F347288
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 234 | 158 | 233 | 359 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0078655|Ga0373937_0078655_1634_2719 |
| Length | 343 |
| Sequence | MERGPVIPTSYWHRLEDGRIQCDVCPRFCTLREGQRGLCFVRAREGERIVLTTYGRSSGFCVDPIEKKPLHHFLPGTAVLSFGTEGCNLSCKFCQNWDISKSREIAKLADEAPPGRIARAAKELGCRSVAFTYNDPTIFFEYAAGYMCPEPRAEFYRHIDAANVDLKAFTEKFYWEITGAHLQPVLDTLVYLKTQTRVWLELTNLLIPGHNDSDKELAAMTRWVVDNLGRDVPMHFTAFHPDWKMLDVPPTPAATLSRARRIALKAGVRYAYTGNVRDPDGGSTFCHVCAAEVIGRDGYEITEWNLDHGRCAVCGEPCPGVFEERPGQWGERRLPVRLRDFAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2920107658 | Aquisphaera insulae JC669 | Isolate | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 16 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 21 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 22 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 23 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 24 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 25 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 29 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 30 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 33 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 34 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 35 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 36 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 49 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 76 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 77 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 78 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 79 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 80 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 81 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 82 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 83 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 84 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 85 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 86 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 87 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 88 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 89 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 90 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 91 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 92 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 93 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 94 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 95 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 96 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 97 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 98 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 99 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 100 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 101 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 102 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 103 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 104 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 105 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 106 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 107 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 108 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 109 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 110 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 111 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 112 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 113 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 114 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 115 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 116 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 117 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 141 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 144 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 148 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 149 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 151 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.57 |
| Metatranscriptomes | 0 |
| Isolates | 0.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.85 |
| Nodule | 0 |
| Rhizoplane | 1.71 |
| Rhizosphere | 88.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10142158 | 3300005293 | Bacteria | 1838 |
| 2 | Ga0070670_100000274 | 3300005331 | Bacteria | 45804 |
| 3 | Ga0070670_100078294 | 3300005331 | Bacteria | 2840 |
| 4 | Ga0070670_100131068 | 3300005331 | Bacteria | 2165 |
| 5 | Ga0068869_100002759 | 3300005334 | Bacteria | 10636 |
| 6 | Ga0068869_100004100 | 3300005334 | Bacteria | 9026 |
| 7 | Ga0070666_10217156 | 3300005335 | Bacteria | 1348 |
| 8 | Ga0070668_100013298 | 3300005347 | Bacteria | 6142 |
| 9 | Ga0070668_100014299 | 3300005347 | Bacteria | 5931 |
| 10 | Ga0070668_100015146 | 3300005347 | Bacteria | 5762 |
| 11 | Ga0070669_100038278 | 3300005353 | Bacteria | 3482 |
| 12 | Ga0070669_100042306 | 3300005353 | Bacteria | 3315 |
| 13 | Ga0070675_100005416 | 3300005354 | Bacteria | 9760 |
| 14 | Ga0070675_100099672 | 3300005354 | Bacteria | 2446 |
| 15 | Ga0070673_100002101 | 3300005364 | Bacteria | 12033 |
| 16 | Ga0070673_100126808 | 3300005364 | Bacteria | 2137 |
| 17 | Ga0070667_100009280 | 3300005367 | Bacteria | 8151 |
| 18 | Ga0070667_100062715 | 3300005367 | Bacteria | 3149 |
| 19 | Ga0070714_100350319 | 3300005435 | Bacteria | 1387 |
| 20 | Ga0070713_100008625 | 3300005436 | Bacteria | 7242 |
| 21 | Ga0070678_100149444 | 3300005456 | Bacteria | 1880 |
| 22 | Ga0070662_100150962 | 3300005457 | Bacteria | 1809 |
| 23 | Ga0068867_100034470 | 3300005459 | Bacteria | 3668 |
| 24 | Ga0070706_100000988 | 3300005467 | Bacteria | 30963 |
| 25 | Ga0070707_100000931 | 3300005468 | Bacteria | 29052 |
| 26 | Ga0070696_100162763 | 3300005546 | Bacteria | 1645 |
| 27 | Ga0068855_100044952 | 3300005563 | Bacteria | 5225 |
| 28 | Ga0068857_100003534 | 3300005577 | Bacteria | 13063 |
| 29 | Ga0068852_100479757 | 3300005616 | Bacteria | 1235 |
| 30 | Ga0068859_100002792 | 3300005617 | Bacteria | 17696 |
| 31 | Ga0068859_100149608 | 3300005617 | Bacteria | 2410 |
| 32 | Ga0068859_100346276 | 3300005617 | Bacteria | 1581 |
| 33 | Ga0068864_100008382 | 3300005618 | Bacteria | 8528 |
| 34 | Ga0068861_100004435 | 3300005719 | Bacteria | 9417 |
| 35 | Ga0068861_100375293 | 3300005719 | Bacteria | 1255 |
| 36 | Ga0068870_10026170 | 3300005840 | Bacteria | 2906 |
| 37 | Ga0068863_100002691 | 3300005841 | Bacteria | 17567 |
| 38 | Ga0068863_100104500 | 3300005841 | Bacteria | 2694 |
| 39 | Ga0068858_100000345 | 3300005842 | Bacteria | 49147 |
| 40 | Ga0068858_100126493 | 3300005842 | Bacteria | 2394 |
| 41 | Ga0068860_100001723 | 3300005843 | Bacteria | 23333 |
| 42 | Ga0068860_100043743 | 3300005843 | Bacteria | 4270 |
| 43 | Ga0068862_100008744 | 3300005844 | Bacteria | 8383 |
| 44 | Ga0068862_100128747 | 3300005844 | Bacteria | 2237 |
| 45 | Ga0070716_100053519 | 3300006173 | Bacteria | 2302 |
| 46 | Ga0070712_100003787 | 3300006175 | Bacteria | 9314 |
| 47 | Ga0075366_10041794 | 3300006195 | Bacteria | 2714 |
| 48 | Ga0068871_100040809 | 3300006358 | Bacteria | 3718 |
| 49 | Ga0075430_100238410 | 3300006846 | Bacteria | 1507 |
| 50 | Ga0075436_100030924 | 3300006914 | Bacteria | 3685 |
| 51 | Ga0097620_100002792 | 3300006931 | Bacteria | 17696 |
| 52 | Ga0097620_100149601 | 3300006931 | Bacteria | 2410 |
| 53 | Ga0097620_100346262 | 3300006931 | Bacteria | 1581 |
| 54 | Ga0105247_10032173 | 3300009101 | Bacteria | 3187 |
| 55 | Ga0114129_10090478 | 3300009147 | Bacteria | 4242 |
| 56 | Ga0105248_10035918 | 3300009177 | Bacteria | 5543 |
| 57 | Ga0105248_10231560 | 3300009177 | Bacteria | 2080 |
| 58 | Ga0105248_10437125 | 3300009177 | Bacteria | 1474 |
| 59 | Ga0105246_10163691 | 3300011119 | Bacteria | 1697 |
| 60 | Ga0157374_10358161 | 3300013296 | Bacteria | 1450 |
| 61 | Ga0157378_10035469 | 3300013297 | Bacteria | 4412 |
| 62 | Ga0163162_10067799 | 3300013306 | Bacteria | 3619 |
| 63 | Ga0157375_10016898 | 3300013308 | Bacteria | 6572 |
| 64 | Ga0157375_10043527 | 3300013308 | Bacteria | 4355 |
| 65 | Ga0163163_10002386 | 3300014325 | Bacteria | 15903 |
| 66 | Ga0163163_10179598 | 3300014325 | Bacteria | 2164 |
| 67 | Ga0157379_10000443 | 3300014968 | Bacteria | 33618 |
| 68 | Ga0157376_10022624 | 3300014969 | Bacteria | 4904 |
| 69 | Ga0213872_10002051 | 3300021361 | Bacteria | 12229 |
| 70 | Ga0207656_10052565 | 3300025321 | Bacteria | 1765 |
| 71 | Ga0207642_10090814 | 3300025899 | Bacteria | 1508 |
| 72 | Ga0207684_10000507 | 3300025910 | Bacteria | 48732 |
| 73 | Ga0207693_10005537 | 3300025915 | Bacteria | 10506 |
| 74 | Ga0207681_10000026 | 3300025923 | Bacteria | 194056 |
| 75 | Ga0207681_10007147 | 3300025923 | Bacteria | 6847 |
| 76 | Ga0207681_10043114 | 3300025923 | Bacteria | 3018 |
| 77 | Ga0207650_10005657 | 3300025925 | Bacteria | 8537 |
| 78 | Ga0207650_10245256 | 3300025925 | Bacteria | 1449 |
| 79 | Ga0207659_10005626 | 3300025926 | Bacteria | 7618 |
| 80 | Ga0207664_10045356 | 3300025929 | Bacteria | 3447 |
| 81 | Ga0207691_10335890 | 3300025940 | Bacteria | 1294 |
| 82 | Ga0207711_10002732 | 3300025941 | Bacteria | 15558 |
| 83 | Ga0207711_10236473 | 3300025941 | Bacteria | 1674 |
| 84 | Ga0207689_10003883 | 3300025942 | Bacteria | 13618 |
| 85 | Ga0207689_10008166 | 3300025942 | Bacteria | 9125 |
| 86 | Ga0207667_10168277 | 3300025949 | Bacteria | 2253 |
| 87 | Ga0207651_10056461 | 3300025960 | Bacteria | 2702 |
| 88 | Ga0207668_10001594 | 3300025972 | Bacteria | 13247 |
| 89 | Ga0207668_10046516 | 3300025972 | Bacteria | 2965 |
| 90 | Ga0207658_10004916 | 3300025986 | Bacteria | 9219 |
| 91 | Ga0207658_10198610 | 3300025986 | Bacteria | 1673 |
| 92 | Ga0207677_10277685 | 3300026023 | Bacteria | 1373 |
| 93 | Ga0207703_10000292 | 3300026035 | Bacteria | 54983 |
| 94 | Ga0207703_10227027 | 3300026035 | Bacteria | 1672 |
| 95 | Ga0207641_10001774 | 3300026088 | Bacteria | 20774 |
| 96 | Ga0207641_10091998 | 3300026088 | Bacteria | 2656 |
| 97 | Ga0207641_10125129 | 3300026088 | Bacteria | 2300 |
| 98 | Ga0207648_10007170 | 3300026089 | Bacteria | 10990 |
| 99 | Ga0207648_10025374 | 3300026089 | Bacteria | 5281 |
| 100 | Ga0207676_10001693 | 3300026095 | Bacteria | 16260 |
| 101 | Ga0207676_10031407 | 3300026095 | Bacteria | 3995 |
| 102 | Ga0207674_10007473 | 3300026116 | Bacteria | 12735 |
| 103 | Ga0207675_100001077 | 3300026118 | Bacteria | 27123 |
| 104 | Ga0207683_10054600 | 3300026121 | Bacteria | 3503 |
| 105 | Ga0209966_1007653 | 3300027695 | Bacteria | 1898 |
| 106 | Ga0268265_10300384 | 3300028380 | Bacteria | 1445 |
| 107 | Ga0268264_10000862 | 3300028381 | Bacteria | 32146 |
| 108 | Ga0268264_10100830 | 3300028381 | Bacteria | 2508 |
| 109 | Ga0265328_10008905 | 3300031239 | Bacteria | 4113 |
| 110 | Ga0265331_10000109 | 3300031250 | Bacteria | 108845 |
| 111 | Ga0265327_10000243 | 3300031251 | Bacteria | 108869 |
| 112 | Ga0265327_10000512 | 3300031251 | Bacteria | 67274 |
| 113 | Ga0265327_10025794 | 3300031251 | Bacteria | 3418 |
| 114 | Ga0307408_100024130 | 3300031548 | Bacteria | 4149 |
| 115 | Ga0316575_10001724 | 3300031665 | Bacteria | 7158 |
| 116 | Ga0316575_10012260 | 3300031665 | Bacteria | 3186 |
| 117 | Ga0316578_10030192 | 3300031728 | Bacteria | 3080 |
| 118 | Ga0316578_10046893 | 3300031728 | Bacteria | 2520 |
| 119 | Ga0316578_10105811 | 3300031728 | Bacteria | 1688 |
| 120 | Ga0307405_10000758 | 3300031731 | Bacteria | 12596 |
| 121 | Ga0316577_10029203 | 3300031733 | Bacteria | 3078 |
| 122 | Ga0316577_10136563 | 3300031733 | Bacteria | 1381 |
| 123 | Ga0307410_10013716 | 3300031852 | Bacteria | 4739 |
| 124 | Ga0307406_10008674 | 3300031901 | Bacteria | 5681 |
| 125 | Ga0307407_10000533 | 3300031903 | Bacteria | 11833 |
| 126 | Ga0307412_10003563 | 3300031911 | Bacteria | 8644 |
| 127 | Ga0307409_100000533 | 3300031995 | Bacteria | 16444 |
| 128 | Ga0307416_100000164 | 3300032002 | Bacteria | 37789 |
| 129 | Ga0307414_10023267 | 3300032004 | Bacteria | 3927 |
| 130 | Ga0307411_10001297 | 3300032005 | Bacteria | 10041 |
| 131 | Ga0307415_100001532 | 3300032126 | Bacteria | 11097 |
| 132 | Ga0316583_10000202 | 3300032133 | Bacteria | 15619 |
| 133 | Ga0316583_10010547 | 3300032133 | Bacteria | 3332 |
| 134 | Ga0373934_0055424 | 3300035086 | Bacteria | 1575 |
| 135 | Ga0373956_0022646 | 3300035119 | Bacteria | 2690 |
| 136 | Ga0373955_0239349 | 3300035172 | Bacteria | 1087 |
| 137 | Ga0316574_0000300 | 3300035398 | Bacteria | 18658 |
| 138 | Ga0316574_0021065 | 3300035398 | Bacteria | 3865 |
| 139 | Ga0316574_0060755 | 3300035398 | Bacteria | 2373 |
| 140 | Ga0373935_0106692 | 3300035692 | Bacteria | 1854 |
| 141 | Ga0373933_0002044 | 3300035724 | Bacteria | 11592 |
| 142 | Ga0373937_0000868 | 3300036401 | Bacteria | 26006 |
| 143 | Ga0373937_0008787 | 3300036401 | Bacteria | 8764 |
| 144 | Ga0373937_0078655 | 3300036401 | Bacteria | 3048 |
| 145 | Ga0316582_0006869 | 3300036647 | Bacteria | 6017 |
| 146 | Ga0316582_0026994 | 3300036647 | Bacteria | 3463 |
| 147 | Ga0316582_0034132 | 3300036647 | Bacteria | 3131 |
| 148 | Ga0316582_0048964 | 3300036647 | Bacteria | 2673 |
| 149 | Ga0316582_0054957 | 3300036647 | Bacteria | 2537 |
| 150 | Ga0316584_0014484 | 3300036712 | Bacteria | 5615 |
| 151 | Ga0316584_0140749 | 3300036712 | Bacteria | 1799 |
| 152 | Ga0373925_0024457 | 3300037068 | Bacteria | 4410 |
| 153 | Ga0316581_0009727 | 3300037588 | Bacteria | 2649 |
| 154 | Ga0400484_13421 | 3300038725 | Bacteria | 33582 |
| 155 | Ga0400490_00731 | 3300038726 | Bacteria | 33699 |
| 156 | Ga0400490_02841 | 3300038726 | Bacteria | 6278 |
| 157 | Ga0400490_05485 | 3300038726 | Bacteria | 73498 |
| 158 | Ga0400490_19194 | 3300038726 | Bacteria | 15214 |
| 159 | Ga0400491_25846 | 3300038727 | Bacteria | 2117 |
| 160 | Ga0400485_07884 | 3300038735 | Bacteria | 123132 |
| 161 | Ga0400485_16880 | 3300038735 | Bacteria | 18572 |
| 162 | Ga0400488_01902 | 3300038741 | Bacteria | 13587 |
| 163 | Ga0400488_16067 | 3300038741 | Bacteria | 4092 |
| 164 | Ga0400488_28196 | 3300038741 | Bacteria | 2075 |
| 165 | Ga0400488_39297 | 3300038741 | Bacteria | 1597 |
| 166 | Ga0400488_62074 | 3300038741 | Bacteria | 18243 |
| 167 | Ga0400486_15402 | 3300038742 | Bacteria | 34536 |
| 168 | Ga0400486_28685 | 3300038742 | Bacteria | 138069 |
| 169 | Ga0400483_108103 | 3300039062 | Bacteria | 30756 |
| 170 | Ga0400483_180179 | 3300039062 | Bacteria | 29553 |
| 171 | Ga0400483_198090 | 3300039062 | Bacteria | 2292 |
| 172 | Ga0400483_263075 | 3300039062 | Bacteria | 6260 |
| 173 | Ga0400487_03158 | 3300039110 | Bacteria | 8991 |
| 174 | Ga0400487_08272 | 3300039110 | Bacteria | 7289 |
| 175 | Ga0400487_27243 | 3300039110 | Bacteria | 18394 |
| 176 | Ga0436361_0210067 | 3300039447 | Bacteria | 6857 |
| 177 | Ga0451577_0016302 | 3300042876 | Bacteria | 6884 |
| 178 | Ga0451577_0031737 | 3300042876 | Bacteria | 4765 |
| 179 | Ga0466964_0027379 | 3300044706 | Bacteria | 2238 |
| 180 | Ga0453684_0000341 | 3300044712 | Bacteria | 194228 |
| 181 | Ga0451576_0220014 | 3300045051 | Bacteria | 1983 |
| 182 | Ga0495592_0033667 | 3300046454 | Bacteria | 3864 |
| 183 | Ga0495592_0122551 | 3300046454 | Bacteria | 1827 |
| 184 | Ga0495653_0137756 | 3300046463 | Bacteria | 1720 |
| 185 | Ga0495608_0005156 | 3300046511 | Bacteria | 9336 |
| 186 | Ga0495608_0067552 | 3300046511 | Bacteria | 2338 |
| 187 | Ga0495618_0051585 | 3300046514 | Bacteria | 2599 |
| 188 | Ga0495628_0050165 | 3300046516 | Bacteria | 3302 |
| 189 | Ga0495628_0092956 | 3300046516 | Bacteria | 2333 |
| 190 | Ga0495652_0033430 | 3300046529 | Bacteria | 4490 |
| 191 | Ga0495640_0026962 | 3300046533 | Bacteria | 4147 |
| 192 | Ga0495587_0021075 | 3300046536 | Bacteria | 4020 |
| 193 | Ga0495587_0051618 | 3300046536 | Bacteria | 2430 |
| 194 | Ga0495645_0002431 | 3300046543 | Bacteria | 12654 |
| 195 | Ga0495667_0006307 | 3300046559 | Bacteria | 8047 |
| 196 | Ga0495667_0052984 | 3300046559 | Bacteria | 2672 |
| 197 | Ga0495656_0016923 | 3300046615 | Bacteria | 2774 |
| 198 | Ga0495656_0069141 | 3300046615 | Bacteria | 1563 |
| 199 | Ga0495634_0002869 | 3300046642 | Bacteria | 14135 |
| 200 | Ga0495635_0156720 | 3300046663 | Bacteria | 1550 |
| 201 | Ga0495599_0008806 | 3300046678 | Bacteria | 6143 |
| 202 | Ga0495599_0016189 | 3300046678 | Bacteria | 4628 |
| 203 | Ga0495658_0004009 | 3300046683 | Bacteria | 7260 |
| 204 | Ga0495624_0023452 | 3300046690 | Bacteria | 4069 |
| 205 | Ga0495600_0005281 | 3300046809 | Bacteria | 7779 |
| 206 | Ga0495600_0036389 | 3300046809 | Bacteria | 3199 |
| 207 | Ga0495604_0003865 | 3300047317 | Bacteria | 11932 |
| 208 | Ga0495604_0113117 | 3300047317 | Bacteria | 1976 |
| 209 | Ga0495680_0000735 | 3300047322 | Bacteria | 36769 |
| 210 | Ga0495680_0142851 | 3300047322 | Bacteria | 1750 |
| 211 | Ga0495675_0018691 | 3300047444 | Bacteria | 4401 |
| 212 | Ga0495684_0060588 | 3300047471 | Bacteria | 2881 |
| 213 | Ga0495593_0033904 | 3300047673 | Bacteria | 2779 |
| 214 | Ga0495602_0000963 | 3300048088 | Bacteria | 27824 |
| 215 | Ga0496102_0064381 | 3300048905 | Bacteria | 3358 |
| 216 | Ga0496108_0031826 | 3300048911 | Bacteria | 4379 |
| 217 | Ga0496109_0010882 | 3300048912 | Bacteria | 7790 |
| 218 | Ga0496110_0249701 | 3300048913 | Bacteria | 1615 |
| 219 | Ga0501031_0062801 | 3300049568 | Bacteria | 2420 |
| 220 | Ga0501039_0091569 | 3300049575 | Bacteria | 2370 |
| 221 | Ga0501074_0066839 | 3300049590 | Bacteria | 2586 |
| 222 | Ga0501198_000037 | 3300049649 | Bacteria | 52054 |
| 223 | Ga0501222_000094 | 3300049662 | Bacteria | 23733 |
| 224 | Ga0501079_0031227 | 3300049741 | Bacteria | 4094 |
| 225 | nmdc:mga0k408_18791_c1 | 3300050493 | Bacteria | 3859 |
| 226 | nmdc:mga05p37_241211_c1 | 3300050507 | Bacteria | 2173 |
| 227 | nmdc:mga0qj67_61842_c1 | 3300050509 | Bacteria | 2974 |
| 228 | nmdc:mga0n895_30931_c1 | 3300050512 | Bacteria | 5121 |
| 229 | nmdc:mga08x19_97489_c1 | 3300050514 | Bacteria | 1947 |
| 230 | Ga0495601_0002833 | 3300053077 | Bacteria | 9849 |
| 231 | Ga0495612_0000660 | 3300053078 | Bacteria | 13890 |
| 232 | Ga0495595_0013280 | 3300053084 | Bacteria | 3478 |
| 233 | Ga0501084_0137884 | 3300054114 | Bacteria | 2054 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038725 | Ga0400484_13421 | Ga0400484_13421_32377_33372 | 315 |
| 2 | 3300038726 | Ga0400490_00731 | Ga0400490_00731_23968_24927 | 319 |
| 3 | 3300038727 | Ga0400491_25846 | Ga0400491_25846_373_1332 | 319 |
| 4 | 3300038741 | Ga0400488_28196 | Ga0400488_28196_660_1619 | 319 |
| 5 | 3300039110 | Ga0400487_08272 | Ga0400487_08272_5300_6259 | 319 |
| 6 | 3300046615 | Ga0495656_0069141 | Ga0495656_0069141_285_1244 | 319 |
| 7 | 3300036647 | Ga0316582_0054957 | Ga0316582_0054957_106_1074 | 321 |
| 8 | 3300042876 | Ga0451577_0031737 | Ga0451577_0031737_2648_3613 | 321 |
| 9 | 3300049741 | Ga0501079_0031227 | Ga0501079_0031227_980_1960 | 323 |
| 10 | 3300005546 | Ga0070696_100162763 | Ga0070696_1001627631 | 324 |
| 11 | 3300009177 | Ga0105248_10231560 | Ga0105248_102315602 | 335 |
| 12 | 3300036401 | Ga0373937_0078655 | Ga0373937_0078655_1634_2719 | 338 |
| 13 | 3300047317 | Ga0495604_0003865 | Ga0495604_0003865_1405_2424 | 339 |
| 14 | 3300048913 | Ga0496110_0249701 | Ga0496110_0249701_460_1560 | 340 |
| 15 | 3300046678 | Ga0495599_0008806 | Ga0495599_0008806_4168_5253 | 341 |
| 16 | 3300013297 | Ga0157378_10035469 | Ga0157378_100354695 | 342 |
| 17 | 3300031239 | Ga0265328_10008905 | Ga0265328_100089052 | 343 |
| 18 | 3300031251 | Ga0265327_10000512 | Ga0265327_1000051234 | 343 |
| 19 | 3300036401 | Ga0373937_0000868 | Ga0373937_0000868_19244_20329 | 343 |
| 20 | 3300037068 | Ga0373925_0024457 | Ga0373925_0024457_1655_2740 | 343 |
| 21 | 3300046516 | Ga0495628_0050165 | Ga0495628_0050165_22_1107 | 343 |
| 22 | 3300038726 | Ga0400490_19194 | Ga0400490_19194_9054_10127 | 345 |
| 23 | 3300038741 | Ga0400488_01902 | Ga0400488_01902_4834_5919 | 346 |
| 24 | 3300035172 | Ga0373955_0239349 | Ga0373955_0239349_19_1068 | 347 |
| 25 | 3300031728 | Ga0316578_10105811 | Ga0316578_101058111 | 348 |
| 26 | 3300035398 | Ga0316574_0021065 | Ga0316574_0021065_1743_2837 | 348 |
| 27 | 3300039062 | Ga0400483_263075 | Ga0400483_263075_2913_3995 | 349 |
| 28 | 3300049590 | Ga0501074_0066839 | Ga0501074_0066839_1477_2547 | 350 |
| 29 | 3300054114 | Ga0501084_0137884 | Ga0501084_0137884_404_1474 | 350 |
| 30 | 3300021361 | Ga0213872_10002051 | Ga0213872_100020517 | 353 |
| 31 | 3300039447 | Ga0436361_0210067 | Ga0436361_0210067_3638_4714 | 353 |
| 32 | 3300005456 | Ga0070678_100149444 | Ga0070678_1001494442 | 354 |
| 33 | 3300006175 | Ga0070712_100003787 | Ga0070712_1000037874 | 354 |
| 34 | 3300026121 | Ga0207683_10054600 | Ga0207683_100546003 | 354 |
| 35 | 3300038726 | Ga0400490_05485 | Ga0400490_05485_29469_30539 | 354 |
| 36 | 3300039062 | Ga0400483_108103 | Ga0400483_108103_10019_11089 | 354 |
| 37 | 3300039062 | Ga0400483_180179 | Ga0400483_180179_25682_26752 | 354 |
| 38 | 3300044712 | Ga0453684_0000341 | Ga0453684_0000341_160292_161383 | 354 |
| 39 | 3300005435 | Ga0070714_100350319 | Ga0070714_1003503191 | 355 |
| 40 | 3300005436 | Ga0070713_100008625 | Ga0070713_1000086254 | 355 |
| 41 | 3300025915 | Ga0207693_10005537 | Ga0207693_100055376 | 355 |
| 42 | 3300025929 | Ga0207664_10045356 | Ga0207664_100453562 | 355 |
| 43 | 3300031665 | Ga0316575_10012260 | Ga0316575_100122603 | 355 |
| 44 | 3300031728 | Ga0316578_10046893 | Ga0316578_100468932 | 355 |
| 45 | 3300035086 | Ga0373934_0055424 | Ga0373934_0055424_233_1321 | 355 |
| 46 | 3300035119 | Ga0373956_0022646 | Ga0373956_0022646_1380_2468 | 355 |
| 47 | 3300035398 | Ga0316574_0060755 | Ga0316574_0060755_940_2025 | 355 |
| 48 | 3300035692 | Ga0373935_0106692 | Ga0373935_0106692_445_1533 | 355 |
| 49 | 3300035724 | Ga0373933_0002044 | Ga0373933_0002044_9893_10981 | 355 |
| 50 | 3300036401 | Ga0373937_0008787 | Ga0373937_0008787_144_1211 | 355 |
| 51 | 3300036647 | Ga0316582_0006869 | Ga0316582_0006869_1387_2472 | 355 |
| 52 | 3300036647 | Ga0316582_0026994 | Ga0316582_0026994_98_1180 | 355 |
| 53 | 3300037588 | Ga0316581_0009727 | Ga0316581_0009727_315_1400 | 355 |
| 54 | 3300038735 | Ga0400485_16880 | Ga0400485_16880_9798_10871 | 355 |
| 55 | 3300038741 | Ga0400488_16067 | Ga0400488_16067_995_2068 | 355 |
| 56 | 3300038741 | Ga0400488_39297 | Ga0400488_39297_289_1362 | 355 |
| 57 | 3300038742 | Ga0400486_15402 | Ga0400486_15402_13676_14749 | 355 |
| 58 | 3300039062 | Ga0400483_198090 | Ga0400483_198090_819_1892 | 355 |
| 59 | 3300039110 | Ga0400487_03158 | Ga0400487_03158_3249_4322 | 355 |
| 60 | 3300042876 | Ga0451577_0016302 | Ga0451577_0016302_5417_6517 | 355 |
| 61 | 3300044706 | Ga0466964_0027379 | Ga0466964_0027379_579_1655 | 355 |
| 62 | 3300046454 | Ga0495592_0033667 | Ga0495592_0033667_1808_2875 | 355 |
| 63 | 3300046454 | Ga0495592_0122551 | Ga0495592_0122551_712_1800 | 355 |
| 64 | 3300046463 | Ga0495653_0137756 | Ga0495653_0137756_308_1396 | 355 |
| 65 | 3300046511 | Ga0495608_0005156 | Ga0495608_0005156_15_1091 | 355 |
| 66 | 3300046511 | Ga0495608_0067552 | Ga0495608_0067552_660_1748 | 355 |
| 67 | 3300046514 | Ga0495618_0051585 | Ga0495618_0051585_1381_2448 | 355 |
| 68 | 3300046516 | Ga0495628_0092956 | Ga0495628_0092956_629_1717 | 355 |
| 69 | 3300046529 | Ga0495652_0033430 | Ga0495652_0033430_1132_2220 | 355 |
| 70 | 3300046533 | Ga0495640_0026962 | Ga0495640_0026962_3040_4128 | 355 |
| 71 | 3300046536 | Ga0495587_0021075 | Ga0495587_0021075_2163_3251 | 355 |
| 72 | 3300046536 | Ga0495587_0051618 | Ga0495587_0051618_878_1945 | 355 |
| 73 | 3300046543 | Ga0495645_0002431 | Ga0495645_0002431_8324_9412 | 355 |
| 74 | 3300046559 | Ga0495667_0006307 | Ga0495667_0006307_3112_4200 | 355 |
| 75 | 3300046559 | Ga0495667_0052984 | Ga0495667_0052984_1234_2322 | 355 |
| 76 | 3300046615 | Ga0495656_0016923 | Ga0495656_0016923_184_1260 | 355 |
| 77 | 3300046642 | Ga0495634_0002869 | Ga0495634_0002869_13023_14090 | 355 |
| 78 | 3300046663 | Ga0495635_0156720 | Ga0495635_0156720_377_1465 | 355 |
| 79 | 3300046678 | Ga0495599_0016189 | Ga0495599_0016189_1813_2880 | 355 |
| 80 | 3300046683 | Ga0495658_0004009 | Ga0495658_0004009_3526_4593 | 355 |
| 81 | 3300046690 | Ga0495624_0023452 | Ga0495624_0023452_2418_3485 | 355 |
| 82 | 3300046809 | Ga0495600_0005281 | Ga0495600_0005281_4805_5872 | 355 |
| 83 | 3300046809 | Ga0495600_0036389 | Ga0495600_0036389_794_1882 | 355 |
| 84 | 3300047317 | Ga0495604_0113117 | Ga0495604_0113117_830_1918 | 355 |
| 85 | 3300047322 | Ga0495680_0000735 | Ga0495680_0000735_3274_4341 | 355 |
| 86 | 3300047322 | Ga0495680_0142851 | Ga0495680_0142851_596_1684 | 355 |
| 87 | 3300047444 | Ga0495675_0018691 | Ga0495675_0018691_3116_4204 | 355 |
| 88 | 3300047471 | Ga0495684_0060588 | Ga0495684_0060588_1757_2845 | 355 |
| 89 | 3300047673 | Ga0495593_0033904 | Ga0495593_0033904_180_1247 | 355 |
| 90 | 3300048088 | Ga0495602_0000963 | Ga0495602_0000963_7657_8745 | 355 |
| 91 | 3300049649 | Ga0501198_000037 | Ga0501198_000037_14244_15320 | 355 |
| 92 | 3300049662 | Ga0501222_000094 | Ga0501222_000094_14244_15320 | 355 |
| 93 | 3300053077 | Ga0495601_0002833 | Ga0495601_0002833_4465_5553 | 355 |
| 94 | 3300053078 | Ga0495612_0000660 | Ga0495612_0000660_8329_9417 | 355 |
| 95 | 3300053084 | Ga0495595_0013280 | Ga0495595_0013280_1504_2592 | 355 |
| 96 | 3300005331 | Ga0070670_100131068 | Ga0070670_1001310682 | 356 |
| 97 | 3300005347 | Ga0070668_100015146 | Ga0070668_1000151461 | 356 |
| 98 | 3300005719 | Ga0068861_100375293 | Ga0068861_1003752931 | 356 |
| 99 | 3300005841 | Ga0068863_100104500 | Ga0068863_1001045002 | 356 |
| 100 | 3300005843 | Ga0068860_100043743 | Ga0068860_1000437435 | 356 |
| 101 | 3300005844 | Ga0068862_100128747 | Ga0068862_1001287473 | 356 |
| 102 | 3300006914 | Ga0075436_100030924 | Ga0075436_1000309244 | 356 |
| 103 | 3300009147 | Ga0114129_10090478 | Ga0114129_100904783 | 356 |
| 104 | 3300025925 | Ga0207650_10245256 | Ga0207650_102452562 | 356 |
| 105 | 3300025940 | Ga0207691_10335890 | Ga0207691_103358901 | 356 |
| 106 | 3300026088 | Ga0207641_10091998 | Ga0207641_100919982 | 356 |
| 107 | 3300026095 | Ga0207676_10031407 | Ga0207676_100314074 | 356 |
| 108 | 3300028380 | Ga0268265_10300384 | Ga0268265_103003842 | 356 |
| 109 | 3300031251 | Ga0265327_10025794 | Ga0265327_100257942 | 356 |
| 110 | 3300032133 | Ga0316583_10010547 | Ga0316583_100105474 | 356 |
| 111 | 3300049568 | Ga0501031_0062801 | Ga0501031_0062801_1309_2382 | 356 |
| 112 | 3300050507 | nmdc:mga05p37_241211_c1 | nmdc:mga05p37_241211_c1_489_1562 | 356 |
| 113 | 3300050514 | nmdc:mga08x19_97489_c1 | nmdc:mga08x19_97489_c1_406_1479 | 356 |
| 114 | 3300005293 | Ga0065715_10142158 | Ga0065715_101421582 | 357 |
| 115 | 3300005331 | Ga0070670_100000274 | Ga0070670_10000027440 | 357 |
| 116 | 3300005331 | Ga0070670_100078294 | Ga0070670_1000782943 | 357 |
| 117 | 3300005334 | Ga0068869_100002759 | Ga0068869_1000027592 | 357 |
| 118 | 3300005334 | Ga0068869_100004100 | Ga0068869_1000041009 | 357 |
| 119 | 3300005335 | Ga0070666_10217156 | Ga0070666_102171562 | 357 |
| 120 | 3300005347 | Ga0070668_100013298 | Ga0070668_1000132985 | 357 |
| 121 | 3300005347 | Ga0070668_100014299 | Ga0070668_1000142995 | 357 |
| 122 | 3300005353 | Ga0070669_100038278 | Ga0070669_1000382782 | 357 |
| 123 | 3300005353 | Ga0070669_100042306 | Ga0070669_1000423064 | 357 |
| 124 | 3300005354 | Ga0070675_100005416 | Ga0070675_1000054166 | 357 |
| 125 | 3300005354 | Ga0070675_100099672 | Ga0070675_1000996722 | 357 |
| 126 | 3300005364 | Ga0070673_100002101 | Ga0070673_1000021015 | 357 |
| 127 | 3300005364 | Ga0070673_100126808 | Ga0070673_1001268081 | 357 |
| 128 | 3300005367 | Ga0070667_100009280 | Ga0070667_10000928010 | 357 |
| 129 | 3300005367 | Ga0070667_100062715 | Ga0070667_1000627152 | 357 |
| 130 | 3300005457 | Ga0070662_100150962 | Ga0070662_1001509622 | 357 |
| 131 | 3300005459 | Ga0068867_100034470 | Ga0068867_1000344704 | 357 |
| 132 | 3300005467 | Ga0070706_100000988 | Ga0070706_10000098820 | 357 |
| 133 | 3300005468 | Ga0070707_100000931 | Ga0070707_10000093120 | 357 |
| 134 | 3300005563 | Ga0068855_100044952 | Ga0068855_1000449523 | 357 |
| 135 | 3300005577 | Ga0068857_100003534 | Ga0068857_1000035346 | 357 |
| 136 | 3300005616 | Ga0068852_100479757 | Ga0068852_1004797572 | 357 |
| 137 | 3300005617 | Ga0068859_100002792 | Ga0068859_10000279215 | 357 |
| 138 | 3300005617 | Ga0068859_100149608 | Ga0068859_1001496082 | 357 |
| 139 | 3300005617 | Ga0068859_100346276 | Ga0068859_1003462762 | 357 |
| 140 | 3300005618 | Ga0068864_100008382 | Ga0068864_1000083826 | 357 |
| 141 | 3300005719 | Ga0068861_100004435 | Ga0068861_1000044353 | 357 |
| 142 | 3300005840 | Ga0068870_10026170 | Ga0068870_100261703 | 357 |
| 143 | 3300005841 | Ga0068863_100002691 | Ga0068863_10000269118 | 357 |
| 144 | 3300005842 | Ga0068858_100000345 | Ga0068858_10000034532 | 357 |
| 145 | 3300005842 | Ga0068858_100126493 | Ga0068858_1001264932 | 357 |
| 146 | 3300005843 | Ga0068860_100001723 | Ga0068860_10000172320 | 357 |
| 147 | 3300005844 | Ga0068862_100008744 | Ga0068862_1000087444 | 357 |
| 148 | 3300006173 | Ga0070716_100053519 | Ga0070716_1000535192 | 357 |
| 149 | 3300006195 | Ga0075366_10041794 | Ga0075366_100417943 | 357 |
| 150 | 3300006358 | Ga0068871_100040809 | Ga0068871_1000408093 | 357 |
| 151 | 3300006846 | Ga0075430_100238410 | Ga0075430_1002384101 | 357 |
| 152 | 3300006931 | Ga0097620_100002792 | Ga0097620_1000027924 | 357 |
| 153 | 3300006931 | Ga0097620_100149601 | Ga0097620_1001496012 | 357 |
| 154 | 3300006931 | Ga0097620_100346262 | Ga0097620_1003462622 | 357 |
| 155 | 3300009101 | Ga0105247_10032173 | Ga0105247_100321733 | 357 |
| 156 | 3300009177 | Ga0105248_10035918 | Ga0105248_100359184 | 357 |
| 157 | 3300009177 | Ga0105248_10437125 | Ga0105248_104371252 | 357 |
| 158 | 3300011119 | Ga0105246_10163691 | Ga0105246_101636912 | 357 |
| 159 | 3300013296 | Ga0157374_10358161 | Ga0157374_103581612 | 357 |
| 160 | 3300013306 | Ga0163162_10067799 | Ga0163162_100677991 | 357 |
| 161 | 3300013308 | Ga0157375_10016898 | Ga0157375_100168984 | 357 |
| 162 | 3300013308 | Ga0157375_10043527 | Ga0157375_100435272 | 357 |
| 163 | 3300014325 | Ga0163163_10002386 | Ga0163163_1000238611 | 357 |
| 164 | 3300014325 | Ga0163163_10179598 | Ga0163163_101795982 | 357 |
| 165 | 3300014968 | Ga0157379_10000443 | Ga0157379_100004435 | 357 |
| 166 | 3300014969 | Ga0157376_10022624 | Ga0157376_100226248 | 357 |
| 167 | 3300025321 | Ga0207656_10052565 | Ga0207656_100525652 | 357 |
| 168 | 3300025899 | Ga0207642_10090814 | Ga0207642_100908141 | 357 |
| 169 | 3300025910 | Ga0207684_10000507 | Ga0207684_1000050719 | 357 |
| 170 | 3300025923 | Ga0207681_10000026 | Ga0207681_1000002658 | 357 |
| 171 | 3300025923 | Ga0207681_10007147 | Ga0207681_100071475 | 357 |
| 172 | 3300025923 | Ga0207681_10043114 | Ga0207681_100431142 | 357 |
| 173 | 3300025925 | Ga0207650_10005657 | Ga0207650_100056576 | 357 |
| 174 | 3300025926 | Ga0207659_10005626 | Ga0207659_100056264 | 357 |
| 175 | 3300025941 | Ga0207711_10002732 | Ga0207711_100027324 | 357 |
| 176 | 3300025941 | Ga0207711_10236473 | Ga0207711_102364732 | 357 |
| 177 | 3300025942 | Ga0207689_10003883 | Ga0207689_1000388316 | 357 |
| 178 | 3300025942 | Ga0207689_10008166 | Ga0207689_100081669 | 357 |
| 179 | 3300025949 | Ga0207667_10168277 | Ga0207667_101682773 | 357 |
| 180 | 3300025960 | Ga0207651_10056461 | Ga0207651_100564612 | 357 |
| 181 | 3300025972 | Ga0207668_10001594 | Ga0207668_100015944 | 357 |
| 182 | 3300025972 | Ga0207668_10046516 | Ga0207668_100465164 | 357 |
| 183 | 3300025986 | Ga0207658_10004916 | Ga0207658_100049166 | 357 |
| 184 | 3300025986 | Ga0207658_10198610 | Ga0207658_101986102 | 357 |
| 185 | 3300026023 | Ga0207677_10277685 | Ga0207677_102776851 | 357 |
| 186 | 3300026035 | Ga0207703_10000292 | Ga0207703_1000029211 | 357 |
| 187 | 3300026035 | Ga0207703_10227027 | Ga0207703_102270272 | 357 |
| 188 | 3300026088 | Ga0207641_10001774 | Ga0207641_100017743 | 357 |
| 189 | 3300026088 | Ga0207641_10125129 | Ga0207641_101251293 | 357 |
| 190 | 3300026089 | Ga0207648_10007170 | Ga0207648_1000717010 | 357 |
| 191 | 3300026089 | Ga0207648_10025374 | Ga0207648_100253743 | 357 |
| 192 | 3300026095 | Ga0207676_10001693 | Ga0207676_100016937 | 357 |
| 193 | 3300026116 | Ga0207674_10007473 | Ga0207674_1000747310 | 357 |
| 194 | 3300026118 | Ga0207675_100001077 | Ga0207675_10000107714 | 357 |
| 195 | 3300027695 | Ga0209966_1007653 | Ga0209966_10076532 | 357 |
| 196 | 3300028381 | Ga0268264_10000862 | Ga0268264_1000086214 | 357 |
| 197 | 3300028381 | Ga0268264_10100830 | Ga0268264_101008302 | 357 |
| 198 | 3300031250 | Ga0265331_10000109 | Ga0265331_1000010974 | 357 |
| 199 | 3300031251 | Ga0265327_10000243 | Ga0265327_1000024323 | 357 |
| 200 | 3300031548 | Ga0307408_100024130 | Ga0307408_1000241304 | 357 |
| 201 | 3300031665 | Ga0316575_10001724 | Ga0316575_100017249 | 357 |
| 202 | 3300031728 | Ga0316578_10030192 | Ga0316578_100301923 | 357 |
| 203 | 3300031731 | Ga0307405_10000758 | Ga0307405_1000075810 | 357 |
| 204 | 3300031733 | Ga0316577_10029203 | Ga0316577_100292032 | 357 |
| 205 | 3300031733 | Ga0316577_10136563 | Ga0316577_101365631 | 357 |
| 206 | 3300031852 | Ga0307410_10013716 | Ga0307410_100137162 | 357 |
| 207 | 3300031901 | Ga0307406_10008674 | Ga0307406_100086742 | 357 |
| 208 | 3300031903 | Ga0307407_10000533 | Ga0307407_100005332 | 357 |
| 209 | 3300031911 | Ga0307412_10003563 | Ga0307412_100035632 | 357 |
| 210 | 3300031995 | Ga0307409_100000533 | Ga0307409_1000005331 | 357 |
| 211 | 3300032002 | Ga0307416_100000164 | Ga0307416_10000016439 | 357 |
| 212 | 3300032004 | Ga0307414_10023267 | Ga0307414_100232673 | 357 |
| 213 | 3300032005 | Ga0307411_10001297 | Ga0307411_100012973 | 357 |
| 214 | 3300032126 | Ga0307415_100001532 | Ga0307415_1000015324 | 357 |
| 215 | 3300032133 | Ga0316583_10000202 | Ga0316583_1000020214 | 357 |
| 216 | 3300035398 | Ga0316574_0000300 | Ga0316574_0000300_3275_4369 | 357 |
| 217 | 3300036647 | Ga0316582_0034132 | Ga0316582_0034132_1916_3010 | 357 |
| 218 | 3300036647 | Ga0316582_0048964 | Ga0316582_0048964_173_1267 | 357 |
| 219 | 3300036712 | Ga0316584_0014484 | Ga0316584_0014484_1405_2499 | 357 |
| 220 | 3300036712 | Ga0316584_0140749 | Ga0316584_0140749_418_1512 | 357 |
| 221 | 3300038726 | Ga0400490_02841 | Ga0400490_02841_5158_6237 | 357 |
| 222 | 3300038735 | Ga0400485_07884 | Ga0400485_07884_40154_41245 | 357 |
| 223 | 3300038741 | Ga0400488_62074 | Ga0400488_62074_5123_6214 | 357 |
| 224 | 3300038742 | Ga0400486_28685 | Ga0400486_28685_81848_82939 | 357 |
| 225 | 3300039110 | Ga0400487_27243 | Ga0400487_27243_12181_13272 | 357 |
| 226 | 3300045051 | Ga0451576_0220014 | Ga0451576_0220014_646_1728 | 357 |
| 227 | 3300048905 | Ga0496102_0064381 | Ga0496102_0064381_1407_2492 | 357 |
| 228 | 3300048911 | Ga0496108_0031826 | Ga0496108_0031826_2362_3447 | 357 |
| 229 | 3300048912 | Ga0496109_0010882 | Ga0496109_0010882_5678_6763 | 357 |
| 230 | 3300049575 | Ga0501039_0091569 | Ga0501039_0091569_144_1262 | 357 |
| 231 | 3300050493 | nmdc:mga0k408_18791_c1 | nmdc:mga0k408_18791_c1_1480_2559 | 357 |
| 232 | 3300050509 | nmdc:mga0qj67_61842_c1 | nmdc:mga0qj67_61842_c1_505_1614 | 357 |
| 233 | 3300050512 | nmdc:mga0n895_30931_c1 | nmdc:mga0n895_30931_c1_57_1196 | 357 |
| 234 | iso_pu_bacteria | 2920107658 | 2920108518 | 357 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3can-assembly1.cif.gz_A-2 | crystal structure of a domain of pyruvate-formate lyase-activating enzyme from bacteroides vulgatus atcc 8482 | 0.8899 | 124 | 289 |
| 3can-assembly1.cif.gz_A-2 | crystal structure of a domain of pyruvate-formate lyase-activating enzyme from bacteroides vulgatus atcc 8482 | 0.8746 | 124 | 289 |
| 8fsi-assembly1.cif.gz_A | the structure of a crystallizable variant of e. coli pyruvate formate-lyase activating enzyme bound to sam | 0.8219 | 72 | 285 |
| 3cb8-assembly1.cif.gz_A | 4fe-4s-pyruvate formate-lyase activating enzyme in complex with adomet and a peptide substrate | 0.8029 | 51 | 286 |
| 3cb8-assembly1.cif.gz_A | 4fe-4s-pyruvate formate-lyase activating enzyme in complex with adomet and a peptide substrate | 0.7757 | 51 | 286 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P95188_67_289_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9565 | 64 | 285 | 3.20.20.70 |
| af_P95188_67_289_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9482 | 64 | 285 | 3.20.20.70 |
| af_Q58218_60_281_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9176 | 62 | 286 | 3.20.20.70 |
| af_Q58218_60_281_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9097 | 62 | 286 | 3.20.20.70 |
| 3canA00 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;pyruvate-formate lyase- activating enzyme | 0.8759 | 124 | 289 | 3.80.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1V3XT04-F1-model_v4 | Putative pYRUVATE FORMATE LYASE ACTIVATING PROTEIN PFLA | 0.9981 | 158 | 272 |
GO:0016829
GO:0046872 GO:0051539 |
| AF-A0A6I7WCS7-F1-model_v4 | Radical SAM protein | 0.9968 | 205 | 306 |
GO:0046872
GO:0051539 |
| AF-A7BUD1-F1-model_v4 | deleted | 0.9872 | 143 | 355 |
|
| AF-A0A7X6UPZ0-F1-model_v4 | Radical SAM protein | 0.9826 | 157 | 336 |
GO:0046872
GO:0051539 |
| AF-A0A533YLT6-F1-model_v4 | AmmeMemoRadiSam system radical SAM enzyme | 0.9819 | 180 | 353 |
GO:0046872
GO:0051539 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar