F347370

General Info

Members Datasets Scaffolds Average Seq Length
234 123 468 152

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0164959|Ga0466970_0164959_592_1143
Length 183
Sequence VEHRPALAPVAGTPRGGAADTGGVRPDAVGDHVAMTANAGLPAGLFTTIDHVGIAVPDLDEAIAFYARTYGVRSVHEETNEEQGVREAMLAVGDGDTRIQLLAPLSPDSTIAKFIGRSGPGLQQLAFRVDDVEAASAVLRERGLRLLYDAPRRGTAGSRVNFVHPKDAGGVLVELVQPAAGGH

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
23 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
24 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
25 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
36 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
37 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
38 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
39 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
40 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
41 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
42 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
43 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
44 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
45 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
46 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
47 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
48 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
49 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
50 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
51 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
52 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
59 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
60 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
61 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
62 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
63 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
64 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
65 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
66 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
67 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
68 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
69 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
82 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
83 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
84 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
85 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
86 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
87 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
88 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
89 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
90 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
94 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
108 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
113 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
117 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
118 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
121 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
122 2643221641 Nocardioides sp. Root122 Isolate Unclassified
123 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.99
Nodule 0
Rhizoplane 2.99
Rhizosphere 88.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0164959 3300044765 Bacteria 1226
2 LJQas_1016472 3300000549 Bacteria 862
3 Ga0070683_100686095 3300005329 Bacteria 981
4 Ga0070659_100396232 3300005366 Bacteria 1165
5 Ga0070667_100003719 3300005367 Bacteria 12950
6 Ga0070714_101845366 3300005435 Bacteria 590
7 Ga0070713_100668614 3300005436 Bacteria 990
8 Ga0068855_101182376 3300005563 Bacteria 796
9 Ga0068854_100361406 3300005578 Bacteria 1191
10 Ga0068856_100083081 3300005614 Bacteria 3180
11 Ga0068852_100917895 3300005616 Bacteria 893
12 Ga0068858_101293302 3300005842 Bacteria 718
13 Ga0068860_100820262 3300005843 Bacteria 944
14 Ga0075365_10205225 3300006038 Bacteria 1381
15 Ga0075364_10000264 3300006051 Bacteria 25484
16 Ga0111539_10513962 3300009094 Bacteria 1395
17 Ga0114129_10293659 3300009147 Bacteria 2168
18 Ga0105242_11486207 3300009176 Bacteria 708
19 Ga0105238_11940367 3300009551 Bacteria 622
20 Ga0157369_10018358 3300013105 Bacteria 7842
21 Ga0157369_10284844 3300013105 Bacteria 1721
22 Ga0157372_10396942 3300013307 Bacteria 1607
23 Ga0157372_10761896 3300013307 Bacteria 1125
24 Ga0157375_10840007 3300013308 Bacteria 1065
25 Ga0157380_11042100 3300014326 Bacteria 854
26 Ga0213876_10005167 3300021384 Bacteria 7197
27 Ga0207710_10459520 3300025900 Bacteria 658
28 Ga0207647_10186086 3300025904 Bacteria 1205
29 Ga0207657_10398537 3300025919 Bacteria 1082
30 Ga0207700_10819903 3300025928 Bacteria 832
31 Ga0207664_10025960 3300025929 Bacteria 4422
32 Ga0207664_10036802 3300025929 Bacteria 3784
33 Ga0207668_11597531 3300025972 Bacteria 589
34 Ga0207702_10900768 3300026078 Bacteria 876
35 Ga0207675_100270309 3300026118 Bacteria 1649
36 Ga0268266_10271952 3300028379 Bacteria 1573
37 Ga0307408_100142076 3300031548 Bacteria 1885
38 Ga0307408_100524070 3300031548 Bacteria 1041
39 Ga0307408_100655536 3300031548 Bacteria 939
40 Ga0307408_101051610 3300031548 Bacteria 753
41 Ga0307508_10001486 3300031616 Bacteria 26310
42 Ga0307508_10094675 3300031616 Bacteria 2577
43 Ga0316579_10000161 3300031691 Bacteria 19214
44 Ga0307405_10395003 3300031731 Bacteria 1081
45 Ga0307405_10497773 3300031731 Bacteria 976
46 Ga0307413_10119911 3300031824 Bacteria 1780
47 Ga0307413_10457842 3300031824 Bacteria 1014
48 Ga0307413_10782313 3300031824 Bacteria 800
49 Ga0307413_10809013 3300031824 Bacteria 788
50 Ga0307413_10897168 3300031824 Bacteria 753
51 Ga0307413_11063486 3300031824 Bacteria 697
52 Ga0307518_10068916 3300031838 Bacteria 2563
53 Ga0307410_10201826 3300031852 Bacteria 1518
54 Ga0307410_10332679 3300031852 Bacteria 1208
55 Ga0307410_10393155 3300031852 Bacteria 1118
56 Ga0307410_10727097 3300031852 Bacteria 839
57 Ga0307410_10810435 3300031852 Bacteria 797
58 Ga0307410_10830498 3300031852 Bacteria 788
59 Ga0307406_10103642 3300031901 Bacteria 1943
60 Ga0307406_10125135 3300031901 Bacteria 1794
61 Ga0307406_10199854 3300031901 Bacteria 1470
62 Ga0307406_10439806 3300031901 Bacteria 1043
63 Ga0307406_10446501 3300031901 Bacteria 1036
64 Ga0307406_10557521 3300031901 Bacteria 938
65 Ga0307406_11002011 3300031901 Bacteria 717
66 Ga0307406_11044682 3300031901 Bacteria 703
67 Ga0307406_11168356 3300031901 Bacteria 667
68 Ga0307406_11319214 3300031901 Bacteria 630
69 Ga0307406_11542414 3300031901 Bacteria 585
70 Ga0307407_10238813 3300031903 Bacteria 1238
71 Ga0307407_10351946 3300031903 Bacteria 1043
72 Ga0307412_10123704 3300031911 Bacteria 1867
73 Ga0307412_10356402 3300031911 Bacteria 1176
74 Ga0307412_10399648 3300031911 Bacteria 1118
75 Ga0307409_100192089 3300031995 Bacteria 1818
76 Ga0307409_100247186 3300031995 Bacteria 1628
77 Ga0307409_100271150 3300031995 Bacteria 1563
78 Ga0307409_100321933 3300031995 Bacteria 1447
79 Ga0307409_100348735 3300031995 Bacteria 1396
80 Ga0307409_101274792 3300031995 Bacteria 759
81 Ga0307409_101366732 3300031995 Bacteria 734
82 Ga0307409_101986974 3300031995 Bacteria 611
83 Ga0307416_100010890 3300032002 Bacteria 6031
84 Ga0307416_100043125 3300032002 Bacteria 3529
85 Ga0307416_100076977 3300032002 Bacteria 2799
86 Ga0307416_100181279 3300032002 Bacteria 1974
87 Ga0307416_100780538 3300032002 Bacteria 1050
88 Ga0307416_101083460 3300032002 Bacteria 905
89 Ga0307414_10247384 3300032004 Bacteria 1480
90 Ga0307414_10533621 3300032004 Bacteria 1043
91 Ga0307414_11054728 3300032004 Bacteria 749
92 Ga0307411_10358472 3300032005 Bacteria 1191
93 Ga0307411_10774842 3300032005 Bacteria 842
94 Ga0307415_100105586 3300032126 Bacteria 2077
95 Ga0307415_100117929 3300032126 Bacteria 1983
96 Ga0307415_100156309 3300032126 Bacteria 1761
97 Ga0307415_100169387 3300032126 Bacteria 1701
98 Ga0307415_100251637 3300032126 Bacteria 1436
99 Ga0307415_100453334 3300032126 Bacteria 1109
100 Ga0307415_100743588 3300032126 Bacteria 890
101 Ga0307507_10469769 3300033179 Bacteria 688
102 Ga0373951_0000129 3300035091 Bacteria 28572
103 Ga0373943_0207129 3300035170 Bacteria 1088
104 Ga0373925_0971419 3300037068 Bacteria 700
105 Ga0395899_0160449 3300037312 Bacteria 1589
106 Ga0395900_0054718 3300037418 Bacteria 4109
107 Ga0395900_0055999 3300037418 Bacteria 4059
108 Ga0395900_0180476 3300037418 Bacteria 2146
109 Ga0395898_0351546 3300037466 Bacteria 1405
110 Ga0395905_0260583 3300037471 Bacteria 1619
111 Ga0395901_0015530 3300038443 Bacteria 7755
112 Ga0395901_0029536 3300038443 Bacteria 5645
113 Ga0400483_086381 3300039062 Bacteria 22243
114 Ga0436365_1876162 3300039437 Bacteria 22108
115 Ga0436360_0620632 3300039438 Bacteria 1006
116 Ga0451787_730292 3300041441 Bacteria 628
117 Ga0451791_0652727 3300041451 Bacteria 543
118 Ga0451793_0727925 3300041452 Bacteria 3674
119 Ga0451802_1324947 3300041460 Bacteria 643
120 Ga0451833_0609791 3300041491 Bacteria 15579
121 Ga0451837_0459564 3300041494 Bacteria 7080
122 Ga0451845_0314653 3300041501 Bacteria 1089
123 Ga0451853_3871129 3300041512 Bacteria 590
124 Ga0466972_0024822 3300044658 Bacteria 2975
125 Ga0466972_0133935 3300044658 Bacteria 1167
126 Ga0466972_0248537 3300044658 Bacteria 832
127 Ga0466965_0037571 3300044683 Bacteria 2378
128 Ga0466965_0048726 3300044683 Bacteria 2099
129 Ga0466965_0142507 3300044683 Bacteria 1249
130 Ga0466965_0209532 3300044683 Bacteria 1036
131 Ga0466966_0203429 3300044684 Bacteria 1198
132 Ga0466961_0098417 3300044693 Bacteria 1844
133 Ga0466961_0147301 3300044693 Bacteria 1472
134 Ga0466961_0173424 3300044693 Bacteria 1341
135 Ga0466961_0216335 3300044693 Bacteria 1182
136 Ga0466961_0265372 3300044693 Bacteria 1052
137 Ga0466961_0347038 3300044693 Bacteria 904
138 Ga0466963_0153714 3300044694 Bacteria 1599
139 Ga0466963_0178633 3300044694 Bacteria 1481
140 Ga0466963_0211414 3300044694 Bacteria 1357
141 Ga0466963_0477544 3300044694 Bacteria 880
142 Ga0466963_0691204 3300044694 Bacteria 720
143 Ga0466963_1280182 3300044694 Bacteria 515
144 Ga0466964_0173169 3300044706 Bacteria 1018
145 Ga0466964_0544204 3300044706 Bacteria 629
146 Ga0466971_0254340 3300044719 Bacteria 837
147 Ga0466971_0398611 3300044719 Bacteria 670
148 Ga0466970_0037739 3300044765 Bacteria 2562
149 Ga0466970_0038106 3300044765 Bacteria 2549
150 Ga0466970_0110145 3300044765 Bacteria 1503
151 Ga0466970_0133095 3300044765 Bacteria 1367
152 Ga0466970_0146584 3300044765 Bacteria 1302
153 Ga0466970_0213053 3300044765 Bacteria 1077
154 Ga0466970_0316430 3300044765 Bacteria 882
155 Ga0466970_0333211 3300044765 Bacteria 859
156 Ga0466970_0500513 3300044765 Bacteria 700
157 Ga0466970_0564892 3300044765 Bacteria 658
158 Ga0466970_0818886 3300044765 Bacteria 546
159 Ga0466957_0366998 3300044842 Bacteria 979
160 Ga0466957_0543229 3300044842 Bacteria 809
161 Ga0466957_0658665 3300044842 Bacteria 737
162 Ga0466957_1011495 3300044842 Bacteria 597
163 Ga0466960_0037000 3300044901 Bacteria 2288
164 Ga0466960_0098132 3300044901 Bacteria 1504
165 Ga0466960_0153623 3300044901 Bacteria 1231
166 Ga0466960_0412555 3300044901 Bacteria 779
167 Ga0466960_0943025 3300044901 Bacteria 528
168 Ga0466959_0176500 3300045049 Bacteria 1496
169 Ga0466958_0158839 3300045836 Bacteria 1427
170 Ga0466958_0332294 3300045836 Bacteria 977
171 Ga0466958_0760886 3300045836 Bacteria 631
172 Ga0466967_0002128 3300045976 Bacteria 12137
173 Ga0466967_0130499 3300045976 Bacteria 2332
174 Ga0466967_0255498 3300045976 Bacteria 1675
175 Ga0466967_0327224 3300045976 Bacteria 1479
176 Ga0495596_0264317 3300046500 Bacteria 668
177 Ga0495620_0095964 3300046515 Bacteria 1186
178 Ga0495631_0118799 3300046518 Bacteria 1137
179 Ga0495598_0325293 3300046537 Bacteria 587
180 Ga0495621_0197780 3300046539 Bacteria 808
181 Ga0495656_0109578 3300046615 Bacteria 1289
182 Ga0495668_0126551 3300046616 Bacteria 1399
183 Ga0495661_0138936 3300046665 Bacteria 1324
184 Ga0495588_0418769 3300046674 Bacteria 703
185 Ga0496101_1152681 3300048904 Bacteria 608
186 Ga0496102_0234508 3300048905 Bacteria 1730
187 Ga0496109_0890175 3300048912 Bacteria 828
188 Ga0496124_0091790 3300048927 Bacteria 2474
189 Ga0501031_0020816 3300049568 Bacteria 4277
190 Ga0501031_0419720 3300049568 Bacteria 865
191 Ga0501032_0004868 3300049569 Bacteria 10049
192 Ga0501033_0004849 3300049570 Bacteria 10720
193 Ga0501034_0012560 3300049571 Bacteria 8742
194 Ga0501036_0018349 3300049572 Bacteria 5859
195 Ga0501036_0025958 3300049572 Bacteria 4943
196 Ga0501037_0011182 3300049573 Bacteria 6604
197 Ga0501037_0175135 3300049573 Bacteria 1524
198 Ga0501038_0013548 3300049574 Bacteria 7431
199 Ga0501038_0047092 3300049574 Bacteria 3736
200 Ga0501039_0020447 3300049575 Bacteria 5073
201 Ga0501039_0304507 3300049575 Bacteria 1253
202 Ga0501042_0064918 3300049578 Bacteria 2609
203 Ga0501042_0159781 3300049578 Bacteria 1626
204 Ga0501042_0669543 3300049578 Bacteria 754
205 Ga0501043_0005169 3300049579 Bacteria 10558
206 Ga0501043_0183995 3300049579 Bacteria 1627
207 Ga0501046_0002171 3300049580 Bacteria 18533
208 Ga0501047_0005752 3300049581 Bacteria 11671
209 Ga0501047_0039734 3300049581 Bacteria 4550
210 Ga0501048_0007889 3300049582 Bacteria 8064
211 Ga0501048_0088473 3300049582 Bacteria 2185
212 Ga0501067_0198219 3300049583 Bacteria 1118
213 Ga0501069_0259932 3300049585 Bacteria 1013
214 Ga0501070_0025554 3300049586 Bacteria 4954
215 Ga0501070_0393493 3300049586 Bacteria 1122
216 Ga0501072_0694268 3300049588 Bacteria 800
217 Ga0501072_0794436 3300049588 Bacteria 741
218 Ga0501073_0576298 3300049589 Bacteria 777
219 Ga0501245_046008 3300049708 Bacteria 762
220 Ga0501283_131894 3300049779 Bacteria 508
221 Ga0501035_0119450 3300049822 Bacteria 2305
222 Ga0501044_0037808 3300049823 Bacteria 5044
223 Ga0501044_1101905 3300049823 Bacteria 663
224 nmdc:mga00v17_535_c1 3300050491 Bacteria 21350
225 nmdc:mga0yw44_116845_c1 3300050492 Bacteria 1715
226 nmdc:mga0yw44_170258_c1 3300050492 Bacteria 1430
227 nmdc:mga06z11_127984_c1 3300050494 Bacteria 1423
228 nmdc:mga05p37_173741_c1 3300050507 Bacteria 2626
229 Ga0500642_0100459 3300053130 Bacteria 1345
230 Ga0466962_0043313 3300061719 Bacteria 2154
231 Ga0466962_0282814 3300061719 Bacteria 819
232 Ga0466962_0399568 3300061719 Bacteria 688
233 2644230679 2643221641 Bacteria 4490190
234 2676480887 2675903059 Bacteria 8644972
235 Ga0466970_0164959
236 LJQas_1016472
237 Ga0070683_100686095
238 Ga0070659_100396232
239 Ga0070667_100003719
240 Ga0070714_101845366
241 Ga0070713_100668614
242 Ga0068855_101182376
243 Ga0068854_100361406
244 Ga0068856_100083081
245 Ga0068852_100917895
246 Ga0068858_101293302
247 Ga0068860_100820262
248 Ga0075365_10205225
249 Ga0075364_10000264
250 Ga0111539_10513962
251 Ga0114129_10293659
252 Ga0105242_11486207
253 Ga0105238_11940367
254 Ga0157369_10018358
255 Ga0157369_10284844
256 Ga0157372_10396942
257 Ga0157372_10761896
258 Ga0157375_10840007
259 Ga0157380_11042100
260 Ga0213876_10005167
261 Ga0207710_10459520
262 Ga0207647_10186086
263 Ga0207657_10398537
264 Ga0207700_10819903
265 Ga0207664_10025960
266 Ga0207664_10036802
267 Ga0207668_11597531
268 Ga0207702_10900768
269 Ga0207675_100270309
270 Ga0268266_10271952
271 Ga0307408_100142076
272 Ga0307408_100524070
273 Ga0307408_100655536
274 Ga0307408_101051610
275 Ga0307508_10001486
276 Ga0307508_10094675
277 Ga0316579_10000161
278 Ga0307405_10395003
279 Ga0307405_10497773
280 Ga0307413_10119911
281 Ga0307413_10457842
282 Ga0307413_10782313
283 Ga0307413_10809013
284 Ga0307413_10897168
285 Ga0307413_11063486
286 Ga0307518_10068916
287 Ga0307410_10201826
288 Ga0307410_10332679
289 Ga0307410_10393155
290 Ga0307410_10727097
291 Ga0307410_10810435
292 Ga0307410_10830498
293 Ga0307406_10103642
294 Ga0307406_10125135
295 Ga0307406_10199854
296 Ga0307406_10439806
297 Ga0307406_10446501
298 Ga0307406_10557521
299 Ga0307406_11002011
300 Ga0307406_11044682
301 Ga0307406_11168356
302 Ga0307406_11319214
303 Ga0307406_11542414
304 Ga0307407_10238813
305 Ga0307407_10351946
306 Ga0307412_10123704
307 Ga0307412_10356402
308 Ga0307412_10399648
309 Ga0307409_100192089
310 Ga0307409_100247186
311 Ga0307409_100271150
312 Ga0307409_100321933
313 Ga0307409_100348735
314 Ga0307409_101274792
315 Ga0307409_101366732
316 Ga0307409_101986974
317 Ga0307416_100010890
318 Ga0307416_100043125
319 Ga0307416_100076977
320 Ga0307416_100181279
321 Ga0307416_100780538
322 Ga0307416_101083460
323 Ga0307414_10247384
324 Ga0307414_10533621
325 Ga0307414_11054728
326 Ga0307411_10358472
327 Ga0307411_10774842
328 Ga0307415_100105586
329 Ga0307415_100117929
330 Ga0307415_100156309
331 Ga0307415_100169387
332 Ga0307415_100251637
333 Ga0307415_100453334
334 Ga0307415_100743588
335 Ga0307507_10469769
336 Ga0373951_0000129
337 Ga0373943_0207129
338 Ga0373925_0971419
339 Ga0395899_0160449
340 Ga0395900_0054718
341 Ga0395900_0055999
342 Ga0395900_0180476
343 Ga0395898_0351546
344 Ga0395905_0260583
345 Ga0395901_0015530
346 Ga0395901_0029536
347 Ga0400483_086381
348 Ga0436365_1876162
349 Ga0436360_0620632
350 Ga0451787_730292
351 Ga0451791_0652727
352 Ga0451793_0727925
353 Ga0451802_1324947
354 Ga0451833_0609791
355 Ga0451837_0459564
356 Ga0451845_0314653
357 Ga0451853_3871129
358 Ga0466972_0024822
359 Ga0466972_0133935
360 Ga0466972_0248537
361 Ga0466965_0037571
362 Ga0466965_0048726
363 Ga0466965_0142507
364 Ga0466965_0209532
365 Ga0466966_0203429
366 Ga0466961_0098417
367 Ga0466961_0147301
368 Ga0466961_0173424
369 Ga0466961_0216335
370 Ga0466961_0265372
371 Ga0466961_0347038
372 Ga0466963_0153714
373 Ga0466963_0178633
374 Ga0466963_0211414
375 Ga0466963_0477544
376 Ga0466963_0691204
377 Ga0466963_1280182
378 Ga0466964_0173169
379 Ga0466964_0544204
380 Ga0466971_0254340
381 Ga0466971_0398611
382 Ga0466970_0037739
383 Ga0466970_0038106
384 Ga0466970_0110145
385 Ga0466970_0133095
386 Ga0466970_0146584
387 Ga0466970_0213053
388 Ga0466970_0316430
389 Ga0466970_0333211
390 Ga0466970_0500513
391 Ga0466970_0564892
392 Ga0466970_0818886
393 Ga0466957_0366998
394 Ga0466957_0543229
395 Ga0466957_0658665
396 Ga0466957_1011495
397 Ga0466960_0037000
398 Ga0466960_0098132
399 Ga0466960_0153623
400 Ga0466960_0412555
401 Ga0466960_0943025
402 Ga0466959_0176500
403 Ga0466958_0158839
404 Ga0466958_0332294
405 Ga0466958_0760886
406 Ga0466967_0002128
407 Ga0466967_0130499
408 Ga0466967_0255498
409 Ga0466967_0327224
410 Ga0495596_0264317
411 Ga0495620_0095964
412 Ga0495631_0118799
413 Ga0495598_0325293
414 Ga0495621_0197780
415 Ga0495656_0109578
416 Ga0495668_0126551
417 Ga0495661_0138936
418 Ga0495588_0418769
419 Ga0496101_1152681
420 Ga0496102_0234508
421 Ga0496109_0890175
422 Ga0496124_0091790
423 Ga0501031_0020816
424 Ga0501031_0419720
425 Ga0501032_0004868
426 Ga0501033_0004849
427 Ga0501034_0012560
428 Ga0501036_0018349
429 Ga0501036_0025958
430 Ga0501037_0011182
431 Ga0501037_0175135
432 Ga0501038_0013548
433 Ga0501038_0047092
434 Ga0501039_0020447
435 Ga0501039_0304507
436 Ga0501042_0064918
437 Ga0501042_0159781
438 Ga0501042_0669543
439 Ga0501043_0005169
440 Ga0501043_0183995
441 Ga0501046_0002171
442 Ga0501047_0005752
443 Ga0501047_0039734
444 Ga0501048_0007889
445 Ga0501048_0088473
446 Ga0501067_0198219
447 Ga0501069_0259932
448 Ga0501070_0025554
449 Ga0501070_0393493
450 Ga0501072_0694268
451 Ga0501072_0794436
452 Ga0501073_0576298
453 Ga0501245_046008
454 Ga0501283_131894
455 Ga0501035_0119450
456 Ga0501044_0037808
457 Ga0501044_1101905
458 nmdc:mga00v17_535_c1
459 nmdc:mga0yw44_116845_c1
460 nmdc:mga0yw44_170258_c1
461 nmdc:mga06z11_127984_c1
462 nmdc:mga05p37_173741_c1
463 Ga0500642_0100459
464 Ga0466962_0043313
465 Ga0466962_0282814
466 Ga0466962_0399568
467 2644230679
468 2676480887

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

50

162

0.98

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

48

175

0.86

PF13468

Glyoxalase_3

Glyoxalase-like domain

49

177

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.8936 16 151
1jc4-assembly1.cif.gz_B crystal structure of se-met methylmalonyl-coa epimerase 0.8878 13 148
6xbt-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (q60a) in complex with 2-nitronate-propionyl-coa 0.8751 14 147
6xbs-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa 0.8742 14 147
6xbv-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (s115t) in complex with 2-nitronate-propionyl-coa 0.873 14 148
ID Description Score Start End Superfamily
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9061 16 145 3.10.180.10
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.894 15 71 3.10.180.10
af_K7KBB9_206_354_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8873 13 110 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8792 5 147 3.10.180.10
2r5vB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8757 16 147 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A3D2S7F7-F1-model_v4 Methylmalonyl-CoA epimerase 0.9479 91 150 GO:0004493
GO:0046491
GO:0046872
AF-A0A2E6S561-F1-model_v4 Methylmalonyl-CoA epimerase 0.939 16 145 GO:0004493
GO:0046491
GO:0046872
AF-A0A523R3G5-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9365 13 145 GO:0004493
GO:0046491
GO:0046872
AF-A0A3A0AR59-F1-model_v4 Methylmalonyl-CoA epimerase 0.9357 14 145 GO:0004493
GO:0046491
GO:0046872
AF-A0A7V9PNI7-F1-model_v4 VOC family protein 0.9336 14 93 GO:0004493
GO:0046491
GO:0046872

Map