F347632

General Info

Members Datasets Scaffolds Average Seq Length
234 169 214 380

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2929297113|2929298689
Length 418
Sequence APLRLGWTIYVHVPFCVAKCSYCDFYSHRADPAERLAYGEALRRHLAALPADPGGDGRPPASLFFGGGTPSLLPPSMLVGLVGTVAERFGMPAEVTVEANPGTVSPDDLATWVAGGIRRLSFGAQAFQGRLLHLLGRCHDQAAIGQAVAMAQQAGIEDINLDLIYGIPGQTLEDWRESLQAAVALAPTHLSLYNLKLEVGTPLERQAAAGHVALCPEEDEVAMYEWACAYLAAHGFDQYELSNFARPGYQCRHNLNYWRRGDYLGIGSGAASNWGHYRWTWCLDSRRYSQAWQQGEACALPSMLGGGSNDNVLRSSGGAERPAGVGPAQTVEMIDDFEALAPEVAAGEAIFLGLRRMVGVDLTAVAAEYQVVPSVLTRWQREAEKLRQQGWVTWDGRHLTLTPKAYLLSNEIMERFLP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
3 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
4 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
5 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
6 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
7 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
8 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
9 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
10 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
11 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
12 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
13 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
14 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
15 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
16 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
17 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
18 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
19 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
20 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
21 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
22 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
87 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
105 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
106 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
107 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
108 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
112 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
116 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
117 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
118 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
119 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
120 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
159 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
160 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
161 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
162 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
163 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
164 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
165 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
166 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
167 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
168 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
169 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.45
Metatranscriptomes 0
Isolates 8.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.67
Nodule 0
Rhizoplane 5.98
Rhizosphere 64.96
Stem 0
Stem Tuber 0
Unclassified 12.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_825531 2162886007 Bacteria 5071
2 JGI24751J29686_10000341 3300002459 Bacteria 16857
3 Ga0065704_10000864 3300005289 Bacteria 15301
4 Ga0065704_10007859 3300005289 Bacteria 2473
5 Ga0070658_10000494 3300005327 Bacteria 34238
6 Ga0070658_10006358 3300005327 Bacteria 9573
7 Ga0070658_10030277 3300005327 Bacteria 4350
8 Ga0070658_10092167 3300005327 Bacteria 2498
9 Ga0070666_10042787 3300005335 Bacteria 3031
10 Ga0070661_100000189 3300005344 Bacteria 51018
11 Ga0070668_100009143 3300005347 Bacteria 7352
12 Ga0070669_100000446 3300005353 Bacteria 31546
13 Ga0070669_100003745 3300005353 Bacteria 10979
14 Ga0070671_100000052 3300005355 Bacteria 78614
15 Ga0070671_100000232 3300005355 Bacteria 37343
16 Ga0070671_100013374 3300005355 Bacteria 6616
17 Ga0070671_100145413 3300005355 Bacteria 2001
18 Ga0070667_100002216 3300005367 Bacteria 17087
19 Ga0070667_100009037 3300005367 Bacteria 8248
20 Ga0070667_100011190 3300005367 Bacteria 7422
21 Ga0070663_100035608 3300005455 Bacteria 3454
22 Ga0070662_100001989 3300005457 Bacteria 12527
23 Ga0070707_100012581 3300005468 Bacteria 7904
24 Ga0070698_100201603 3300005471 Bacteria 1925
25 Ga0070699_100306421 3300005518 Bacteria 1425
26 Ga0068853_100057681 3300005539 Bacteria 3351
27 Ga0070686_100066589 3300005544 Bacteria 2344
28 Ga0070665_100032131 3300005548 Bacteria 5283
29 Ga0070665_100077613 3300005548 Bacteria 3328
30 Ga0068855_100025347 3300005563 Bacteria 7096
31 Ga0068855_100040201 3300005563 Bacteria 5551
32 Ga0068855_100116913 3300005563 Bacteria 3056
33 Ga0068857_100025453 3300005577 Bacteria 5211
34 Ga0068854_100000453 3300005578 Bacteria 25275
35 Ga0068854_100003179 3300005578 Bacteria 10251
36 Ga0068856_100140114 3300005614 Bacteria 2425
37 Ga0068852_100000317 3300005616 Bacteria 32757
38 Ga0068859_100103742 3300005617 Bacteria 2902
39 Ga0068859_100189870 3300005617 Bacteria 2139
40 Ga0068864_100076844 3300005618 Bacteria 2919
41 Ga0068863_100000005 3300005841 Bacteria 269757
42 Ga0068863_100011089 3300005841 Bacteria 8740
43 Ga0068858_100038296 3300005842 Bacteria 4448
44 Ga0068860_100000192 3300005843 Bacteria 97363
45 Ga0068860_100059338 3300005843 Bacteria 3638
46 Ga0068860_100374290 3300005843 Bacteria 1405
47 Ga0068862_100015532 3300005844 Bacteria 6323
48 Ga0075363_100006360 3300006048 Bacteria 5351
49 Ga0075363_100088377 3300006048 Bacteria 1703
50 Ga0075364_10057962 3300006051 Bacteria 2537
51 Ga0075432_10001348 3300006058 Bacteria 7961
52 Ga0075362_10000001 3300006177 Bacteria 215983
53 Ga0075362_10002520 3300006177 Bacteria 6169
54 Ga0075367_10007729 3300006178 Bacteria 5528
55 Ga0075369_10014399 3300006186 Bacteria 3159
56 Ga0075369_10037935 3300006186 Bacteria 2054
57 Ga0075366_10000420 3300006195 Bacteria 19887
58 Ga0075366_10011688 3300006195 Bacteria 4961
59 Ga0075366_10022760 3300006195 Bacteria 3648
60 Ga0075370_10006385 3300006353 Bacteria 5924
61 Ga0075370_10039137 3300006353 Bacteria 2671
62 Ga0097620_100103737 3300006931 Bacteria 2902
63 Ga0097620_100189878 3300006931 Bacteria 2139
64 Ga0105250_10005347 3300009092 Bacteria 5766
65 Ga0105243_10218102 3300009148 Bacteria 1684
66 Ga0105246_10001236 3300011119 Bacteria 14986
67 Ga0157372_10019088 3300013307 Bacteria 7381
68 Ga0163161_10022106 3300017792 Bacteria 4477
69 Ga0207696_1001700 3300025711 Bacteria 11426
70 Ga0207680_10095739 3300025903 Bacteria 1898
71 Ga0207647_10028538 3300025904 Bacteria 3622
72 Ga0207705_10000004 3300025909 Bacteria 705756
73 Ga0207695_10023097 3300025913 Bacteria 7038
74 Ga0207657_10000763 3300025919 Bacteria 34137
75 Ga0207652_10001167 3300025921 Bacteria 23590
76 Ga0207646_10000051 3300025922 Bacteria 170502
77 Ga0207681_10000203 3300025923 Bacteria 47389
78 Ga0207681_10000207 3300025923 Bacteria 46953
79 Ga0207644_10000003 3300025931 Bacteria 585905
80 Ga0207644_10049306 3300025931 Bacteria 3014
81 Ga0207706_10003120 3300025933 Bacteria 15935
82 Ga0207706_10032430 3300025933 Bacteria 4652
83 Ga0207679_10123672 3300025945 Bacteria 2064
84 Ga0207667_10032623 3300025949 Bacteria 5609
85 Ga0207667_10068059 3300025949 Bacteria 3709
86 Ga0207667_10084995 3300025949 Bacteria 3275
87 Ga0207640_10000675 3300025981 Bacteria 19912
88 Ga0207640_10001572 3300025981 Bacteria 12263
89 Ga0207658_10002073 3300025986 Bacteria 14924
90 Ga0207658_10005982 3300025986 Bacteria 8317
91 Ga0207658_10013849 3300025986 Bacteria 5518
92 Ga0207703_10005791 3300026035 Bacteria 9904
93 Ga0207639_10065648 3300026041 Bacteria 2818
94 Ga0207678_10021294 3300026067 Bacteria 5684
95 Ga0207702_10004299 3300026078 Bacteria 12693
96 Ga0207641_10000064 3300026088 Bacteria 156652
97 Ga0207641_10054312 3300026088 Bacteria 3398
98 Ga0207676_10106096 3300026095 Bacteria 2340
99 Ga0207698_10000192 3300026142 Bacteria 38082
100 Ga0207698_10045543 3300026142 Bacteria 3306
101 Ga0209813_10000088 3300027866 Bacteria 34192
102 Ga0209974_10034510 3300027876 Bacteria 1680
103 Ga0209974_10049548 3300027876 Bacteria 1409
104 Ga0207428_10163363 3300027907 Bacteria 1690
105 Ga0268266_10024358 3300028379 Bacteria 5148
106 Ga0268266_10047313 3300028379 Bacteria 3685
107 Ga0268266_10056671 3300028379 Bacteria 3371
108 Ga0268265_10003108 3300028380 Bacteria 12110
109 Ga0268265_10009551 3300028380 Bacteria 6552
110 Ga0268265_10045457 3300028380 Bacteria 3276
111 Ga0268264_10000018 3300028381 Bacteria 495324
112 Ga0268264_10028649 3300028381 Bacteria 4558
113 Ga0268264_10372820 3300028381 Bacteria 1365
114 Ga0307508_10076764 3300031616 Bacteria 2919
115 Ga0316576_10160193 3300031727 Bacteria 1697
116 Ga0307405_10006159 3300031731 Bacteria 5876
117 Ga0307413_10016703 3300031824 Bacteria 3801
118 Ga0307413_10147767 3300031824 Bacteria 1634
119 Ga0307410_10140042 3300031852 Bacteria 1789
120 Ga0307412_10012575 3300031911 Bacteria 4939
121 Ga0307409_100161171 3300031995 Bacteria 1962
122 Ga0307414_10010835 3300032004 Bacteria 5317
123 Ga0307411_10012543 3300032005 Bacteria 4632
124 Ga0307411_10209305 3300032005 Bacteria 1505
125 Ga0316574_0083107 3300035398 Bacteria 2036
126 Ga0395899_0102877 3300037312 Bacteria 2060
127 Ga0395900_0318723 3300037418 Bacteria 1535
128 Ga0400484_21377 3300038725 Bacteria 8879
129 Ga0400490_50119 3300038726 Bacteria 4054
130 Ga0439432_021448 3300042006 Bacteria 2141
131 Ga0439462_0000932 3300042015 Bacteria 6199
132 Ga0439464_0022050 3300042439 Bacteria 1752
133 Ga0453684_0472888 3300044712 Bacteria 1392
134 Ga0451576_0000007 3300045051 Bacteria 782228
135 Ga0495617_007276 3300046452 Bacteria 3849
136 Ga0495627_000099 3300046453 Bacteria 107062
137 Ga0495627_000156 3300046453 Bacteria 78784
138 Ga0495638_0029038 3300046460 Bacteria 3567
139 Ga0495650_0001801 3300046471 Bacteria 19318
140 Ga0495583_0000242 3300046506 Bacteria 90367
141 Ga0495606_0085412 3300046507 Bacteria 1952
142 Ga0495610_0000018 3300046512 Bacteria 355044
143 Ga0495610_0005633 3300046512 Bacteria 8836
144 Ga0495632_0000007 3300046519 Bacteria 343246
145 Ga0495637_0023794 3300046520 Bacteria 2776
146 Ga0495643_0000070 3300046522 Bacteria 170879
147 Ga0495648_0038657 3300046524 Bacteria 3048
148 Ga0495663_0000005 3300046525 Bacteria 342265
149 Ga0495633_0000307 3300046558 Bacteria 55767
150 Ga0495633_0003263 3300046558 Bacteria 10931
151 Ga0495661_0079738 3300046665 Bacteria 1891
152 Ga0495671_0000039 3300046692 Bacteria 170879
153 Ga0495681_0000020 3300047470 Bacteria 170007
154 Ga0495681_0000098 3300047470 Bacteria 75809
155 Ga0495681_0009624 3300047470 Bacteria 5934
156 Ga0495686_0035337 3300047472 Bacteria 3213
157 Ga0495686_0038386 3300047472 Bacteria 3063
158 Ga0496100_0005289 3300048903 Bacteria 6933
159 Ga0496101_0004647 3300048904 Bacteria 8685
160 Ga0496101_0012870 3300048904 Bacteria 5596
161 Ga0496102_0000162 3300048905 Bacteria 89746
162 Ga0496103_0000328 3300048906 Bacteria 43483
163 Ga0496104_0000083 3300048907 Bacteria 91698
164 Ga0496105_0000086 3300048908 Bacteria 66447
165 Ga0496106_0010890 3300048909 Bacteria 6718
166 Ga0496106_0108149 3300048909 Bacteria 2163
167 Ga0496108_0240351 3300048911 Bacteria 1575
168 Ga0496112_0195024 3300048915 Bacteria 1986
169 Ga0496113_0000776 3300048916 Bacteria 16491
170 Ga0496114_0006267 3300048917 Bacteria 9365
171 Ga0496114_0021863 3300048917 Bacteria 5207
172 Ga0496117_0000323 3300048920 Bacteria 83916
173 Ga0496117_0037702 3300048920 Bacteria 3597
174 Ga0496118_0012140 3300048921 Bacteria 8311
175 Ga0496119_0000180 3300048922 Bacteria 88339
176 Ga0496120_0000342 3300048923 Bacteria 77136
177 Ga0496121_0000168 3300048924 Bacteria 144896
178 Ga0496121_0000206 3300048924 Bacteria 130071
179 Ga0496121_0002474 3300048924 Bacteria 28166
180 Ga0496122_0000918 3300048925 Bacteria 53963
181 Ga0496123_0001257 3300048926 Bacteria 36453
182 Ga0496124_0014949 3300048927 Bacteria 7472
183 Ga0496125_0004290 3300048928 Bacteria 16559
184 Ga0496126_0000044 3300048929 Bacteria 335904
185 Ga0496126_0030454 3300048929 Bacteria 5112
186 Ga0501047_0097264 3300049581 Bacteria 2822
187 Ga0501235_003370 3300049669 Bacteria 3455
188 Ga0501035_0078145 3300049822 Bacteria 2924
189 Ga0501044_0001194 3300049823 Bacteria 30781
190 nmdc:mga03683_334_c1 3300050489 Bacteria 13821
191 nmdc:mga03683_48_c1 3300050489 Bacteria 53827
192 nmdc:mga03n38_3617_c1 3300050490 Bacteria 4993
193 nmdc:mga00v17_10475_c1 3300050491 Bacteria 5064
194 nmdc:mga00v17_47432_c1 3300050491 Bacteria 2602
195 nmdc:mga0k408_10002_c1 3300050493 Bacteria 5122
196 nmdc:mga0k408_93_c1 3300050493 Bacteria 42678
197 nmdc:mga06z11_636_c1 3300050494 Bacteria 12763
198 nmdc:mga04h51_287_c1 3300050495 Bacteria 12948
199 nmdc:mga07m45_46_c1 3300050496 Bacteria 18747
200 nmdc:mga07m45_4_c1 3300050496 Bacteria 409607
201 nmdc:mga0sz30_19386_c1 3300050516 Bacteria 2735
202 nmdc:mga0sz30_2566_c1 3300050516 Bacteria 6464
203 nmdc:mga0sz30_35133_c1 3300050516 Bacteria 2090
204 Ga0500643_000001 3300053087 Bacteria 1440111
205 Ga0500607_000082 3300053121 Bacteria 70790
206 Ga0500618_002760 3300053125 Bacteria 6385
207 Ga0500564_002319 3300053138 Bacteria 7001
208 Ga0500564_062159 3300053138 Bacteria 1693
209 Ga0500573_0127948 3300053140 Bacteria 1409
210 Ga0500637_0032240 3300053178 Bacteria 2921
211 Ga0500567_003006 3300053723 Bacteria 7393
212 Ga0500625_000018 3300053729 Bacteria 94860
213 Ga0500645_002566 3300053730 Bacteria 7999
214 Ga0500645_051760 3300053730 Bacteria 1197

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031852 Ga0307410_10140042 Ga0307410_101400423 316
2 3300042015 Ga0439462_0000932 Ga0439462_0000932_2888_3841 316
3 3300050516 nmdc:mga0sz30_19386_c1 nmdc:mga0sz30_19386_c1_1771_2724 316
4 3300053730 Ga0500645_051760 Ga0500645_051760_229_1182 316
5 3300044712 Ga0453684_0472888 Ga0453684_0472888_71_1126 343
6 iso_pu_bacteria 2808606401 2809063021 344
7 iso_pu_bacteria 2808606404 2809078985 344
8 iso_pu_bacteria 2808606405 2809083640 344
9 iso_pu_bacteria 2880518877 2880520276 344
10 3300046452 Ga0495617_007276 Ga0495617_007276_1997_3049 350
11 3300046453 Ga0495627_000156 Ga0495627_000156_34501_35553 350
12 3300046512 Ga0495610_0005633 Ga0495610_0005633_2318_3370 350
13 3300046519 Ga0495632_0000007 Ga0495632_0000007_242300_243352 350
14 3300046520 Ga0495637_0023794 Ga0495637_0023794_22_1074 350
15 3300046522 Ga0495643_0000070 Ga0495643_0000070_138502_139554 350
16 3300046524 Ga0495648_0038657 Ga0495648_0038657_1985_3037 350
17 3300046525 Ga0495663_0000005 Ga0495663_0000005_241319_242371 350
18 3300046558 Ga0495633_0000307 Ga0495633_0000307_6217_7269 350
19 3300046558 Ga0495633_0003263 Ga0495633_0003263_3487_4539 350
20 3300046665 Ga0495661_0079738 Ga0495661_0079738_191_1243 350
21 3300046692 Ga0495671_0000039 Ga0495671_0000039_31326_32378 350
22 3300047470 Ga0495681_0000098 Ga0495681_0000098_15128_16180 350
23 3300047470 Ga0495681_0009624 Ga0495681_0009624_3136_4188 350
24 3300047472 Ga0495686_0035337 Ga0495686_0035337_1684_2736 350
25 3300047472 Ga0495686_0038386 Ga0495686_0038386_1096_2148 350
26 3300035398 Ga0316574_0083107 Ga0316574_0083107_554_1720 358
27 3300005468 Ga0070707_100012581 Ga0070707_1000125819 359
28 3300005471 Ga0070698_100201603 Ga0070698_1002016031 359
29 3300005518 Ga0070699_100306421 Ga0070699_1003064211 359
30 3300025922 Ga0207646_10000051 Ga0207646_1000005158 359
31 3300031727 Ga0316576_10160193 Ga0316576_101601932 360
32 3300046506 Ga0495583_0000242 Ga0495583_0000242_73338_74579 365
33 3300038725 Ga0400484_21377 Ga0400484_21377_701_1867 375
34 3300038726 Ga0400490_50119 Ga0400490_50119_686_1852 375
35 3300042006 Ga0439432_021448 Ga0439432_021448_825_2048 375
36 3300031995 Ga0307409_100161171 Ga0307409_1001611712 376
37 3300049669 Ga0501235_003370 Ga0501235_003370_1611_2741 376
38 iso_pu_bacteria 2929297113 2929298689 376
39 3300042439 Ga0439464_0022050 Ga0439464_0022050_214_1440 377
40 iso_pu_bacteria 2643221588 2643949230 378
41 iso_pu_bacteria 2739367664 2739650083 378
42 iso_pu_bacteria 2739367865 2740028556 378
43 iso_pu_bacteria 2848297114 2848299854 378
44 iso_pu_bacteria 2882806704 2882807787 378
45 iso_pu_bacteria 2895880812 2895886148 378
46 iso_pu_bacteria 2896253425 2896255199 378
47 3300025919 Ga0207657_10000763 Ga0207657_100007639 379
48 3300053087 Ga0500643_000001 Ga0500643_000001_1406762_1407901 379
49 iso_pu_bacteria 2738541275 2738711849 379
50 iso_pu_bacteria 2738541301 2738850274 379
51 iso_pu_bacteria 2738541304 2738866003 379
52 iso_pu_bacteria 2738543022 2739298521 379
53 iso_pu_bacteria 2738543033 2739360199 379
54 iso_pu_bacteria 2919709256 2919712752 379
55 iso_pu_bacteria 2928100450 2928103017 379
56 iso_pu_bacteria 2928959182 2928959581 379
57 3300005327 Ga0070658_10030277 Ga0070658_100302773 380
58 3300032005 Ga0307411_10209305 Ga0307411_102093052 380
59 3300037418 Ga0395900_0318723 Ga0395900_0318723_183_1418 380
60 3300005344 Ga0070661_100000189 Ga0070661_10000018917 381
61 3300002459 JGI24751J29686_10000341 JGI24751J29686_1000034112 382
62 3300005289 Ga0065704_10007859 Ga0065704_100078592 382
63 3300005327 Ga0070658_10000494 Ga0070658_1000049424 382
64 3300005327 Ga0070658_10006358 Ga0070658_100063585 382
65 3300005327 Ga0070658_10092167 Ga0070658_100921673 382
66 3300005335 Ga0070666_10042787 Ga0070666_100427872 382
67 3300005347 Ga0070668_100009143 Ga0070668_1000091437 382
68 3300005353 Ga0070669_100003745 Ga0070669_10000374510 382
69 3300005355 Ga0070671_100000052 Ga0070671_10000005232 382
70 3300005355 Ga0070671_100145413 Ga0070671_1001454132 382
71 3300005367 Ga0070667_100002216 Ga0070667_10000221613 382
72 3300005367 Ga0070667_100011190 Ga0070667_1000111901 382
73 3300005455 Ga0070663_100035608 Ga0070663_1000356083 382
74 3300005457 Ga0070662_100001989 Ga0070662_1000019892 382
75 3300005539 Ga0068853_100057681 Ga0068853_1000576812 382
76 3300005544 Ga0070686_100066589 Ga0070686_1000665892 382
77 3300005548 Ga0070665_100077613 Ga0070665_1000776132 382
78 3300005563 Ga0068855_100025347 Ga0068855_1000253472 382
79 3300005563 Ga0068855_100040201 Ga0068855_1000402012 382
80 3300005563 Ga0068855_100116913 Ga0068855_1001169131 382
81 3300005577 Ga0068857_100025453 Ga0068857_1000254534 382
82 3300005578 Ga0068854_100000453 Ga0068854_10000045321 382
83 3300005578 Ga0068854_100003179 Ga0068854_1000031792 382
84 3300005614 Ga0068856_100140114 Ga0068856_1001401142 382
85 3300005616 Ga0068852_100000317 Ga0068852_10000031727 382
86 3300005617 Ga0068859_100103742 Ga0068859_1001037423 382
87 3300005617 Ga0068859_100189870 Ga0068859_1001898702 382
88 3300005618 Ga0068864_100076844 Ga0068864_1000768441 382
89 3300005841 Ga0068863_100000005 Ga0068863_1000000053 382
90 3300005841 Ga0068863_100011089 Ga0068863_1000110899 382
91 3300005842 Ga0068858_100038296 Ga0068858_1000382963 382
92 3300005843 Ga0068860_100000192 Ga0068860_1000001923 382
93 3300005843 Ga0068860_100374290 Ga0068860_1003742901 382
94 3300005844 Ga0068862_100015532 Ga0068862_1000155322 382
95 3300006048 Ga0075363_100006360 Ga0075363_1000063607 382
96 3300006048 Ga0075363_100088377 Ga0075363_1000883772 382
97 3300006051 Ga0075364_10057962 Ga0075364_100579622 382
98 3300006058 Ga0075432_10001348 Ga0075432_100013482 382
99 3300006177 Ga0075362_10000001 Ga0075362_1000000145 382
100 3300006177 Ga0075362_10002520 Ga0075362_100025202 382
101 3300006178 Ga0075367_10007729 Ga0075367_100077297 382
102 3300006186 Ga0075369_10014399 Ga0075369_100143994 382
103 3300006186 Ga0075369_10037935 Ga0075369_100379352 382
104 3300006195 Ga0075366_10000420 Ga0075366_100004209 382
105 3300006195 Ga0075366_10011688 Ga0075366_100116886 382
106 3300006195 Ga0075366_10022760 Ga0075366_100227604 382
107 3300006353 Ga0075370_10006385 Ga0075370_100063857 382
108 3300006353 Ga0075370_10039137 Ga0075370_100391371 382
109 3300006931 Ga0097620_100103737 Ga0097620_1001037373 382
110 3300006931 Ga0097620_100189878 Ga0097620_1001898782 382
111 3300011119 Ga0105246_10001236 Ga0105246_100012369 382
112 3300013307 Ga0157372_10019088 Ga0157372_100190888 382
113 3300017792 Ga0163161_10022106 Ga0163161_100221063 382
114 3300025903 Ga0207680_10095739 Ga0207680_100957392 382
115 3300025904 Ga0207647_10028538 Ga0207647_100285384 382
116 3300025909 Ga0207705_10000004 Ga0207705_10000004590 382
117 3300025913 Ga0207695_10023097 Ga0207695_100230978 382
118 3300025921 Ga0207652_10001167 Ga0207652_1000116712 382
119 3300025923 Ga0207681_10000207 Ga0207681_1000020715 382
120 3300025931 Ga0207644_10000003 Ga0207644_10000003512 382
121 3300025931 Ga0207644_10049306 Ga0207644_100493064 382
122 3300025933 Ga0207706_10003120 Ga0207706_100031202 382
123 3300025933 Ga0207706_10032430 Ga0207706_100324304 382
124 3300025945 Ga0207679_10123672 Ga0207679_101236722 382
125 3300025949 Ga0207667_10032623 Ga0207667_100326232 382
126 3300025949 Ga0207667_10068059 Ga0207667_100680591 382
127 3300025981 Ga0207640_10000675 Ga0207640_1000067518 382
128 3300025981 Ga0207640_10001572 Ga0207640_1000157213 382
129 3300025986 Ga0207658_10002073 Ga0207658_100020738 382
130 3300025986 Ga0207658_10013849 Ga0207658_100138494 382
131 3300026035 Ga0207703_10005791 Ga0207703_100057915 382
132 3300026041 Ga0207639_10065648 Ga0207639_100656484 382
133 3300026067 Ga0207678_10021294 Ga0207678_100212947 382
134 3300026078 Ga0207702_10004299 Ga0207702_100042999 382
135 3300026088 Ga0207641_10000064 Ga0207641_1000006470 382
136 3300026088 Ga0207641_10054312 Ga0207641_100543123 382
137 3300026095 Ga0207676_10106096 Ga0207676_101060962 382
138 3300026142 Ga0207698_10000192 Ga0207698_1000019238 382
139 3300026142 Ga0207698_10045543 Ga0207698_100455434 382
140 3300027866 Ga0209813_10000088 Ga0209813_1000008829 382
141 3300027876 Ga0209974_10034510 Ga0209974_100345102 382
142 3300027876 Ga0209974_10049548 Ga0209974_100495482 382
143 3300027907 Ga0207428_10163363 Ga0207428_101633632 382
144 3300028379 Ga0268266_10047313 Ga0268266_100473132 382
145 3300028379 Ga0268266_10056671 Ga0268266_100566713 382
146 3300028380 Ga0268265_10003108 Ga0268265_100031087 382
147 3300028380 Ga0268265_10009551 Ga0268265_100095515 382
148 3300028381 Ga0268264_10000018 Ga0268264_1000001893 382
149 3300028381 Ga0268264_10372820 Ga0268264_103728202 382
150 3300031616 Ga0307508_10076764 Ga0307508_100767643 382
151 3300031731 Ga0307405_10006159 Ga0307405_100061592 382
152 3300031824 Ga0307413_10016703 Ga0307413_100167032 382
153 3300031824 Ga0307413_10147767 Ga0307413_101477672 382
154 3300031911 Ga0307412_10012575 Ga0307412_100125755 382
155 3300032004 Ga0307414_10010835 Ga0307414_100108356 382
156 3300032005 Ga0307411_10012543 Ga0307411_100125432 382
157 3300045051 Ga0451576_0000007 Ga0451576_0000007_48067_49218 382
158 3300046453 Ga0495627_000099 Ga0495627_000099_104722_105873 382
159 3300046460 Ga0495638_0029038 Ga0495638_0029038_1583_2734 382
160 3300046471 Ga0495650_0001801 Ga0495650_0001801_10445_11596 382
161 3300046507 Ga0495606_0085412 Ga0495606_0085412_251_1402 382
162 3300046512 Ga0495610_0000018 Ga0495610_0000018_34215_35366 382
163 3300047470 Ga0495681_0000020 Ga0495681_0000020_42529_43680 382
164 3300048904 Ga0496101_0012870 Ga0496101_0012870_2255_3406 382
165 3300048909 Ga0496106_0010890 Ga0496106_0010890_2450_3601 382
166 3300048911 Ga0496108_0240351 Ga0496108_0240351_37_1188 382
167 3300048917 Ga0496114_0006267 Ga0496114_0006267_348_1499 382
168 3300048917 Ga0496114_0021863 Ga0496114_0021863_932_2083 382
169 3300048920 Ga0496117_0037702 Ga0496117_0037702_1694_2845 382
170 3300048924 Ga0496121_0000168 Ga0496121_0000168_124717_125877 382
171 3300048924 Ga0496121_0000206 Ga0496121_0000206_67954_69105 382
172 3300048929 Ga0496126_0030454 Ga0496126_0030454_3036_4184 382
173 3300049581 Ga0501047_0097264 Ga0501047_0097264_1529_2680 382
174 3300049822 Ga0501035_0078145 Ga0501035_0078145_1331_2482 382
175 3300050489 nmdc:mga03683_334_c1 nmdc:mga03683_334_c1_4971_6122 382
176 3300050489 nmdc:mga03683_48_c1 nmdc:mga03683_48_c1_46784_47935 382
177 3300050490 nmdc:mga03n38_3617_c1 nmdc:mga03n38_3617_c1_1384_2535 382
178 3300050491 nmdc:mga00v17_10475_c1 nmdc:mga00v17_10475_c1_1197_2348 382
179 3300050491 nmdc:mga00v17_47432_c1 nmdc:mga00v17_47432_c1_849_2000 382
180 3300050493 nmdc:mga0k408_10002_c1 nmdc:mga0k408_10002_c1_405_1556 382
181 3300050493 nmdc:mga0k408_93_c1 nmdc:mga0k408_93_c1_29306_30457 382
182 3300050494 nmdc:mga06z11_636_c1 nmdc:mga06z11_636_c1_403_1554 382
183 3300050495 nmdc:mga04h51_287_c1 nmdc:mga04h51_287_c1_6680_7831 382
184 3300050496 nmdc:mga07m45_46_c1 nmdc:mga07m45_46_c1_4487_5638 382
185 3300050496 nmdc:mga07m45_4_c1 nmdc:mga07m45_4_c1_369296_370447 382
186 3300050516 nmdc:mga0sz30_2566_c1 nmdc:mga0sz30_2566_c1_3642_4793 382
187 3300050516 nmdc:mga0sz30_35133_c1 nmdc:mga0sz30_35133_c1_623_1774 382
188 3300053125 Ga0500618_002760 Ga0500618_002760_4547_5695 382
189 3300053138 Ga0500564_062159 Ga0500564_062159_209_1360 382
190 3300009092 Ga0105250_10005347 Ga0105250_100053475 383
191 3300028379 Ga0268266_10024358 Ga0268266_100243582 383
192 3300048903 Ga0496100_0005289 Ga0496100_0005289_4533_5684 383
193 3300048904 Ga0496101_0004647 Ga0496101_0004647_483_1634 383
194 3300048905 Ga0496102_0000162 Ga0496102_0000162_14640_15791 383
195 3300048906 Ga0496103_0000328 Ga0496103_0000328_22888_24039 383
196 3300048907 Ga0496104_0000083 Ga0496104_0000083_57889_59040 383
197 3300048908 Ga0496105_0000086 Ga0496105_0000086_60949_62100 383
198 3300048909 Ga0496106_0108149 Ga0496106_0108149_391_1542 383
199 3300048915 Ga0496112_0195024 Ga0496112_0195024_36_1187 383
200 3300048916 Ga0496113_0000776 Ga0496113_0000776_14840_15991 383
201 3300048920 Ga0496117_0000323 Ga0496117_0000323_7866_9017 383
202 3300048921 Ga0496118_0012140 Ga0496118_0012140_3552_4703 383
203 3300048922 Ga0496119_0000180 Ga0496119_0000180_32531_33682 383
204 3300048923 Ga0496120_0000342 Ga0496120_0000342_53070_54221 383
205 3300048924 Ga0496121_0002474 Ga0496121_0002474_12609_13760 383
206 3300048925 Ga0496122_0000918 Ga0496122_0000918_41288_42439 383
207 3300048926 Ga0496123_0001257 Ga0496123_0001257_12368_13519 383
208 3300048927 Ga0496124_0014949 Ga0496124_0014949_3960_5111 383
209 3300048928 Ga0496125_0004290 Ga0496125_0004290_11179_12330 383
210 3300048929 Ga0496126_0000044 Ga0496126_0000044_45644_46795 383
211 3300025949 Ga0207667_10084995 Ga0207667_100849952 384
212 3300037312 Ga0395899_0102877 Ga0395899_0102877_161_1447 384
213 3300053138 Ga0500564_002319 Ga0500564_002319_2805_3962 384
214 3300053140 Ga0500573_0127948 Ga0500573_0127948_210_1367 384
215 3300053723 Ga0500567_003006 Ga0500567_003006_1167_2324 384
216 3300053729 Ga0500625_000018 Ga0500625_000018_3156_4313 384
217 3300009148 Ga0105243_10218102 Ga0105243_102181022 386
218 3300049823 Ga0501044_0001194 Ga0501044_0001194_27895_29058 386
219 3300005355 Ga0070671_100000232 Ga0070671_10000023225 390
220 3300053121 Ga0500607_000082 Ga0500607_000082_49198_50388 392
221 3300053178 Ga0500637_0032240 Ga0500637_0032240_1547_2737 392
222 3300053730 Ga0500645_002566 Ga0500645_002566_3440_4630 392
223 2162886007 SwRhRL2b_contig_825531 SwRhRL2b_0722.00008850 396
224 3300005289 Ga0065704_10000864 Ga0065704_100008643 396
225 3300005353 Ga0070669_100000446 Ga0070669_10000044623 396
226 3300005355 Ga0070671_100013374 Ga0070671_1000133748 396
227 3300005367 Ga0070667_100009037 Ga0070667_1000090377 396
228 3300005548 Ga0070665_100032131 Ga0070665_1000321312 396
229 3300005843 Ga0068860_100059338 Ga0068860_1000593383 396
230 3300025711 Ga0207696_1001700 Ga0207696_10017009 396
231 3300025923 Ga0207681_10000203 Ga0207681_100002038 396
232 3300025986 Ga0207658_10005982 Ga0207658_100059827 396
233 3300028380 Ga0268265_10045457 Ga0268265_100454573 396
234 3300028381 Ga0268264_10028649 Ga0268264_100286493 396

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

10

182

0.88

PF06969

HemN_C

HemN C-terminal domain

340

408

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1olt-assembly1.cif.gz_A coproporphyrinogen iii oxidase (hemn) from escherichia coli is a radical sam enzyme. 0.8395 12 387
1olt-assembly1.cif.gz_A coproporphyrinogen iii oxidase (hemn) from escherichia coli is a radical sam enzyme. 0.799 12 387
6efn-assembly1.cif.gz_A-2 structure of a ripp maturase, skfb 0.7376 15 241
6qk7-assembly1.cif.gz_C elongator catalytic subcomplex elp123 lobe 0.7247 14 235
6q2q-assembly2.cif.gz_B crystal structure of mouse viperin bound to uridine triphosphate and s-adenosylhomocysteine 0.7221 13 238
ID Description Score Start End Superfamily
af_Q9HA92_43_208_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9684 20 184 3.20.20.70
af_A4IGH2_157_284_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.9604 131 255 3.30.750.200
af_Q9HA92_43_208_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.957 20 184 3.20.20.70
af_Q5SUV1_33_283_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9471 15 259 3.20.20.70
af_P9WP73_8_223_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.9343 19 228 3.80.30.20
ID Description Score Start End GO Terms
AF-A0A2W5C2G4-F1-model_v4 deleted 0.9823 16 242
AF-A0A2D7C169-F1-model_v4 Heme chaperone HemW 0.975 15 391 GO:0004109
GO:0005737
GO:0006779
GO:0046872
GO:0051539
AF-A0A3D2BRQ0-F1-model_v4 Heme chaperone HemW 0.973 16 392 GO:0004109
GO:0005737
GO:0006779
GO:0046872
GO:0051539
AF-A0A2E3K4G8-F1-model_v4 Heme chaperone HemW 0.9692 14 389 GO:0004109
GO:0005737
GO:0006779
GO:0046872
GO:0051539
AF-A0A3B9VET2-F1-model_v4 Heme chaperone HemW 0.9683 14 391 GO:0004109
GO:0005737
GO:0006779
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
93.55 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map