 51 | iso_pu_bacteria | 2738541304 | 2738866003 | 379 |
| 52 | iso_pu_bacteria | 2738543022 | 2739298521 | 379 |
| 53 | iso_pu_bacteria | 2738543033 | 2739360199 | 379 |
| 54 | iso_pu_bacteria | 2919709256 | 2919712752 | 379 |
| 55 | iso_pu_bacteria | 2928100450 | 2928103017 | 379 |
| 56 | iso_pu_bacteria | 2928959182 | 2928959581 | 379 |
| 57 | 3300005327 | Ga0070658_10030277 | Ga0070658_100302773 | 380 |
| 58 | 3300032005 | Ga0307411_10209305 | Ga0307411_102093052 | 380 |
| 59 | 3300037418 | Ga0395900_0318723 | Ga0395900_0318723_183_1418 | 380 |
| 60 | 3300005344 | Ga0070661_100000189 | Ga0070661_10000018917 | 381 |
| 61 | 3300002459 | JGI24751J29686_10000341 | JGI24751J29686_1000034112 | 382 |
| 62 | 3300005289 | Ga0065704_10007859 | Ga0065704_100078592 | 382 |
| 63 | 3300005327 | Ga0070658_10000494 | Ga0070658_1000049424 | 382 |
| 64 | 3300005327 | Ga0070658_10006358 | Ga0070658_100063585 | 382 |
| 65 | 3300005327 | Ga0070658_10092167 | Ga0070658_100921673 | 382 |
| 66 | 3300005335 | Ga0070666_10042787 | Ga0070666_100427872 | 382 |
| 67 | 3300005347 | Ga0070668_100009143 | Ga0070668_1000091437 | 382 |
| 68 | 3300005353 | Ga0070669_100003745 | Ga0070669_10000374510 | 382 |
| 69 | 3300005355 | Ga0070671_100000052 | Ga0070671_10000005232 | 382 |
| 70 | 3300005355 | Ga0070671_100145413 | Ga0070671_1001454132 | 382 |
| 71 | 3300005367 | Ga0070667_100002216 | Ga0070667_10000221613 | 382 |
| 72 | 3300005367 | Ga0070667_100011190 | Ga0070667_1000111901 | 382 |
| 73 | 3300005455 | Ga0070663_100035608 | Ga0070663_1000356083 | 382 |
| 74 | 3300005457 | Ga0070662_100001989 | Ga0070662_1000019892 | 382 |
| 75 | 3300005539 | Ga0068853_100057681 | Ga0068853_1000576812 | 382 |
| 76 | 3300005544 | Ga0070686_100066589 | Ga0070686_1000665892 | 382 |
| 77 | 3300005548 | Ga0070665_100077613 | Ga0070665_1000776132 | 382 |
| 78 | 3300005563 | Ga0068855_100025347 | Ga0068855_1000253472 | 382 |
| 79 | 3300005563 | Ga0068855_100040201 | Ga0068855_1000402012 | 382 |
| 80 | 3300005563 | Ga0068855_100116913 | Ga0068855_1001169131 | 382 |
| 81 | 3300005577 | Ga0068857_100025453 | Ga0068857_1000254534 | 382 |
| 82 | 3300005578 | Ga0068854_100000453 | Ga0068854_10000045321 | 382 |
| 83 | 3300005578 | Ga0068854_100003179 | Ga0068854_1000031792 | 382 |
| 84 | 3300005614 | Ga0068856_100140114 | Ga0068856_1001401142 | 382 |
| 85 | 3300005616 | Ga0068852_100000317 | Ga0068852_10000031727 | 382 |
| 86 | 3300005617 | Ga0068859_100103742 | Ga0068859_1001037423 | 382 |
| 87 | 3300005617 | Ga0068859_100189870 | Ga0068859_1001898702 | 382 |
| 88 | 3300005618 | Ga0068864_100076844 | Ga0068864_1000768441 | 382 |
| 89 | 3300005841 | Ga0068863_100000005 | Ga0068863_1000000053 | 382 |
| 90 | 3300005841 | Ga0068863_100011089 | Ga0068863_1000110899 | 382 |
| 91 | 3300005842 | Ga0068858_100038296 | Ga0068858_1000382963 | 382 |
| 92 | 3300005843 | Ga0068860_100000192 | Ga0068860_1000001923 | 382 |
| 93 | 3300005843 | Ga0068860_100374290 | Ga0068860_1003742901 | 382 |
| 94 | 3300005844 | Ga0068862_100015532 | Ga0068862_1000155322 | 382 |
| 95 | 3300006048 | Ga0075363_100006360 | Ga0075363_1000063607 | 382 |
| 96 | 3300006048 | Ga0075363_100088377 | Ga0075363_1000883772 | 382 |
| 97 | 3300006051 | Ga0075364_10057962 | Ga0075364_100579622 | 382 |
| 98 | 3300006058 | Ga0075432_10001348 | Ga0075432_100013482 | 382 |
| 99 | 3300006177 | Ga0075362_10000001 | Ga0075362_1000000145 | 382 |
| 100 | 3300006177 | Ga0075362_10002520 | Ga0075362_100025202 | 382 |
| 101 | 3300006178 | Ga0075367_10007729 | Ga0075367_100077297 | 382 |
| 102 | 3300006186 | Ga0075369_10014399 | Ga0075369_100143994 | 382 |
| 103 | 3300006186 | Ga0075369_10037935 | Ga0075369_100379352 | 382 |
| 104 | 3300006195 | Ga0075366_10000420 | Ga0075366_100004209 | 382 |
| 105 | 3300006195 | Ga0075366_10011688 | Ga0075366_100116886 | 382 |
| 106 | 3300006195 | Ga0075366_10022760 | Ga0075366_100227604 | 382 |
| 107 | 3300006353 | Ga0075370_10006385 | Ga0075370_100063857 | 382 |
| 108 | 3300006353 | Ga0075370_10039137 | Ga0075370_100391371 | 382 |
| 109 | 3300006931 | Ga0097620_100103737 | Ga0097620_1001037373 | 382 |
| 110 | 3300006931 | Ga0097620_100189878 | Ga0097620_1001898782 | 382 |
| 111 | 3300011119 | Ga0105246_10001236 | Ga0105246_100012369 | 382 |
| 112 | 3300013307 | Ga0157372_10019088 | Ga0157372_100190888 | 382 |
| 113 | 3300017792 | Ga0163161_10022106 | Ga0163161_100221063 | 382 |
| 114 | 3300025903 | Ga0207680_10095739 | Ga0207680_100957392 | 382 |
| 115 | 3300025904 | Ga0207647_10028538 | Ga0207647_100285384 | 382 |
| 116 | 3300025909 | Ga0207705_10000004 | Ga0207705_10000004590 | 382 |
| 117 | 3300025913 | Ga0207695_10023097 | Ga0207695_100230978 | 382 |
| 118 | 3300025921 | Ga0207652_10001167 | Ga0207652_1000116712 | 382 |
| 119 | 3300025923 | Ga0207681_10000207 | Ga0207681_1000020715 | 382 |
| 120 | 3300025931 | Ga0207644_10000003 | Ga0207644_10000003512 | 382 |
| 121 | 3300025931 | Ga0207644_10049306 | Ga0207644_100493064 | 382 |
| 122 | 3300025933 | Ga0207706_10003120 | Ga0207706_100031202 | 382 |
| 123 | 3300025933 | Ga0207706_10032430 | Ga0207706_100324304 | 382 |
| 124 | 3300025945 | Ga0207679_10123672 | Ga0207679_101236722 | 382 |
| 125 | 3300025949 | Ga0207667_10032623 | Ga0207667_100326232 | 382 |
| 126 | 3300025949 | Ga0207667_10068059 | Ga0207667_100680591 | 382 |
| 127 | 3300025981 | Ga0207640_10000675 | Ga0207640_1000067518 | 382 |
| 128 | 3300025981 | Ga0207640_10001572 | Ga0207640_1000157213 | 382 |
| 129 | 3300025986 | Ga0207658_10002073 | Ga0207658_100020738 | 382 |
| 130 | 3300025986 | Ga0207658_10013849 | Ga0207658_100138494 | 382 |
| 131 | 3300026035 | Ga0207703_10005791 | Ga0207703_100057915 | 382 |
| 132 | 3300026041 | Ga0207639_10065648 | Ga0207639_100656484 | 382 |
| 133 | 3300026067 | Ga0207678_10021294 | Ga0207678_100212947 | 382 |
| 134 | 3300026078 | Ga0207702_10004299 | Ga0207702_100042999 | 382 |
| 135 | 3300026088 | Ga0207641_10000064 | Ga0207641_1000006470 | 382 |
| 136 | 3300026088 | Ga0207641_10054312 | Ga0207641_100543123 | 382 |
| 137 | 3300026095 | Ga0207676_10106096 | Ga0207676_101060962 | 382 |
| 138 | 3300026142 | Ga0207698_10000192 | Ga0207698_1000019238 | 382 |
| 139 | 3300026142 | Ga0207698_10045543 | Ga0207698_100455434 | 382 |
| 140 | 3300027866 | Ga0209813_10000088 | Ga0209813_1000008829 | 382 |
| 141 | 3300027876 | Ga0209974_10034510 | Ga0209974_100345102 | 382 |
| 142 | 3300027876 | Ga0209974_10049548 | Ga0209974_100495482 | 382 |
| 143 | 3300027907 | Ga0207428_10163363 | Ga0207428_101633632 | 382 |
| 144 | 3300028379 | Ga0268266_10047313 | Ga0268266_100473132 | 382 |
| 145 | 3300028379 | Ga0268266_10056671 | Ga0268266_100566713 | 382 |
| 146 | 3300028380 | Ga0268265_10003108 | Ga0268265_100031087 | 382 |
| 147 | 3300028380 | Ga0268265_10009551 | Ga0268265_100095515 | 382 |
| 148 | 3300028381 | Ga0268264_10000018 | Ga0268264_1000001893 | 382 |
| 149 | 3300028381 | Ga0268264_10372820 | Ga0268264_103728202 | 382 |
| 150 | 3300031616 | Ga0307508_10076764 | Ga0307508_100767643 | 382 |
| 151 | 3300031731 | Ga0307405_10006159 | Ga0307405_100061592 | 382 |
| 152 | 3300031824 | Ga0307413_10016703 | Ga0307413_100167032 | 382 |
| 153 | 3300031824 | Ga0307413_10147767 | Ga0307413_101477672 | 382 |
| 154 | 3300031911 | Ga0307412_10012575 | Ga0307412_100125755 | 382 |
| 155 | 3300032004 | Ga0307414_10010835 | Ga0307414_100108356 | 382 |
| 156 | 3300032005 | Ga0307411_10012543 | Ga0307411_100125432 | 382 |
| 157 | 3300045051 | Ga0451576_0000007 | Ga0451576_0000007_48067_49218 | 382 |
| 158 | 3300046453 | Ga0495627_000099 | Ga0495627_000099_104722_105873 | 382 |
| 159 | 3300046460 | Ga0495638_0029038 | Ga0495638_0029038_1583_2734 | 382 |
| 160 | 3300046471 | Ga0495650_0001801 | Ga0495650_0001801_10445_11596 | 382 |
| 161 | 3300046507 | Ga0495606_0085412 | Ga0495606_0085412_251_1402 | 382 |
| 162 | 3300046512 | Ga0495610_0000018 | Ga0495610_0000018_34215_35366 | 382 |
| 163 | 3300047470 | Ga0495681_0000020 | Ga0495681_0000020_42529_43680 | 382 |
| 164 | 3300048904 | Ga0496101_0012870 | Ga0496101_0012870_2255_3406 | 382 |
| 165 | 3300048909 | Ga0496106_0010890 | Ga0496106_0010890_2450_3601 | 382 |
| 166 | 3300048911 | Ga0496108_0240351 | Ga0496108_0240351_37_1188 | 382 |
| 167 | 3300048917 | Ga0496114_0006267 | Ga0496114_0006267_348_1499 | 382 |
| 168 | 3300048917 | Ga0496114_0021863 | Ga0496114_0021863_932_2083 | 382 |
| 169 | 3300048920 | Ga0496117_0037702 | Ga0496117_0037702_1694_2845 | 382 |
| 170 | 3300048924 | Ga0496121_0000168 | Ga0496121_0000168_124717_125877 | 382 |
| 171 | 3300048924 | Ga0496121_0000206 | Ga0496121_0000206_67954_69105 | 382 |
| 172 | 3300048929 | Ga0496126_0030454 | Ga0496126_0030454_3036_4184 | 382 |
| 173 | 3300049581 | Ga0501047_0097264 | Ga0501047_0097264_1529_2680 | 382 |
| 174 | 3300049822 | Ga0501035_0078145 | Ga0501035_0078145_1331_2482 | 382 |
| 175 | 3300050489 | nmdc:mga03683_334_c1 | nmdc:mga03683_334_c1_4971_6122 | 382 |
| 176 | 3300050489 | nmdc:mga03683_48_c1 | nmdc:mga03683_48_c1_46784_47935 | 382 |
| 177 | 3300050490 | nmdc:mga03n38_3617_c1 | nmdc:mga03n38_3617_c1_1384_2535 | 382 |
| 178 | 3300050491 | nmdc:mga00v17_10475_c1 | nmdc:mga00v17_10475_c1_1197_2348 | 382 |
| 179 | 3300050491 | nmdc:mga00v17_47432_c1 | nmdc:mga00v17_47432_c1_849_2000 | 382 |
| 180 | 3300050493 | nmdc:mga0k408_10002_c1 | nmdc:mga0k408_10002_c1_405_1556 | 382 |
| 181 | 3300050493 | nmdc:mga0k408_93_c1 | nmdc:mga0k408_93_c1_29306_30457 | 382 |
| 182 | 3300050494 | nmdc:mga06z11_636_c1 | nmdc:mga06z11_636_c1_403_1554 | 382 |
| 183 | 3300050495 | nmdc:mga04h51_287_c1 | nmdc:mga04h51_287_c1_6680_7831 | 382 |
| 184 | 3300050496 | nmdc:mga07m45_46_c1 | nmdc:mga07m45_46_c1_4487_5638 | 382 |
| 185 | 3300050496 | nmdc:mga07m45_4_c1 | nmdc:mga07m45_4_c1_369296_370447 | 382 |
| 186 | 3300050516 | nmdc:mga0sz30_2566_c1 | nmdc:mga0sz30_2566_c1_3642_4793 | 382 |
| 187 | 3300050516 | nmdc:mga0sz30_35133_c1 | nmdc:mga0sz30_35133_c1_623_1774 | 382 |
| 188 | 3300053125 | Ga0500618_002760 | Ga0500618_002760_4547_5695 | 382 |
| 189 | 3300053138 | Ga0500564_062159 | Ga0500564_062159_209_1360 | 382 |
| 190 | 3300009092 | Ga0105250_10005347 | Ga0105250_100053475 | 383 |
| 191 | 3300028379 | Ga0268266_10024358 | Ga0268266_100243582 | 383 |
| 192 | 3300048903 | Ga0496100_0005289 | Ga0496100_0005289_4533_5684 | 383 |
| 193 | 3300048904 | Ga0496101_0004647 | Ga0496101_0004647_483_1634 | 383 |
| 194 | 3300048905 | Ga0496102_0000162 | Ga0496102_0000162_14640_15791 | 383 |
| 195 | 3300048906 | Ga0496103_0000328 | Ga0496103_0000328_22888_24039 | 383 |
| 196 | 3300048907 | Ga0496104_0000083 | Ga0496104_0000083_57889_59040 | 383 |
| 197 | 3300048908 | Ga0496105_0000086 | Ga0496105_0000086_60949_62100 | 383 |
| 198 | 3300048909 | Ga0496106_0108149 | Ga0496106_0108149_391_1542 | 383 |
| 199 | 3300048915 | Ga0496112_0195024 | Ga0496112_0195024_36_1187 | 383 |
| 200 | 3300048916 | Ga0496113_0000776 | Ga0496113_0000776_14840_15991 | 383 |
| 201 | 3300048920 | Ga0496117_0000323 | Ga0496117_0000323_7866_9017 | 383 |
| 202 | 3300048921 | Ga0496118_0012140 | Ga0496118_0012140_3552_4703 | 383 |
| 203 | 3300048922 | Ga0496119_0000180 | Ga0496119_0000180_32531_33682 | 383 |
| 204 | 3300048923 | Ga0496120_0000342 | Ga0496120_0000342_53070_54221 | 383 |
| 205 | 3300048924 | Ga0496121_0002474 | Ga0496121_0002474_12609_13760 | 383 |
| 206 | 3300048925 | Ga0496122_0000918 | Ga0496122_0000918_41288_42439 | 383 |
| 207 | 3300048926 | Ga0496123_0001257 | Ga0496123_0001257_12368_13519 | 383 |
| 208 | 3300048927 | Ga0496124_0014949 | Ga0496124_0014949_3960_5111 | 383 |
| 209 | 3300048928 | Ga0496125_0004290 | Ga0496125_0004290_11179_12330 | 383 |
| 210 | 3300048929 | Ga0496126_0000044 | Ga0496126_0000044_45644_46795 | 383 |
| 211 | 3300025949 | Ga0207667_10084995 | Ga0207667_100849952 | 384 |
| 212 | 3300037312 | Ga0395899_0102877 | Ga0395899_0102877_161_1447 | 384 |
| 213 | 3300053138 | Ga0500564_002319 | Ga0500564_002319_2805_3962 | 384 |
| 214 | 3300053140 | Ga0500573_0127948 | Ga0500573_0127948_210_1367 | 384 |
| 215 | 3300053723 | Ga0500567_003006 | Ga0500567_003006_1167_2324 | 384 |
| 216 | 3300053729 | Ga0500625_000018 | Ga0500625_000018_3156_4313 | 384 |
| 217 | 3300009148 | Ga0105243_10218102 | Ga0105243_102181022 | 386 |
| 218 | 3300049823 | Ga0501044_0001194 | Ga0501044_0001194_27895_29058 | 386 |
| 219 | 3300005355 | Ga0070671_100000232 | Ga0070671_10000023225 | 390 |
| 220 | 3300053121 | Ga0500607_000082 | Ga0500607_000082_49198_50388 | 392 |
| 221 | 3300053178 | Ga0500637_0032240 | Ga0500637_0032240_1547_2737 | 392 |
| 222 | 3300053730 | Ga0500645_002566 | Ga0500645_002566_3440_4630 | 392 |
| 223 | 2162886007 | SwRhRL2b_contig_825531 | SwRhRL2b_0722.00008850 | 396 |
| 224 | 3300005289 | Ga0065704_10000864 | Ga0065704_100008643 | 396 |
| 225 | 3300005353 | Ga0070669_100000446 | Ga0070669_10000044623 | 396 |
| 226 | 3300005355 | Ga0070671_100013374 | Ga0070671_1000133748 | 396 |
| 227 | 3300005367 | Ga0070667_100009037 | Ga0070667_1000090377 | 396 |
| 228 | 3300005548 | Ga0070665_100032131 | Ga0070665_1000321312 | 396 |
| 229 | 3300005843 | Ga0068860_100059338 | Ga0068860_1000593383 | 396 |
| 230 | 3300025711 | Ga0207696_1001700 | Ga0207696_10017009 | 396 |
| 231 | 3300025923 | Ga0207681_10000203 | Ga0207681_100002038 | 396 |
| 232 | 3300025986 | Ga0207658_10005982 | Ga0207658_100059827 | 396 |
| 233 | 3300028380 | Ga0268265_10045457 | Ga0268265_100454573 | 396 |
| 234 | 3300028381 | Ga0268264_10028649 | Ga0268264_100286493 | 396 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1olt-assembly1.cif.gz_A | coproporphyrinogen iii oxidase (hemn) from escherichia coli is a radical sam enzyme. | 0.8395 | 12 | 387 |
| 1olt-assembly1.cif.gz_A | coproporphyrinogen iii oxidase (hemn) from escherichia coli is a radical sam enzyme. | 0.799 | 12 | 387 |
| 6efn-assembly1.cif.gz_A-2 | structure of a ripp maturase, skfb | 0.7376 | 15 | 241 |
| 6qk7-assembly1.cif.gz_C | elongator catalytic subcomplex elp123 lobe | 0.7247 | 14 | 235 |
| 6q2q-assembly2.cif.gz_B | crystal structure of mouse viperin bound to uridine triphosphate and s-adenosylhomocysteine | 0.7221 | 13 | 238 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9HA92_43_208_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9684 | 20 | 184 | 3.20.20.70 |
| af_A4IGH2_157_284_3.30.750.200 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; | 0.9604 | 131 | 255 | 3.30.750.200 |
| af_Q9HA92_43_208_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.957 | 20 | 184 | 3.20.20.70 |
| af_Q5SUV1_33_283_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9471 | 15 | 259 | 3.20.20.70 |
| af_P9WP73_8_223_3.80.30.20 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain | 0.9343 | 19 | 228 | 3.80.30.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W5C2G4-F1-model_v4 | deleted | 0.9823 | 16 | 242 |
|
| AF-A0A2D7C169-F1-model_v4 | Heme chaperone HemW | 0.975 | 15 | 391 |
GO:0004109
GO:0005737 GO:0006779 GO:0046872 GO:0051539 |
| AF-A0A3D2BRQ0-F1-model_v4 | Heme chaperone HemW | 0.973 | 16 | 392 |
GO:0004109
GO:0005737 GO:0006779 GO:0046872 GO:0051539 |
| AF-A0A2E3K4G8-F1-model_v4 | Heme chaperone HemW | 0.9692 | 14 | 389 |
GO:0004109
GO:0005737 GO:0006779 GO:0046872 GO:0051539 |
| AF-A0A3B9VET2-F1-model_v4 | Heme chaperone HemW | 0.9683 | 14 | 391 |
GO:0004109
GO:0005737 GO:0006779 GO:0046872 GO:0051539 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar