F347369

General Info

Members Datasets Scaffolds Average Seq Length
234 170 468 297

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0013184|Ga0466970_0013184_2355_3326
Length 323
Sequence MSDHRGAPADQAGPPAAGTPEAAEVRRFWARLGLPGLVDVHTHFMPDRVLRKVWAYFDALGPLTGGIEWPITYRAEEEQRAALLRDFGVRAFTAMLYPHKPGMARWLNDWAVDFARRTPGCLHTATLFPEPDVRAYVGEAVAAGARVFKAHVQVGAYDPADALLDDAWGLLAEAGTPVVIHCGSGPAPGKHTGPGPIARVLARHPRLRLIVAHMGMPEYEDFLGLAERYEQVRLDTTMAFTDFAERMAPFPHRALPRLRDLADRVLLGTDFPNIPYPYLHQLEALERLGLGDTWLRAVCHDNGARLFGVRGVGRAQERGERPA

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
14 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
22 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
23 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
33 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
34 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
35 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
36 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
37 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
38 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
39 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
40 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
41 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
42 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
43 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
44 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
45 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
46 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
47 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
48 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
49 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
50 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
51 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
52 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
53 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
54 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
55 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
56 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
57 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
58 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
59 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
60 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
61 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
76 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
79 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
80 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
81 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
82 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
83 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
84 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
85 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
86 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
87 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
88 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
89 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
90 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
93 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
110 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
111 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
115 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
116 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
117 2643221604 Nocardioides sp. Root190 Isolate Unclassified
118 2643221647 Streptomyces sp. Root369 Isolate Unclassified
119 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
120 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
121 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
122 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
123 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
124 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
125 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
126 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
127 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
128 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
129 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
130 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
131 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
132 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
133 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
134 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
135 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
136 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
137 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
138 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
139 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
140 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
141 2867369537 Streptomyces sp. Z26 Isolate Unclassified
142 2867428634 Streptomyces sp. RP5T Isolate Unclassified
143 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
144 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
145 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
146 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
147 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
148 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
149 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
150 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
151 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
152 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
153 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
154 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
155 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
156 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
157 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
158 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
159 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
160 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
161 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
162 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
163 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
164 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
165 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
166 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
167 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
168 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
169 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
170 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.79
Metatranscriptomes 1.28
Isolates 23.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0.85
Rhizoplane 0.85
Rhizosphere 77.35
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0013184 3300044765 Bacteria 4236
2 rootH1_10062969 3300003316 Bacteria 3727
3 JGI25160J50197_1020380 3300003354 Bacteria 2001
4 Ga0006562J51391_1044868 3300003578 Bacteria 4830
5 Ga0006562J51391_1044870 3300003578 Bacteria 1960
6 Ga0070680_100065968 3300005336 Bacteria 2967
7 Ga0070710_10099079 3300005437 Bacteria 1732
8 Ga0070711_100027983 3300005439 Bacteria 3705
9 Ga0070681_10072024 3300005458 Bacteria 3419
10 Ga0070679_100069263 3300005530 Bacteria 3519
11 Ga0081455_10059585 3300005937 Bacteria 3222
12 Ga0070717_10376540 3300006028 Bacteria 1272
13 Ga0075363_100083132 3300006048 Bacteria 1754
14 Ga0070712_100278452 3300006175 Bacteria 1346
15 Ga0075370_10048576 3300006353 Bacteria 2404
16 Ga0075428_100019721 3300006844 Bacteria 7461
17 Ga0075431_100100552 3300006847 Bacteria 2983
18 Ga0075429_100004786 3300006880 Bacteria 11653
19 Ga0105243_10001620 3300009148 Bacteria 19586
20 Ga0182008_10046973 3300014497 Bacteria 2146
21 Ga0182007_10001212 3300015262 Bacteria 14007
22 Ga0183367_1012 3300015688 Bacteria 347438
23 Ga0206353_10944017 3300020082 Bacteria 8344
24 Ga0207705_10057771 3300025909 Bacteria 2799
25 Ga0207707_10062477 3300025912 Bacteria 3241
26 Ga0207693_10325082 3300025915 Bacteria 1204
27 Ga0207693_10372582 3300025915 Bacteria 1117
28 Ga0207663_10014098 3300025916 Bacteria 4367
29 Ga0207660_10006010 3300025917 Bacteria 7883
30 Ga0207652_10008197 3300025921 Bacteria 8391
31 Ga0207652_10169092 3300025921 Bacteria 1961
32 Ga0207700_10215858 3300025928 Bacteria 1624
33 Ga0207700_10315436 3300025928 Bacteria 1354
34 Ga0207709_10000598 3300025935 Bacteria 30054
35 Ga0207702_10366371 3300026078 Bacteria 1382
36 Ga0307515_10151242 3300028794 Bacteria 2425
37 Ga0307511_10001895 3300030521 Bacteria 21961
38 Ga0307512_10014392 3300030522 Bacteria 7368
39 Ga0307512_10036133 3300030522 Bacteria 4196
40 Ga0307509_10035792 3300031507 Bacteria 5444
41 Ga0307509_10192991 3300031507 Bacteria 1885
42 Ga0307408_100069954 3300031548 Bacteria 2590
43 Ga0307408_100289042 3300031548 Bacteria 1368
44 Ga0307508_10214081 3300031616 Bacteria 1527
45 Ga0307516_10041459 3300031730 Bacteria 4575
46 Ga0307413_10285950 3300031824 Bacteria 1243
47 Ga0307518_10045731 3300031838 Bacteria 3182
48 Ga0307518_10098533 3300031838 Bacteria 2095
49 Ga0307410_10147160 3300031852 Bacteria 1749
50 Ga0307406_10148686 3300031901 Bacteria 1668
51 Ga0307409_100072661 3300031995 Bacteria 2740
52 Ga0307409_100194420 3300031995 Bacteria 1809
53 Ga0307414_10173084 3300032004 Bacteria 1728
54 Ga0307415_100172629 3300032126 Bacteria 1688
55 Ga0307415_100357931 3300032126 Bacteria 1231
56 Ga0395900_0017448 3300037418 Bacteria 7328
57 Ga0395900_0048628 3300037418 Bacteria 4369
58 Ga0395898_0006967 3300037466 Bacteria 12017
59 Ga0395898_0009344 3300037466 Bacteria 10304
60 Ga0395898_0015353 3300037466 Bacteria 7853
61 Ga0395898_0033950 3300037466 Bacteria 5089
62 Ga0395905_0031331 3300037471 Bacteria 5006
63 Ga0395901_0005178 3300038443 Bacteria 13158
64 Ga0395901_0008943 3300038443 Bacteria 10142
65 Ga0439436_0024175 3300041404 Bacteria 1794
66 Ga0439439_0006427 3300041406 Bacteria 2718
67 Ga0451853_2786599 3300041512 Bacteria 8223
68 Ga0451853_3787452 3300041512 Bacteria 1829
69 Ga0439442_008912 3300042002 Bacteria 2028
70 Ga0439448_0002124 3300042005 Bacteria 5340
71 Ga0439449_0025767 3300042007 Bacteria 2197
72 Ga0439457_001892 3300042014 Bacteria 6175
73 Ga0439457_003480 3300042014 Bacteria 4280
74 Ga0450894_000364 3300042131 Bacteria 7911
75 Ga0450903_000112 3300042138 Bacteria 17372
76 Ga0450906_010669 3300042145 Bacteria 1732
77 Ga0439458_0027877 3300042157 Bacteria 1334
78 Ga0450908_007427 3300042184 Bacteria 2067
79 Ga0466972_0060464 3300044658 Bacteria 1817
80 Ga0466965_0000312 3300044683 Bacteria 16288
81 Ga0466966_0160565 3300044684 Bacteria 1368
82 Ga0466966_0163346 3300044684 Bacteria 1355
83 Ga0466961_0002591 3300044693 Bacteria 11217
84 Ga0466961_0033517 3300044693 Bacteria 3299
85 Ga0466961_0036809 3300044693 Bacteria 3141
86 Ga0466961_0195755 3300044693 Bacteria 1251
87 Ga0466963_0002059 3300044694 Bacteria 11092
88 Ga0466963_0016151 3300044694 Bacteria 4639
89 Ga0466963_0137795 3300044694 Bacteria 1689
90 Ga0466963_0251426 3300044694 Bacteria 1240
91 Ga0466963_0345016 3300044694 Bacteria 1048
92 Ga0466971_0023622 3300044719 Bacteria 2741
93 Ga0466971_0074819 3300044719 Bacteria 1540
94 Ga0466970_0000443 3300044765 Bacteria 20304
95 Ga0466970_0027237 3300044765 Bacteria 2998
96 Ga0466970_0030040 3300044765 Bacteria 2865
97 Ga0466970_0042002 3300044765 Bacteria 2431
98 Ga0466970_0054529 3300044765 Bacteria 2135
99 Ga0466970_0122101 3300044765 Bacteria 1427
100 Ga0466957_0001357 3300044842 Bacteria 12776
101 Ga0466960_0006324 3300044901 Bacteria 4747
102 Ga0466960_0062906 3300044901 Bacteria 1825
103 Ga0466960_0116400 3300044901 Bacteria 1395
104 Ga0466960_0144140 3300044901 Bacteria 1267
105 Ga0466960_0145996 3300044901 Bacteria 1260
106 Ga0466960_0149115 3300044901 Bacteria 1248
107 Ga0466959_0012381 3300045049 Bacteria 6161
108 Ga0466959_0059822 3300045049 Bacteria 2773
109 Ga0466959_0071248 3300045049 Bacteria 2517
110 Ga0466958_0001117 3300045836 Bacteria 12377
111 Ga0466958_0171242 3300045836 Bacteria 1375
112 Ga0466958_0256793 3300045836 Bacteria 1118
113 Ga0466967_0026624 3300045976 Bacteria 4793
114 Ga0466967_0038593 3300045976 Bacteria 4097
115 Ga0466967_0061138 3300045976 Bacteria 3341
116 Ga0466967_0090073 3300045976 Bacteria 2786
117 Ga0466967_0136160 3300045976 Bacteria 2284
118 Ga0466967_0443422 3300045976 Bacteria 1268
119 Ga0495592_0033139 3300046454 Bacteria 3897
120 Ga0495651_0060595 3300046462 Bacteria 2898
121 Ga0495594_0016895 3300046499 Bacteria 3850
122 Ga0495618_0033867 3300046514 Bacteria 3203
123 Ga0495628_0025808 3300046516 Bacteria 4798
124 Ga0495640_0049111 3300046533 Bacteria 2911
125 Ga0495667_0109371 3300046559 Bacteria 1786
126 Ga0495657_0019955 3300046675 Bacteria 4828
127 Ga0495613_0018722 3300046689 Bacteria 5163
128 Ga0495624_0042016 3300046690 Bacteria 2922
129 Ga0495600_0016792 3300046809 Bacteria 4653
130 Ga0495604_0095076 3300047317 Bacteria 2201
131 Ga0495674_0282788 3300047319 Bacteria 1359
132 Ga0495676_0009401 3300047321 Bacteria 8906
133 Ga0495687_002467 3300047443 Bacteria 14787
134 Ga0495686_0017323 3300047472 Bacteria 4858
135 Ga0495593_0057582 3300047673 Bacteria 2040
136 Ga0495614_0061716 3300048089 Bacteria 1611
137 Ga0496108_0138325 3300048911 Bacteria 2097
138 Ga0496126_0000104 3300048929 Bacteria 200735
139 Ga0501031_0045984 3300049568 Bacteria 2848
140 Ga0501031_0147003 3300049568 Bacteria 1540
141 Ga0501033_0014574 3300049570 Bacteria 5968
142 Ga0501033_0016142 3300049570 Bacteria 5654
143 Ga0501033_0422417 3300049570 Bacteria 928
144 Ga0501034_0183976 3300049571 Bacteria 2053
145 Ga0501036_0014125 3300049572 Bacteria 6640
146 Ga0501036_0181007 3300049572 Bacteria 1774
147 Ga0501036_0272932 3300049572 Bacteria 1416
148 Ga0501036_0282618 3300049572 Bacteria 1389
149 Ga0501037_0026567 3300049573 Bacteria 4279
150 Ga0501037_0104581 3300049573 Bacteria 2041
151 Ga0501038_0009885 3300049574 Bacteria 8733
152 Ga0501038_0176188 3300049574 Bacteria 1728
153 Ga0501038_0238512 3300049574 Bacteria 1444
154 Ga0501039_0067873 3300049575 Bacteria 2769
155 Ga0501043_0039324 3300049579 Bacteria 3717
156 Ga0501046_0010693 3300049580 Bacteria 7871
157 Ga0501046_0160907 3300049580 Bacteria 1688
158 Ga0501047_0000015 3300049581 Bacteria 307932
159 Ga0501047_0109537 3300049581 Bacteria 2644
160 Ga0501047_0300560 3300049581 Bacteria 1447
161 Ga0501048_0002403 3300049582 Bacteria 14285
162 Ga0501069_0105116 3300049585 Bacteria 1604
163 Ga0501072_0475655 3300049588 Bacteria 989
164 Ga0501080_0129907 3300049742 Bacteria 2332
165 Ga0501035_0106183 3300049822 Bacteria 2462
166 Ga0501035_0107095 3300049822 Bacteria 2450
167 Ga0501044_0023753 3300049823 Bacteria 6520
168 Ga0501044_0081510 3300049823 Bacteria 3275
169 Ga0501044_0136163 3300049823 Bacteria 2447
170 Ga0501044_0274957 3300049823 Bacteria 1619
171 Ga0501045_0141047 3300049824 Bacteria 1792
172 nmdc:mga03n38_53773_c1 3300050490 Bacteria 1807
173 nmdc:mga07m45_47849_c1 3300050496 Bacteria 2404
174 nmdc:mga05p37_102674_c1 3300050507 Bacteria 3521
175 nmdc:mga0qj67_24771_c1 3300050509 Bacteria 4630
176 Ga0466962_0000163 3300061719 Bacteria 28323
177 Ga0466962_0026887 3300061719 Bacteria 2762
178 Ga0466962_0049331 3300061719 Bacteria 2012
179 2547405993 2547132111 Bacteria 8013147
180 2585309758 2582581313 Bacteria 10042643
181 2644035136 2643221604 Bacteria 5014917
182 2644270614 2643221647 Bacteria 10741251
183 2644443341 2643221678 Bacteria 9540101
184 2644639238 2643221715 Bacteria 6671032
185 2739239636 2738543011 Bacteria 5731169
186 2774396746 2773857762 Bacteria 5971770
187 2785342540 2784746763 Bacteria 9783172
188 2785366253 2784746768 Bacteria 10036182
189 2786674549 2786546132 Bacteria 10419719
190 2793982983 2791355406 Bacteria 11364898
191 2808848710 2808606359 Bacteria 9866990
192 2808920897 2808606375 Bacteria 9466072
193 2809198391 2808606439 Bacteria 5952208
194 2811845832 2808606982 Bacteria 7791042
195 2812349597 2811994878 Bacteria 5992952
196 2812358192 2811994879 Bacteria 9313447
197 2812480218 2811994917 Bacteria 7761064
198 2819747272 2818991472 Bacteria 10089953
199 2852636759 2852635781 Bacteria 8251373
200 2862179029 2862178590 Bacteria 8583590
201 2862281736 2862281513 Bacteria 9621493
202 2862389983 2862382967 Bacteria 10317375
203 2862508031 2862507626 Bacteria 9425308
204 2866614908 2866612099 Bacteria 7543886
205 2867372055 2867369537 Bacteria 6501581
206 2867433234 2867428634 Bacteria 9590268
207 2877684262 2877676314 Bacteria 9512378
208 2884703369 2884693830 Bacteria 11273186
209 2889304687 2889300758 Bacteria 5690814
210 2891969444 2891968417 Bacteria 5821697
211 2895443606 2895442618 Bacteria 11027144
212 2919474041 2919468124 Bacteria 9133025
213 2939744927 2939743619 Bacteria 5762299
214 2946067655 2946064051 Bacteria 8957905
215 2954382203 2954380949 Bacteria 10050426
216 2954680854 2954673503 Bacteria 9685905
217 2954683301 2954682443 Bacteria 9862841
218 2954693020 2954691527 Bacteria 10720516
219 2954708093 2954701450 Bacteria 10834262
220 2954712605 2954711539 Bacteria 10867210
221 2954722561 2954721474 Bacteria 10456478
222 2954739297 2954731030 Bacteria 10243860
223 2954741440 2954740390 Bacteria 10229294
224 2954758126 2954749733 Bacteria 10366972
225 2954760456 2954759201 Bacteria 9358192
226 2990089635 2990088156 Bacteria 6657676
227 2995470563 2995463766 Bacteria 8577691
228 8008560043 8008558824 Bacteria 10610750
229 8033688428 8033684223 Bacteria 6906479
230 8047897699 8047893842 Bacteria 11723082
231 8048129745 8048127548 Bacteria 11053136
232 8048361172 8048356638 Bacteria 11044339
233 8048374685 8048369669 Bacteria 11666822
234 8048383537 8048379754 Bacteria 11877923
235 Ga0466970_0013184
236 rootH1_10062969
237 JGI25160J50197_1020380
238 Ga0006562J51391_1044868
239 Ga0006562J51391_1044870
240 Ga0070680_100065968
241 Ga0070710_10099079
242 Ga0070711_100027983
243 Ga0070681_10072024
244 Ga0070679_100069263
245 Ga0081455_10059585
246 Ga0070717_10376540
247 Ga0075363_100083132
248 Ga0070712_100278452
249 Ga0075370_10048576
250 Ga0075428_100019721
251 Ga0075431_100100552
252 Ga0075429_100004786
253 Ga0105243_10001620
254 Ga0182008_10046973
255 Ga0182007_10001212
256 Ga0183367_1012
257 Ga0206353_10944017
258 Ga0207705_10057771
259 Ga0207707_10062477
260 Ga0207693_10325082
261 Ga0207693_10372582
262 Ga0207663_10014098
263 Ga0207660_10006010
264 Ga0207652_10008197
265 Ga0207652_10169092
266 Ga0207700_10215858
267 Ga0207700_10315436
268 Ga0207709_10000598
269 Ga0207702_10366371
270 Ga0307515_10151242
271 Ga0307511_10001895
272 Ga0307512_10014392
273 Ga0307512_10036133
274 Ga0307509_10035792
275 Ga0307509_10192991
276 Ga0307408_100069954
277 Ga0307408_100289042
278 Ga0307508_10214081
279 Ga0307516_10041459
280 Ga0307413_10285950
281 Ga0307518_10045731
282 Ga0307518_10098533
283 Ga0307410_10147160
284 Ga0307406_10148686
285 Ga0307409_100072661
286 Ga0307409_100194420
287 Ga0307414_10173084
288 Ga0307415_100172629
289 Ga0307415_100357931
290 Ga0395900_0017448
291 Ga0395900_0048628
292 Ga0395898_0006967
293 Ga0395898_0009344
294 Ga0395898_0015353
295 Ga0395898_0033950
296 Ga0395905_0031331
297 Ga0395901_0005178
298 Ga0395901_0008943
299 Ga0439436_0024175
300 Ga0439439_0006427
301 Ga0451853_2786599
302 Ga0451853_3787452
303 Ga0439442_008912
304 Ga0439448_0002124
305 Ga0439449_0025767
306 Ga0439457_001892
307 Ga0439457_003480
308 Ga0450894_000364
309 Ga0450903_000112
310 Ga0450906_010669
311 Ga0439458_0027877
312 Ga0450908_007427
313 Ga0466972_0060464
314 Ga0466965_0000312
315 Ga0466966_0160565
316 Ga0466966_0163346
317 Ga0466961_0002591
318 Ga0466961_0033517
319 Ga0466961_0036809
320 Ga0466961_0195755
321 Ga0466963_0002059
322 Ga0466963_0016151
323 Ga0466963_0137795
324 Ga0466963_0251426
325 Ga0466963_0345016
326 Ga0466971_0023622
327 Ga0466971_0074819
328 Ga0466970_0000443
329 Ga0466970_0027237
330 Ga0466970_0030040
331 Ga0466970_0042002
332 Ga0466970_0054529
333 Ga0466970_0122101
334 Ga0466957_0001357
335 Ga0466960_0006324
336 Ga0466960_0062906
337 Ga0466960_0116400
338 Ga0466960_0144140
339 Ga0466960_0145996
340 Ga0466960_0149115
341 Ga0466959_0012381
342 Ga0466959_0059822
343 Ga0466959_0071248
344 Ga0466958_0001117
345 Ga0466958_0171242
346 Ga0466958_0256793
347 Ga0466967_0026624
348 Ga0466967_0038593
349 Ga0466967_0061138
350 Ga0466967_0090073
351 Ga0466967_0136160
352 Ga0466967_0443422
353 Ga0495592_0033139
354 Ga0495651_0060595
355 Ga0495594_0016895
356 Ga0495618_0033867
357 Ga0495628_0025808
358 Ga0495640_0049111
359 Ga0495667_0109371
360 Ga0495657_0019955
361 Ga0495613_0018722
362 Ga0495624_0042016
363 Ga0495600_0016792
364 Ga0495604_0095076
365 Ga0495674_0282788
366 Ga0495676_0009401
367 Ga0495687_002467
368 Ga0495686_0017323
369 Ga0495593_0057582
370 Ga0495614_0061716
371 Ga0496108_0138325
372 Ga0496126_0000104
373 Ga0501031_0045984
374 Ga0501031_0147003
375 Ga0501033_0014574
376 Ga0501033_0016142
377 Ga0501033_0422417
378 Ga0501034_0183976
379 Ga0501036_0014125
380 Ga0501036_0181007
381 Ga0501036_0272932
382 Ga0501036_0282618
383 Ga0501037_0026567
384 Ga0501037_0104581
385 Ga0501038_0009885
386 Ga0501038_0176188
387 Ga0501038_0238512
388 Ga0501039_0067873
389 Ga0501043_0039324
390 Ga0501046_0010693
391 Ga0501046_0160907
392 Ga0501047_0000015
393 Ga0501047_0109537
394 Ga0501047_0300560
395 Ga0501048_0002403
396 Ga0501069_0105116
397 Ga0501072_0475655
398 Ga0501080_0129907
399 Ga0501035_0106183
400 Ga0501035_0107095
401 Ga0501044_0023753
402 Ga0501044_0081510
403 Ga0501044_0136163
404 Ga0501044_0274957
405 Ga0501045_0141047
406 nmdc:mga03n38_53773_c1
407 nmdc:mga07m45_47849_c1
408 nmdc:mga05p37_102674_c1
409 nmdc:mga0qj67_24771_c1
410 Ga0466962_0000163
411 Ga0466962_0026887
412 Ga0466962_0049331
413 2547405993
414 2585309758
415 2644035136
416 2644270614
417 2644443341
418 2644639238
419 2739239636
420 2774396746
421 2785342540
422 2785366253
423 2786674549
424 2793982983
425 2808848710
426 2808920897
427 2809198391
428 2811845832
429 2812349597
430 2812358192
431 2812480218
432 2819747272
433 2852636759
434 2862179029
435 2862281736
436 2862389983
437 2862508031
438 2866614908
439 2867372055
440 2867433234
441 2877684262
442 2884703369
443 2889304687
444 2891969444
445 2895443606
446 2919474041
447 2939744927
448 2946067655
449 2954382203
450 2954680854
451 2954683301
452 2954693020
453 2954708093
454 2954712605
455 2954722561
456 2954739297
457 2954741440
458 2954758126
459 2954760456
460 2990089635
461 2995470563
462 8008560043
463 8033688428
464 8047897699
465 8048129745
466 8048361172
467 8048374685
468 8048383537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

38

309

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.7585 6 278
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.7417 6 278
2f6k-assembly1.cif.gz_A crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24 0.6951 6 279
4i6k-assembly1.cif.gz_A crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound 0.6948 6 279
4i6k-assembly1.cif.gz_A crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound 0.6901 6 279
ID Description Score Start End Superfamily
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.807 8 279 3.20.20.140
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.796 8 279 3.20.20.140
af_A0A0R0KUU2_4_202_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7922 80 265 3.20.20.140
3k4wC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7751 6 278 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7733 42 279 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A2W2KVY9-F1-model_v4 Amidohydrolase 1.001 1 279 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-Q82FQ3-F1-model_v4 Amidohydrolase-related domain-containing protein 1 1 279 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-M3DDT7-F1-model_v4 Amidohydrolase-related domain-containing protein 1 2 279 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A6A0BSI4-F1-model_v4 deleted 1 2 279
AF-V6UGW5-F1-model_v4 deleted 1 1 279

Map