F347340

General Info

Members Datasets Scaffolds Average Seq Length
234 149 234 126

Family's Representative Sequence

Representative Sequence 3300042007|Ga0439449_0410373|Ga0439449_0410373_26_487
Length 153
Sequence MFDFTGRDVLNAAKVTTFTSNKDEYMQEGKRQKQVGGLIQEEMNSIFQHLGLNMLNGGMVSISAVKITPDLLEARIYLSIFQTEAKAVLKKVEERKWEIKKELAARVKQQLRRIPELKFFLDDTLDQVFKMEELFKEIKKGEQGTNDKQAEEK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
112 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
113 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
114 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
115 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
116 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
117 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
118 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
119 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
120 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
121 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
122 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
123 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
124 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
136 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
137 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
138 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
139 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
140 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
141 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
142 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
143 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
144 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
145 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 0.43
Rhizosphere 97.86
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5751345 2162886012 Unclassified 2943
2 ARcpr5oldR_c014181 3300000041 Unclassified 687
3 JGI24033J26618_1022999 3300002155 Bacteria 808
4 Ga0065704_10181046 3300005289 Bacteria 1237
5 Ga0065704_10362966 3300005289 Unclassified 790
6 Ga0065712_10068022 3300005290 Bacteria 16959
7 Ga0065712_10344635 3300005290 Unclassified 794
8 Ga0065715_10110805 3300005293 Unclassified 2602
9 Ga0065715_10384650 3300005293 Bacteria 902
10 Ga0065707_10231554 3300005295 Bacteria 1173
11 Ga0070676_10039337 3300005328 Unclassified 2735
12 Ga0070683_100598463 3300005329 Unclassified 1055
13 Ga0070670_100762223 3300005331 Unclassified 872
14 Ga0070670_100855484 3300005331 Bacteria 823
15 Ga0070677_10082738 3300005333 Bacteria 1377
16 Ga0070677_10556107 3300005333 Unclassified 629
17 Ga0070682_100152439 3300005337 Unclassified 1587
18 Ga0070682_101057322 3300005337 Bacteria 677
19 Ga0070660_100273043 3300005339 Bacteria 1382
20 Ga0070689_100030562 3300005340 Bacteria 4089
21 Ga0070689_101049498 3300005340 Unclassified 727
22 Ga0070687_100049840 3300005343 Unclassified 2160
23 Ga0070668_100459037 3300005347 Unclassified 1096
24 Ga0070669_100002549 3300005353 Bacteria 13166
25 Ga0070669_100060209 3300005353 Bacteria 2789
26 Ga0070675_100002038 3300005354 Bacteria 14998
27 Ga0070675_100062427 3300005354 Bacteria 3078
28 Ga0070674_100287684 3300005356 Bacteria 1305
29 Ga0070674_101837305 3300005356 Bacteria 550
30 Ga0070673_100140609 3300005364 Unclassified 2036
31 Ga0070673_100231691 3300005364 Bacteria 1602
32 Ga0070673_100666604 3300005364 Unclassified 953
33 Ga0070688_101022731 3300005365 Bacteria 657
34 Ga0070688_101232007 3300005365 Bacteria 602
35 Ga0070688_101311137 3300005365 Unclassified 585
36 Ga0070659_100162778 3300005366 Bacteria 1825
37 Ga0070709_11576579 3300005434 Unclassified 534
38 Ga0070701_10072216 3300005438 Unclassified 1848
39 Ga0070701_10661751 3300005438 Bacteria 698
40 Ga0070700_100505723 3300005441 Unclassified 930
41 Ga0070662_100028845 3300005457 Bacteria 3867
42 Ga0070662_100657805 3300005457 Bacteria 884
43 Ga0068867_100360276 3300005459 Unclassified 1216
44 Ga0070707_101114606 3300005468 Bacteria 755
45 Ga0070698_100009055 3300005471 Bacteria 10701
46 Ga0070698_100523950 3300005471 Bacteria 1124
47 Ga0068853_100019528 3300005539 Bacteria 5620
48 Ga0068853_101745986 3300005539 Bacteria 603
49 Ga0070672_100098966 3300005543 Unclassified 2363
50 Ga0070672_100375000 3300005543 Bacteria 1216
51 Ga0070672_100377833 3300005543 Bacteria 1211
52 Ga0070665_100000002 3300005548 Bacteria 849037
53 Ga0070704_100561897 3300005549 Bacteria 998
54 Ga0070664_100557413 3300005564 Bacteria 1060
55 Ga0068857_100139917 3300005577 Bacteria 2187
56 Ga0068857_100430114 3300005577 Unclassified 1232
57 Ga0068857_100695507 3300005577 Unclassified 966
58 Ga0068857_100816960 3300005577 Bacteria 891
59 Ga0068857_101245698 3300005577 Bacteria 721
60 Ga0070702_100488478 3300005615 Bacteria 902
61 Ga0068852_101272835 3300005616 Bacteria 757
62 Ga0068852_101757433 3300005616 Bacteria 643
63 Ga0068859_100001494 3300005617 Bacteria 23823
64 Ga0068859_100104653 3300005617 Bacteria 2889
65 Ga0068859_100181586 3300005617 Bacteria 2187
66 Ga0068859_101001918 3300005617 Bacteria 917
67 Ga0068859_101081468 3300005617 Bacteria 882
68 Ga0068861_100014280 3300005719 Bacteria 5572
69 Ga0068861_100266292 3300005719 Unclassified 1469
70 Ga0068870_10014932 3300005840 Bacteria 3676
71 Ga0068863_100261817 3300005841 Unclassified 1672
72 Ga0068858_101082886 3300005842 Unclassified 787
73 Ga0068860_102152517 3300005843 Bacteria 579
74 Ga0068862_100001278 3300005844 Bacteria 23579
75 Ga0068862_100750347 3300005844 Bacteria 949
76 Ga0097621_101563936 3300006237 Unclassified 626
77 Ga0097621_101713162 3300006237 Bacteria 598
78 Ga0068871_100090582 3300006358 Bacteria 2547
79 Ga0068871_100328341 3300006358 Unclassified 1349
80 Ga0075436_100595381 3300006914 Bacteria 814
81 Ga0097620_100001494 3300006931 Bacteria 23823
82 Ga0097620_100104650 3300006931 Bacteria 2889
83 Ga0097620_100181588 3300006931 Bacteria 2187
84 Ga0097620_101001893 3300006931 Bacteria 917
85 Ga0097620_101081732 3300006931 Bacteria 882
86 Ga0075435_102020052 3300007076 Bacteria 506
87 Ga0105240_10000047 3300009093 Bacteria 239067
88 Ga0111539_10032137 3300009094 Bacteria 6376
89 Ga0111539_11445454 3300009094 Unclassified 797
90 Ga0111539_12145557 3300009094 Bacteria 648
91 Ga0105242_10959840 3300009176 Bacteria 860
92 Ga0105242_11494069 3300009176 Unclassified 706
93 Ga0105249_10012242 3300009553 Bacteria 7556
94 Ga0105249_10131735 3300009553 Unclassified 2388
95 Ga0105239_10004762 3300010375 Bacteria 16108
96 Ga0157373_10064536 3300013100 Bacteria 2592
97 Ga0157371_10011098 3300013102 Bacteria 6975
98 Ga0157371_10019609 3300013102 Bacteria 4982
99 Ga0157371_11024405 3300013102 Bacteria 630
100 Ga0157370_10260092 3300013104 Bacteria 1604
101 Ga0157370_10382987 3300013104 Bacteria 1295
102 Ga0157369_11426890 3300013105 Bacteria 705
103 Ga0157378_10011012 3300013297 Bacteria 7916
104 Ga0157378_10792303 3300013297 Bacteria 973
105 Ga0163162_10132016 3300013306 Bacteria 2606
106 Ga0157372_10001914 3300013307 Bacteria 22584
107 Ga0157372_10027811 3300013307 Bacteria 6163
108 Ga0157372_10108365 3300013307 Bacteria 3179
109 Ga0157372_10146686 3300013307 Bacteria 2721
110 Ga0157372_10302240 3300013307 Unclassified 1861
111 Ga0157372_10629329 3300013307 Bacteria 1250
112 Ga0157372_11216145 3300013307 Unclassified 870
113 Ga0157375_10262865 3300013308 Unclassified 1887
114 Ga0157375_10357370 3300013308 Unclassified 1627
115 Ga0163163_10237630 3300014325 Unclassified 1871
116 Ga0157380_10000602 3300014326 Bacteria 22163
117 Ga0157380_10052957 3300014326 Unclassified 3216
118 Ga0157380_10110565 3300014326 Unclassified 2308
119 Ga0157380_10114587 3300014326 Bacteria 2272
120 Ga0157380_10138295 3300014326 Unclassified 2088
121 Ga0157377_10039067 3300014745 Unclassified 2624
122 Ga0157379_10723124 3300014968 Unclassified 936
123 Ga0163161_10338159 3300017792 Unclassified 1194
124 Ga0207682_10022910 3300025893 Bacteria 2464
125 Ga0207645_10278163 3300025907 Unclassified 1111
126 Ga0207643_10019697 3300025908 Bacteria 3698
127 Ga0207695_10000010 3300025913 Bacteria 981919
128 Ga0207695_10000550 3300025913 Bacteria 77346
129 Ga0207671_10001002 3300025914 Bacteria 34718
130 Ga0207662_10015543 3300025918 Unclassified 4284
131 Ga0207657_10559426 3300025919 Bacteria 894
132 Ga0207646_10787224 3300025922 Bacteria 847
133 Ga0207681_10024132 3300025923 Bacteria 3900
134 Ga0207681_10192715 3300025923 Unclassified 1560
135 Ga0207650_10615359 3300025925 Bacteria 914
136 Ga0207650_11918135 3300025925 Unclassified 500
137 Ga0207659_10135411 3300025926 Unclassified 1906
138 Ga0207659_10154447 3300025926 Bacteria 1795
139 Ga0207659_10844498 3300025926 Unclassified 787
140 Ga0207690_10277209 3300025932 Bacteria 1305
141 Ga0207706_10014259 3300025933 Bacteria 7202
142 Ga0207706_10824482 3300025933 Bacteria 787
143 Ga0207670_10183709 3300025936 Unclassified 1577
144 Ga0207670_10653323 3300025936 Unclassified 867
145 Ga0207691_10067733 3300025940 Bacteria 3227
146 Ga0207691_10155298 3300025940 Bacteria 2010
147 Ga0207661_10554071 3300025944 Unclassified 1053
148 Ga0207679_10372516 3300025945 Bacteria 1250
149 Ga0207651_10075835 3300025960 Bacteria 2401
150 Ga0207712_10016127 3300025961 Bacteria 4831
151 Ga0207712_11355881 3300025961 Bacteria 636
152 Ga0207639_10045843 3300026041 Bacteria 3295
153 Ga0207639_10074386 3300026041 Bacteria 2668
154 Ga0207639_11354812 3300026041 Bacteria 668
155 Ga0207708_10042730 3300026075 Bacteria 3454
156 Ga0207708_10140460 3300026075 Bacteria 1894
157 Ga0207641_10320204 3300026088 Unclassified 1470
158 Ga0207648_10085341 3300026089 Unclassified 2754
159 Ga0207648_10530738 3300026089 Bacteria 1079
160 Ga0207674_10003180 3300026116 Bacteria 20225
161 Ga0207674_10348942 3300026116 Bacteria 1431
162 Ga0207674_11220592 3300026116 Bacteria 721
163 Ga0207675_100000299 3300026118 Bacteria 47665
164 Ga0207675_100003546 3300026118 Bacteria 15219
165 Ga0207675_100509623 3300026118 Bacteria 1199
166 Ga0207675_101461504 3300026118 Bacteria 704
167 Ga0207698_10178301 3300026142 Bacteria 1879
168 Ga0207698_10709165 3300026142 Bacteria 1002
169 Ga0207698_10873540 3300026142 Bacteria 905
170 Ga0268266_10000022 3300028379 Bacteria 508060
171 Ga0268265_10166044 3300028380 Unclassified 1881
172 Ga0268264_10000082 3300028381 Bacteria 246913
173 Ga0268264_12253101 3300028381 Unclassified 552
174 Ga0307515_10000001 3300028794 Bacteria 4259510
175 Ga0265338_10075819 3300028800 Bacteria 2852
176 Ga0265324_10008317 3300029957 Bacteria 4132
177 Ga0307405_11681590 3300031731 Bacteria 562
178 Ga0307413_10555684 3300031824 Bacteria 932
179 Ga0307410_10137000 3300031852 Bacteria 1806
180 Ga0307407_10528013 3300031903 Bacteria 869
181 Ga0307414_11092838 3300032004 Unclassified 736
182 Ga0373935_0903293 3300035692 Bacteria 654
183 Ga0395899_0984649 3300037312 Unclassified 509
184 Ga0395900_0065050 3300037418 Bacteria 3746
185 Ga0395898_0128579 3300037466 Bacteria 2427
186 Ga0395905_0000227 3300037471 Bacteria 85540
187 Ga0395905_0142087 3300037471 Bacteria 2258
188 Ga0395901_0062146 3300038443 Bacteria 3887
189 Ga0439439_0032323 3300041406 Bacteria 1336
190 Ga0439439_0137959 3300041406 Unclassified 687
191 Ga0439447_140321 3300041407 Bacteria 555
192 Ga0439466_0055137 3300041411 Bacteria 1293
193 Ga0451807_1270939 3300041486 Bacteria 863
194 Ga0451837_0648090 3300041494 Unclassified 550
195 Ga0439431_0046462 3300041997 Bacteria 1117
196 Ga0439442_007943 3300042002 Bacteria 2143
197 Ga0439445_0064725 3300042004 Bacteria 1004
198 Ga0439445_0249427 3300042004 Unclassified 530
199 Ga0439449_0000796 3300042007 Bacteria 12172
200 Ga0439449_0037126 3300042007 Unclassified 1812
201 Ga0439449_0410373 3300042007 Bacteria 514
202 Ga0439454_029264 3300042011 Bacteria 855
203 Ga0439462_0004749 3300042015 Bacteria 3329
204 Ga0439462_0173008 3300042015 Bacteria 611
205 Ga0450897_000287 3300042128 Bacteria 2639
206 Ga0450894_012443 3300042131 Bacteria 1113
207 Ga0439434_0066717 3300042435 Bacteria 1129
208 Ga0451577_0873842 3300042876 Bacteria 810
209 Ga0466959_0377556 3300045049 Bacteria 965
210 Ga0495643_0011140 3300046522 Bacteria 5494
211 Ga0495598_0130124 3300046537 Bacteria 862
212 Ga0495633_0172197 3300046558 Bacteria 998
213 Ga0495668_0014997 3300046616 Bacteria 4534
214 Ga0495670_0220748 3300046691 Bacteria 1007
215 Ga0495600_0329542 3300046809 Bacteria 959
216 Ga0495636_0000002 3300047318 Bacteria 145900
217 Ga0495686_0065244 3300047472 Bacteria 2251
218 Ga0501209_086451 3300049656 Unclassified 908
219 Ga0501235_011106 3300049669 Unclassified 1973
220 Ga0501240_002493 3300049673 Unclassified 1960
221 Ga0501251_018428 3300049681 Unclassified 906
222 Ga0501255_009680 3300049684 Unclassified 1074
223 Ga0501257_007608 3300049686 Unclassified 2420
224 Ga0501259_008144 3300049688 Unclassified 1685
225 Ga0501225_0035877 3300049705 Bacteria 1366
226 Ga0501245_007988 3300049708 Unclassified 1502
227 Ga0501263_044575 3300049760 Bacteria 660
228 Ga0501266_001249 3300049763 Unclassified 3243
229 Ga0501266_017495 3300049763 Bacteria 959
230 nmdc:mga0k408_140605_c2 3300050493 Bacteria 1041
231 nmdc:mga07m45_769700_c1 3300050496 Bacteria 552
232 nmdc:mga09592_1019649_c1 3300050508 Bacteria 691
233 nmdc:mga08y16_459918_c1 3300050511 Unclassified 1297
234 nmdc:mga08y16_95122_c1 3300050511 Bacteria 3103

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100000002 Ga0070665_100000002429 110
2 3300028379 Ga0268266_10000022 Ga0268266_100000229 110
3 3300028381 Ga0268264_10000082 Ga0268264_10000082204 110
4 3300049673 Ga0501240_002493 Ga0501240_002493_568_912 110
5 3300005365 Ga0070688_101232007 Ga0070688_1012320072 112
6 3300025913 Ga0207695_10000550 Ga0207695_1000055046 113
7 3300025914 Ga0207671_10001002 Ga0207671_1000100216 113
8 3300026041 Ga0207639_10074386 Ga0207639_100743863 113
9 3300031852 Ga0307410_10137000 Ga0307410_101370002 113
10 3300005337 Ga0070682_101057322 Ga0070682_1010573222 116
11 3300005539 Ga0068853_100019528 Ga0068853_1000195282 116
12 3300013297 Ga0157378_10792303 Ga0157378_107923032 116
13 3300026041 Ga0207639_10045843 Ga0207639_100458432 116
14 3300026142 Ga0207698_10873540 Ga0207698_108735402 116
15 3300028381 Ga0268264_12253101 Ga0268264_122531011 116
16 3300041494 Ga0451837_0648090 Ga0451837_0648090_14_382 116
17 3300047472 Ga0495686_0065244 Ga0495686_0065244_1523_1894 116
18 3300050493 nmdc:mga0k408_140605_c2 nmdc:mga0k408_140605_c2_454_825 116
19 3300050496 nmdc:mga07m45_769700_c1 nmdc:mga07m45_769700_c1_14_385 116
20 3300026089 Ga0207648_10530738 Ga0207648_105307381 117
21 3300028794 Ga0307515_10000001 Ga0307515_100000012073 117
22 3300005340 Ga0070689_101049498 Ga0070689_1010494981 118
23 3300005343 Ga0070687_100049840 Ga0070687_1000498402 118
24 3300005356 Ga0070674_101837305 Ga0070674_1018373051 118
25 3300005364 Ga0070673_100666604 Ga0070673_1006666042 118
26 3300005577 Ga0068857_101245698 Ga0068857_1012456982 118
27 3300005617 Ga0068859_100001494 Ga0068859_10000149410 118
28 3300005719 Ga0068861_100014280 Ga0068861_1000142804 118
29 3300005841 Ga0068863_100261817 Ga0068863_1002618172 118
30 3300006237 Ga0097621_101713162 Ga0097621_1017131621 118
31 3300006358 Ga0068871_100328341 Ga0068871_1003283412 118
32 3300006931 Ga0097620_100001494 Ga0097620_10000149413 118
33 3300009176 Ga0105242_11494069 Ga0105242_114940691 118
34 3300013297 Ga0157378_10011012 Ga0157378_100110126 118
35 3300013308 Ga0157375_10262865 Ga0157375_102628652 118
36 3300014326 Ga0157380_10138295 Ga0157380_101382952 118
37 3300025918 Ga0207662_10015543 Ga0207662_100155432 118
38 3300025936 Ga0207670_10653323 Ga0207670_106533232 118
39 3300026088 Ga0207641_10320204 Ga0207641_103202042 118
40 3300026116 Ga0207674_11220592 Ga0207674_112205922 118
41 3300026118 Ga0207675_100003546 Ga0207675_10000354611 118
42 3300005289 Ga0065704_10181046 Ga0065704_101810462 119
43 3300005434 Ga0070709_11576579 Ga0070709_115765791 119
44 3300005617 Ga0068859_101001918 Ga0068859_1010019181 119
45 3300006914 Ga0075436_100595381 Ga0075436_1005953812 119
46 3300006931 Ga0097620_101001893 Ga0097620_1010018932 119
47 3300042011 Ga0439454_029264 Ga0439454_029264_301_669 119
48 3300042876 Ga0451577_0873842 Ga0451577_0873842_408_776 119
49 3300046522 Ga0495643_0011140 Ga0495643_0011140_1126_1494 119
50 3300005438 Ga0070701_10661751 Ga0070701_106617511 120
51 3300005471 Ga0070698_100009055 Ga0070698_1000090558 120
52 3300005617 Ga0068859_100181586 Ga0068859_1001815862 120
53 3300006931 Ga0097620_100181588 Ga0097620_1001815882 120
54 3300007076 Ga0075435_102020052 Ga0075435_1020200521 120
55 3300013307 Ga0157372_11216145 Ga0157372_112161452 120
56 3300014968 Ga0157379_10723124 Ga0157379_107231242 120
57 3300026075 Ga0207708_10140460 Ga0207708_101404602 120
58 3300005290 Ga0065712_10068022 Ga0065712_100680225 121
59 3300005331 Ga0070670_100855484 Ga0070670_1008554841 121
60 3300005333 Ga0070677_10082738 Ga0070677_100827382 121
61 3300005353 Ga0070669_100060209 Ga0070669_1000602092 121
62 3300005354 Ga0070675_100062427 Ga0070675_1000624273 121
63 3300005356 Ga0070674_100287684 Ga0070674_1002876842 121
64 3300005365 Ga0070688_101022731 Ga0070688_1010227311 121
65 3300005365 Ga0070688_101311137 Ga0070688_1013111371 121
66 3300005457 Ga0070662_100657805 Ga0070662_1006578052 121
67 3300005543 Ga0070672_100375000 Ga0070672_1003750002 121
68 3300005564 Ga0070664_100557413 Ga0070664_1005574131 121
69 3300005577 Ga0068857_100816960 Ga0068857_1008169602 121
70 3300005616 Ga0068852_101272835 Ga0068852_1012728352 121
71 3300005617 Ga0068859_101081468 Ga0068859_1010814682 121
72 3300006931 Ga0097620_101081732 Ga0097620_1010817322 121
73 3300009093 Ga0105240_10000047 Ga0105240_1000004789 121
74 3300010375 Ga0105239_10004762 Ga0105239_100047626 121
75 3300014326 Ga0157380_10000602 Ga0157380_1000060216 121
76 3300025893 Ga0207682_10022910 Ga0207682_100229102 121
77 3300025913 Ga0207695_10000010 Ga0207695_10000010150 121
78 3300025923 Ga0207681_10024132 Ga0207681_100241323 121
79 3300025925 Ga0207650_10615359 Ga0207650_106153592 121
80 3300025926 Ga0207659_10154447 Ga0207659_101544471 121
81 3300025933 Ga0207706_10824482 Ga0207706_108244822 121
82 3300025940 Ga0207691_10155298 Ga0207691_101552982 121
83 3300025945 Ga0207679_10372516 Ga0207679_103725162 121
84 3300026116 Ga0207674_10348942 Ga0207674_103489422 121
85 3300026118 Ga0207675_101461504 Ga0207675_1014615042 121
86 3300026142 Ga0207698_10178301 Ga0207698_101783012 121
87 3300031731 Ga0307405_11681590 Ga0307405_116815902 121
88 3300032004 Ga0307414_11092838 Ga0307414_110928381 121
89 3300041406 Ga0439439_0032323 Ga0439439_0032323_120_512 121
90 3300041486 Ga0451807_1270939 Ga0451807_1270939_344_718 121
91 3300042004 Ga0439445_0249427 Ga0439445_0249427_83_475 121
92 3300042007 Ga0439449_0000796 Ga0439449_0000796_6552_6944 121
93 3300042007 Ga0439449_0410373 Ga0439449_0410373_26_487 121
94 3300042015 Ga0439462_0173008 Ga0439462_0173008_125_517 121
95 2162886012 MBSR1b_contig_5751345 MBSR1b_0512.00004440 122
96 3300000041 ARcpr5oldR_c014181 ARcpr5oldR_0141812 122
97 3300002155 JGI24033J26618_1022999 JGI24033J26618_10229992 122
98 3300005289 Ga0065704_10362966 Ga0065704_103629662 122
99 3300005290 Ga0065712_10344635 Ga0065712_103446352 122
100 3300005293 Ga0065715_10110805 Ga0065715_101108052 122
101 3300005293 Ga0065715_10384650 Ga0065715_103846502 122
102 3300005295 Ga0065707_10231554 Ga0065707_102315542 122
103 3300005328 Ga0070676_10039337 Ga0070676_100393373 122
104 3300005329 Ga0070683_100598463 Ga0070683_1005984632 122
105 3300005331 Ga0070670_100762223 Ga0070670_1007622232 122
106 3300005333 Ga0070677_10556107 Ga0070677_105561071 122
107 3300005337 Ga0070682_100152439 Ga0070682_1001524392 122
108 3300005339 Ga0070660_100273043 Ga0070660_1002730432 122
109 3300005340 Ga0070689_100030562 Ga0070689_1000305622 122
110 3300005347 Ga0070668_100459037 Ga0070668_1004590373 122
111 3300005353 Ga0070669_100002549 Ga0070669_10000254915 122
112 3300005354 Ga0070675_100002038 Ga0070675_10000203811 122
113 3300005364 Ga0070673_100140609 Ga0070673_1001406092 122
114 3300005364 Ga0070673_100231691 Ga0070673_1002316911 122
115 3300005366 Ga0070659_100162778 Ga0070659_1001627782 122
116 3300005438 Ga0070701_10072216 Ga0070701_100722161 122
117 3300005441 Ga0070700_100505723 Ga0070700_1005057232 122
118 3300005457 Ga0070662_100028845 Ga0070662_1000288452 122
119 3300005459 Ga0068867_100360276 Ga0068867_1003602762 122
120 3300005468 Ga0070707_101114606 Ga0070707_1011146061 122
121 3300005471 Ga0070698_100523950 Ga0070698_1005239501 122
122 3300005539 Ga0068853_101745986 Ga0068853_1017459861 122
123 3300005543 Ga0070672_100098966 Ga0070672_1000989662 122
124 3300005543 Ga0070672_100377833 Ga0070672_1003778331 122
125 3300005549 Ga0070704_100561897 Ga0070704_1005618971 122
126 3300005577 Ga0068857_100139917 Ga0068857_1001399172 122
127 3300005577 Ga0068857_100430114 Ga0068857_1004301142 122
128 3300005577 Ga0068857_100695507 Ga0068857_1006955072 122
129 3300005615 Ga0070702_100488478 Ga0070702_1004884782 122
130 3300005616 Ga0068852_101757433 Ga0068852_1017574331 122
131 3300005617 Ga0068859_100104653 Ga0068859_1001046533 122
132 3300005719 Ga0068861_100266292 Ga0068861_1002662921 122
133 3300005840 Ga0068870_10014932 Ga0068870_100149323 122
134 3300005842 Ga0068858_101082886 Ga0068858_1010828862 122
135 3300005843 Ga0068860_102152517 Ga0068860_1021525171 122
136 3300005844 Ga0068862_100001278 Ga0068862_10000127821 122
137 3300005844 Ga0068862_100750347 Ga0068862_1007503472 122
138 3300006237 Ga0097621_101563936 Ga0097621_1015639361 122
139 3300006358 Ga0068871_100090582 Ga0068871_1000905822 122
140 3300006931 Ga0097620_100104650 Ga0097620_1001046503 122
141 3300009094 Ga0111539_10032137 Ga0111539_100321376 122
142 3300009094 Ga0111539_11445454 Ga0111539_114454542 122
143 3300009094 Ga0111539_12145557 Ga0111539_121455571 122
144 3300009176 Ga0105242_10959840 Ga0105242_109598402 122
145 3300009553 Ga0105249_10012242 Ga0105249_100122422 122
146 3300009553 Ga0105249_10131735 Ga0105249_101317352 122
147 3300013100 Ga0157373_10064536 Ga0157373_100645362 122
148 3300013102 Ga0157371_10011098 Ga0157371_100110982 122
149 3300013102 Ga0157371_10019609 Ga0157371_100196095 122
150 3300013102 Ga0157371_11024405 Ga0157371_110244052 122
151 3300013104 Ga0157370_10260092 Ga0157370_102600921 122
152 3300013104 Ga0157370_10382987 Ga0157370_103829872 122
153 3300013105 Ga0157369_11426890 Ga0157369_114268902 122
154 3300013306 Ga0163162_10132016 Ga0163162_101320162 122
155 3300013307 Ga0157372_10001914 Ga0157372_1000191410 122
156 3300013307 Ga0157372_10027811 Ga0157372_100278114 122
157 3300013307 Ga0157372_10108365 Ga0157372_101083653 122
158 3300013307 Ga0157372_10146686 Ga0157372_101466863 122
159 3300013307 Ga0157372_10302240 Ga0157372_103022402 122
160 3300013307 Ga0157372_10629329 Ga0157372_106293292 122
161 3300013308 Ga0157375_10357370 Ga0157375_103573702 122
162 3300014325 Ga0163163_10237630 Ga0163163_102376302 122
163 3300014326 Ga0157380_10052957 Ga0157380_100529572 122
164 3300014326 Ga0157380_10110565 Ga0157380_101105654 122
165 3300014326 Ga0157380_10114587 Ga0157380_101145873 122
166 3300014745 Ga0157377_10039067 Ga0157377_100390672 122
167 3300017792 Ga0163161_10338159 Ga0163161_103381592 122
168 3300025907 Ga0207645_10278163 Ga0207645_102781632 122
169 3300025908 Ga0207643_10019697 Ga0207643_100196972 122
170 3300025919 Ga0207657_10559426 Ga0207657_105594262 122
171 3300025922 Ga0207646_10787224 Ga0207646_107872241 122
172 3300025923 Ga0207681_10192715 Ga0207681_101927152 122
173 3300025925 Ga0207650_11918135 Ga0207650_119181351 122
174 3300025926 Ga0207659_10135411 Ga0207659_101354112 122
175 3300025926 Ga0207659_10844498 Ga0207659_108444982 122
176 3300025932 Ga0207690_10277209 Ga0207690_102772092 122
177 3300025933 Ga0207706_10014259 Ga0207706_100142596 122
178 3300025936 Ga0207670_10183709 Ga0207670_101837092 122
179 3300025940 Ga0207691_10067733 Ga0207691_100677332 122
180 3300025944 Ga0207661_10554071 Ga0207661_105540712 122
181 3300025960 Ga0207651_10075835 Ga0207651_100758353 122
182 3300025961 Ga0207712_10016127 Ga0207712_100161273 122
183 3300025961 Ga0207712_11355881 Ga0207712_113558811 122
184 3300026041 Ga0207639_11354812 Ga0207639_113548122 122
185 3300026075 Ga0207708_10042730 Ga0207708_100427302 122
186 3300026089 Ga0207648_10085341 Ga0207648_100853412 122
187 3300026116 Ga0207674_10003180 Ga0207674_100031809 122
188 3300026118 Ga0207675_100000299 Ga0207675_10000029920 122
189 3300026118 Ga0207675_100509623 Ga0207675_1005096232 122
190 3300026142 Ga0207698_10709165 Ga0207698_107091652 122
191 3300028380 Ga0268265_10166044 Ga0268265_101660442 122
192 3300028800 Ga0265338_10075819 Ga0265338_100758192 122
193 3300029957 Ga0265324_10008317 Ga0265324_100083173 122
194 3300031824 Ga0307413_10555684 Ga0307413_105556842 122
195 3300031903 Ga0307407_10528013 Ga0307407_105280132 122
196 3300035692 Ga0373935_0903293 Ga0373935_0903293_235_630 122
197 3300037312 Ga0395899_0984649 Ga0395899_0984649_75_455 122
198 3300037418 Ga0395900_0065050 Ga0395900_0065050_1019_1414 122
199 3300037466 Ga0395898_0128579 Ga0395898_0128579_1770_2165 122
200 3300037471 Ga0395905_0000227 Ga0395905_0000227_22915_23295 122
201 3300037471 Ga0395905_0142087 Ga0395905_0142087_252_638 122
202 3300038443 Ga0395901_0062146 Ga0395901_0062146_2621_3016 122
203 3300041406 Ga0439439_0137959 Ga0439439_0137959_51_428 122
204 3300041407 Ga0439447_140321 Ga0439447_140321_100_477 122
205 3300041411 Ga0439466_0055137 Ga0439466_0055137_16_393 122
206 3300041997 Ga0439431_0046462 Ga0439431_0046462_291_668 122
207 3300042002 Ga0439442_007943 Ga0439442_007943_561_938 122
208 3300042004 Ga0439445_0064725 Ga0439445_0064725_199_576 122
209 3300042007 Ga0439449_0037126 Ga0439449_0037126_1077_1454 122
210 3300042015 Ga0439462_0004749 Ga0439462_0004749_360_737 122
211 3300042128 Ga0450897_000287 Ga0450897_000287_2008_2385 122
212 3300042131 Ga0450894_012443 Ga0450894_012443_325_702 122
213 3300042435 Ga0439434_0066717 Ga0439434_0066717_416_793 122
214 3300045049 Ga0466959_0377556 Ga0466959_0377556_229_618 122
215 3300046537 Ga0495598_0130124 Ga0495598_0130124_296_673 122
216 3300046558 Ga0495633_0172197 Ga0495633_0172197_117_494 122
217 3300046616 Ga0495668_0014997 Ga0495668_0014997_3920_4312 122
218 3300046691 Ga0495670_0220748 Ga0495670_0220748_523_900 122
219 3300046809 Ga0495600_0329542 Ga0495600_0329542_551_940 122
220 3300047318 Ga0495636_0000002 Ga0495636_0000002_65436_65825 122
221 3300049656 Ga0501209_086451 Ga0501209_086451_283_708 122
222 3300049669 Ga0501235_011106 Ga0501235_011106_58_483 122
223 3300049681 Ga0501251_018428 Ga0501251_018428_472_861 122
224 3300049684 Ga0501255_009680 Ga0501255_009680_487_912 122
225 3300049686 Ga0501257_007608 Ga0501257_007608_1722_2102 122
226 3300049688 Ga0501259_008144 Ga0501259_008144_856_1281 122
227 3300049705 Ga0501225_0035877 Ga0501225_0035877_163_549 122
228 3300049708 Ga0501245_007988 Ga0501245_007988_528_953 122
229 3300049760 Ga0501263_044575 Ga0501263_044575_169_594 122
230 3300049763 Ga0501266_001249 Ga0501266_001249_1240_1665 122
231 3300049763 Ga0501266_017495 Ga0501266_017495_40_426 122
232 3300050508 nmdc:mga09592_1019649_c1 nmdc:mga09592_1019649_c1_298_666 122
233 3300050511 nmdc:mga08y16_459918_c1 nmdc:mga08y16_459918_c1_152_520 122
234 3300050511 nmdc:mga08y16_95122_c1 nmdc:mga08y16_95122_c1_1077_1454 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02033

RBFA

Ribosome-binding factor A

31

135

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dyj-assembly2.cif.gz_B crystal structure of ribosome-binding factor a from thermus thermophilus hb8 0.877 7 97
8bxa-assembly1.cif.gz_A crystal structure of ribosome binding factor a (rbfa) from s. aureus 0.8699 5 101
2dyj-assembly1.cif.gz_A crystal structure of ribosome-binding factor a from thermus thermophilus hb8 0.8629 7 97
2r1c-assembly1.cif.gz_A coordinates of the thermus thermophilus ribosome binding factor a (rbfa) homology model as fitted into the cryo-em map of a 30s-rbfa complex 0.8523 12 97
1jos-assembly1.cif.gz_A ribosome binding factor a(rbfa) 0.8476 7 99
ID Description Score Start End Superfamily
2dyjB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.877 7 97 3.30.300.20
af_Q8SXX0_83_186_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8384 3 98 3.30.300.20
af_Q5VPH3_41_157_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8339 5 104 3.30.300.20
2dyjB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8236 7 97 3.30.300.20
af_Q18170_73_171_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.814 5 98 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A3D6CF68-F1-model_v4 Ribosome-binding factor A 0.9538 1 89 GO:0006364
AF-A0A4Q3W603-F1-model_v4 Ribosome-binding factor A 0.9457 1 65 GO:0006364
AF-A0A3D6CF68-F1-model_v4 Ribosome-binding factor A 0.9433 1 89 GO:0006364
AF-A0A2D9DBE5-F1-model_v4 Ribosome-binding factor A 0.9415 6 112 GO:0005829
GO:0030490
GO:0043024
AF-A0A1F6BWK4-F1-model_v4 Ribosome-binding factor A 0.9374 6 99 GO:0006364

Feature Viewer

pLDDT pTM Quality
79.16 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map