F347288

General Info

Members Datasets Scaffolds Average Seq Length
234 158 233 359

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0078655|Ga0373937_0078655_1634_2719
Length 343
Sequence MERGPVIPTSYWHRLEDGRIQCDVCPRFCTLREGQRGLCFVRAREGERIVLTTYGRSSGFCVDPIEKKPLHHFLPGTAVLSFGTEGCNLSCKFCQNWDISKSREIAKLADEAPPGRIARAAKELGCRSVAFTYNDPTIFFEYAAGYMCPEPRAEFYRHIDAANVDLKAFTEKFYWEITGAHLQPVLDTLVYLKTQTRVWLELTNLLIPGHNDSDKELAAMTRWVVDNLGRDVPMHFTAFHPDWKMLDVPPTPAATLSRARRIALKAGVRYAYTGNVRDPDGGSTFCHVCAAEVIGRDGYEITEWNLDHGRCAVCGEPCPGVFEERPGQWGERRLPVRLRDFAA

Samples

Sample ID Description Type Environment
1 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
76 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
80 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
93 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
101 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
104 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
105 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
106 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
107 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
108 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
109 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
110 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
111 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
148 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
157 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 1.71
Rhizosphere 88.03
Stem 0
Stem Tuber 0
Unclassified 9.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10142158 3300005293 Bacteria 1838
2 Ga0070670_100000274 3300005331 Bacteria 45804
3 Ga0070670_100078294 3300005331 Bacteria 2840
4 Ga0070670_100131068 3300005331 Bacteria 2165
5 Ga0068869_100002759 3300005334 Bacteria 10636
6 Ga0068869_100004100 3300005334 Bacteria 9026
7 Ga0070666_10217156 3300005335 Bacteria 1348
8 Ga0070668_100013298 3300005347 Bacteria 6142
9 Ga0070668_100014299 3300005347 Bacteria 5931
10 Ga0070668_100015146 3300005347 Bacteria 5762
11 Ga0070669_100038278 3300005353 Bacteria 3482
12 Ga0070669_100042306 3300005353 Bacteria 3315
13 Ga0070675_100005416 3300005354 Bacteria 9760
14 Ga0070675_100099672 3300005354 Bacteria 2446
15 Ga0070673_100002101 3300005364 Bacteria 12033
16 Ga0070673_100126808 3300005364 Bacteria 2137
17 Ga0070667_100009280 3300005367 Bacteria 8151
18 Ga0070667_100062715 3300005367 Bacteria 3149
19 Ga0070714_100350319 3300005435 Bacteria 1387
20 Ga0070713_100008625 3300005436 Bacteria 7242
21 Ga0070678_100149444 3300005456 Bacteria 1880
22 Ga0070662_100150962 3300005457 Bacteria 1809
23 Ga0068867_100034470 3300005459 Bacteria 3668
24 Ga0070706_100000988 3300005467 Bacteria 30963
25 Ga0070707_100000931 3300005468 Bacteria 29052
26 Ga0070696_100162763 3300005546 Bacteria 1645
27 Ga0068855_100044952 3300005563 Bacteria 5225
28 Ga0068857_100003534 3300005577 Bacteria 13063
29 Ga0068852_100479757 3300005616 Bacteria 1235
30 Ga0068859_100002792 3300005617 Bacteria 17696
31 Ga0068859_100149608 3300005617 Bacteria 2410
32 Ga0068859_100346276 3300005617 Bacteria 1581
33 Ga0068864_100008382 3300005618 Bacteria 8528
34 Ga0068861_100004435 3300005719 Bacteria 9417
35 Ga0068861_100375293 3300005719 Bacteria 1255
36 Ga0068870_10026170 3300005840 Bacteria 2906
37 Ga0068863_100002691 3300005841 Bacteria 17567
38 Ga0068863_100104500 3300005841 Bacteria 2694
39 Ga0068858_100000345 3300005842 Bacteria 49147
40 Ga0068858_100126493 3300005842 Bacteria 2394
41 Ga0068860_100001723 3300005843 Bacteria 23333
42 Ga0068860_100043743 3300005843 Bacteria 4270
43 Ga0068862_100008744 3300005844 Bacteria 8383
44 Ga0068862_100128747 3300005844 Bacteria 2237
45 Ga0070716_100053519 3300006173 Bacteria 2302
46 Ga0070712_100003787 3300006175 Bacteria 9314
47 Ga0075366_10041794 3300006195 Bacteria 2714
48 Ga0068871_100040809 3300006358 Bacteria 3718
49 Ga0075430_100238410 3300006846 Bacteria 1507
50 Ga0075436_100030924 3300006914 Bacteria 3685
51 Ga0097620_100002792 3300006931 Bacteria 17696
52 Ga0097620_100149601 3300006931 Bacteria 2410
53 Ga0097620_100346262 3300006931 Bacteria 1581
54 Ga0105247_10032173 3300009101 Bacteria 3187
55 Ga0114129_10090478 3300009147 Bacteria 4242
56 Ga0105248_10035918 3300009177 Bacteria 5543
57 Ga0105248_10231560 3300009177 Bacteria 2080
58 Ga0105248_10437125 3300009177 Bacteria 1474
59 Ga0105246_10163691 3300011119 Bacteria 1697
60 Ga0157374_10358161 3300013296 Bacteria 1450
61 Ga0157378_10035469 3300013297 Bacteria 4412
62 Ga0163162_10067799 3300013306 Bacteria 3619
63 Ga0157375_10016898 3300013308 Bacteria 6572
64 Ga0157375_10043527 3300013308 Bacteria 4355
65 Ga0163163_10002386 3300014325 Bacteria 15903
66 Ga0163163_10179598 3300014325 Bacteria 2164
67 Ga0157379_10000443 3300014968 Bacteria 33618
68 Ga0157376_10022624 3300014969 Bacteria 4904
69 Ga0213872_10002051 3300021361 Bacteria 12229
70 Ga0207656_10052565 3300025321 Bacteria 1765
71 Ga0207642_10090814 3300025899 Bacteria 1508
72 Ga0207684_10000507 3300025910 Bacteria 48732
73 Ga0207693_10005537 3300025915 Bacteria 10506
74 Ga0207681_10000026 3300025923 Bacteria 194056
75 Ga0207681_10007147 3300025923 Bacteria 6847
76 Ga0207681_10043114 3300025923 Bacteria 3018
77 Ga0207650_10005657 3300025925 Bacteria 8537
78 Ga0207650_10245256 3300025925 Bacteria 1449
79 Ga0207659_10005626 3300025926 Bacteria 7618
80 Ga0207664_10045356 3300025929 Bacteria 3447
81 Ga0207691_10335890 3300025940 Bacteria 1294
82 Ga0207711_10002732 3300025941 Bacteria 15558
83 Ga0207711_10236473 3300025941 Bacteria 1674
84 Ga0207689_10003883 3300025942 Bacteria 13618
85 Ga0207689_10008166 3300025942 Bacteria 9125
86 Ga0207667_10168277 3300025949 Bacteria 2253
87 Ga0207651_10056461 3300025960 Bacteria 2702
88 Ga0207668_10001594 3300025972 Bacteria 13247
89 Ga0207668_10046516 3300025972 Bacteria 2965
90 Ga0207658_10004916 3300025986 Bacteria 9219
91 Ga0207658_10198610 3300025986 Bacteria 1673
92 Ga0207677_10277685 3300026023 Bacteria 1373
93 Ga0207703_10000292 3300026035 Bacteria 54983
94 Ga0207703_10227027 3300026035 Bacteria 1672
95 Ga0207641_10001774 3300026088 Bacteria 20774
96 Ga0207641_10091998 3300026088 Bacteria 2656
97 Ga0207641_10125129 3300026088 Bacteria 2300
98 Ga0207648_10007170 3300026089 Bacteria 10990
99 Ga0207648_10025374 3300026089 Bacteria 5281
100 Ga0207676_10001693 3300026095 Bacteria 16260
101 Ga0207676_10031407 3300026095 Bacteria 3995
102 Ga0207674_10007473 3300026116 Bacteria 12735
103 Ga0207675_100001077 3300026118 Bacteria 27123
104 Ga0207683_10054600 3300026121 Bacteria 3503
105 Ga0209966_1007653 3300027695 Bacteria 1898
106 Ga0268265_10300384 3300028380 Bacteria 1445
107 Ga0268264_10000862 3300028381 Bacteria 32146
108 Ga0268264_10100830 3300028381 Bacteria 2508
109 Ga0265328_10008905 3300031239 Bacteria 4113
110 Ga0265331_10000109 3300031250 Bacteria 108845
111 Ga0265327_10000243 3300031251 Bacteria 108869
112 Ga0265327_10000512 3300031251 Bacteria 67274
113 Ga0265327_10025794 3300031251 Bacteria 3418
114 Ga0307408_100024130 3300031548 Bacteria 4149
115 Ga0316575_10001724 3300031665 Bacteria 7158
116 Ga0316575_10012260 3300031665 Bacteria 3186
117 Ga0316578_10030192 3300031728 Bacteria 3080
118 Ga0316578_10046893 3300031728 Bacteria 2520
119 Ga0316578_10105811 3300031728 Bacteria 1688
120 Ga0307405_10000758 3300031731 Bacteria 12596
121 Ga0316577_10029203 3300031733 Bacteria 3078
122 Ga0316577_10136563 3300031733 Bacteria 1381
123 Ga0307410_10013716 3300031852 Bacteria 4739
124 Ga0307406_10008674 3300031901 Bacteria 5681
125 Ga0307407_10000533 3300031903 Bacteria 11833
126 Ga0307412_10003563 3300031911 Bacteria 8644
127 Ga0307409_100000533 3300031995 Bacteria 16444
128 Ga0307416_100000164 3300032002 Bacteria 37789
129 Ga0307414_10023267 3300032004 Bacteria 3927
130 Ga0307411_10001297 3300032005 Bacteria 10041
131 Ga0307415_100001532 3300032126 Bacteria 11097
132 Ga0316583_10000202 3300032133 Bacteria 15619
133 Ga0316583_10010547 3300032133 Bacteria 3332
134 Ga0373934_0055424 3300035086 Bacteria 1575
135 Ga0373956_0022646 3300035119 Bacteria 2690
136 Ga0373955_0239349 3300035172 Bacteria 1087
137 Ga0316574_0000300 3300035398 Bacteria 18658
138 Ga0316574_0021065 3300035398 Bacteria 3865
139 Ga0316574_0060755 3300035398 Bacteria 2373
140 Ga0373935_0106692 3300035692 Bacteria 1854
141 Ga0373933_0002044 3300035724 Bacteria 11592
142 Ga0373937_0000868 3300036401 Bacteria 26006
143 Ga0373937_0008787 3300036401 Bacteria 8764
144 Ga0373937_0078655 3300036401 Bacteria 3048
145 Ga0316582_0006869 3300036647 Bacteria 6017
146 Ga0316582_0026994 3300036647 Bacteria 3463
147 Ga0316582_0034132 3300036647 Bacteria 3131
148 Ga0316582_0048964 3300036647 Bacteria 2673
149 Ga0316582_0054957 3300036647 Bacteria 2537
150 Ga0316584_0014484 3300036712 Bacteria 5615
151 Ga0316584_0140749 3300036712 Bacteria 1799
152 Ga0373925_0024457 3300037068 Bacteria 4410
153 Ga0316581_0009727 3300037588 Bacteria 2649
154 Ga0400484_13421 3300038725 Bacteria 33582
155 Ga0400490_00731 3300038726 Bacteria 33699
156 Ga0400490_02841 3300038726 Bacteria 6278
157 Ga0400490_05485 3300038726 Bacteria 73498
158 Ga0400490_19194 3300038726 Bacteria 15214
159 Ga0400491_25846 3300038727 Bacteria 2117
160 Ga0400485_07884 3300038735 Bacteria 123132
161 Ga0400485_16880 3300038735 Bacteria 18572
162 Ga0400488_01902 3300038741 Bacteria 13587
163 Ga0400488_16067 3300038741 Bacteria 4092
164 Ga0400488_28196 3300038741 Bacteria 2075
165 Ga0400488_39297 3300038741 Bacteria 1597
166 Ga0400488_62074 3300038741 Bacteria 18243
167 Ga0400486_15402 3300038742 Bacteria 34536
168 Ga0400486_28685 3300038742 Bacteria 138069
169 Ga0400483_108103 3300039062 Bacteria 30756
170 Ga0400483_180179 3300039062 Bacteria 29553
171 Ga0400483_198090 3300039062 Bacteria 2292
172 Ga0400483_263075 3300039062 Bacteria 6260
173 Ga0400487_03158 3300039110 Bacteria 8991
174 Ga0400487_08272 3300039110 Bacteria 7289
175 Ga0400487_27243 3300039110 Bacteria 18394
176 Ga0436361_0210067 3300039447 Bacteria 6857
177 Ga0451577_0016302 3300042876 Bacteria 6884
178 Ga0451577_0031737 3300042876 Bacteria 4765
179 Ga0466964_0027379 3300044706 Bacteria 2238
180 Ga0453684_0000341 3300044712 Bacteria 194228
181 Ga0451576_0220014 3300045051 Bacteria 1983
182 Ga0495592_0033667 3300046454 Bacteria 3864
183 Ga0495592_0122551 3300046454 Bacteria 1827
184 Ga0495653_0137756 3300046463 Bacteria 1720
185 Ga0495608_0005156 3300046511 Bacteria 9336
186 Ga0495608_0067552 3300046511 Bacteria 2338
187 Ga0495618_0051585 3300046514 Bacteria 2599
188 Ga0495628_0050165 3300046516 Bacteria 3302
189 Ga0495628_0092956 3300046516 Bacteria 2333
190 Ga0495652_0033430 3300046529 Bacteria 4490
191 Ga0495640_0026962 3300046533 Bacteria 4147
192 Ga0495587_0021075 3300046536 Bacteria 4020
193 Ga0495587_0051618 3300046536 Bacteria 2430
194 Ga0495645_0002431 3300046543 Bacteria 12654
195 Ga0495667_0006307 3300046559 Bacteria 8047
196 Ga0495667_0052984 3300046559 Bacteria 2672
197 Ga0495656_0016923 3300046615 Bacteria 2774
198 Ga0495656_0069141 3300046615 Bacteria 1563
199 Ga0495634_0002869 3300046642 Bacteria 14135
200 Ga0495635_0156720 3300046663 Bacteria 1550
201 Ga0495599_0008806 3300046678 Bacteria 6143
202 Ga0495599_0016189 3300046678 Bacteria 4628
203 Ga0495658_0004009 3300046683 Bacteria 7260
204 Ga0495624_0023452 3300046690 Bacteria 4069
205 Ga0495600_0005281 3300046809 Bacteria 7779
206 Ga0495600_0036389 3300046809 Bacteria 3199
207 Ga0495604_0003865 3300047317 Bacteria 11932
208 Ga0495604_0113117 3300047317 Bacteria 1976
209 Ga0495680_0000735 3300047322 Bacteria 36769
210 Ga0495680_0142851 3300047322 Bacteria 1750
211 Ga0495675_0018691 3300047444 Bacteria 4401
212 Ga0495684_0060588 3300047471 Bacteria 2881
213 Ga0495593_0033904 3300047673 Bacteria 2779
214 Ga0495602_0000963 3300048088 Bacteria 27824
215 Ga0496102_0064381 3300048905 Bacteria 3358
216 Ga0496108_0031826 3300048911 Bacteria 4379
217 Ga0496109_0010882 3300048912 Bacteria 7790
218 Ga0496110_0249701 3300048913 Bacteria 1615
219 Ga0501031_0062801 3300049568 Bacteria 2420
220 Ga0501039_0091569 3300049575 Bacteria 2370
221 Ga0501074_0066839 3300049590 Bacteria 2586
222 Ga0501198_000037 3300049649 Bacteria 52054
223 Ga0501222_000094 3300049662 Bacteria 23733
224 Ga0501079_0031227 3300049741 Bacteria 4094
225 nmdc:mga0k408_18791_c1 3300050493 Bacteria 3859
226 nmdc:mga05p37_241211_c1 3300050507 Bacteria 2173
227 nmdc:mga0qj67_61842_c1 3300050509 Bacteria 2974
228 nmdc:mga0n895_30931_c1 3300050512 Bacteria 5121
229 nmdc:mga08x19_97489_c1 3300050514 Bacteria 1947
230 Ga0495601_0002833 3300053077 Bacteria 9849
231 Ga0495612_0000660 3300053078 Bacteria 13890
232 Ga0495595_0013280 3300053084 Bacteria 3478
233 Ga0501084_0137884 3300054114 Bacteria 2054

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038725 Ga0400484_13421 Ga0400484_13421_32377_33372 315
2 3300038726 Ga0400490_00731 Ga0400490_00731_23968_24927 319
3 3300038727 Ga0400491_25846 Ga0400491_25846_373_1332 319
4 3300038741 Ga0400488_28196 Ga0400488_28196_660_1619 319
5 3300039110 Ga0400487_08272 Ga0400487_08272_5300_6259 319
6 3300046615 Ga0495656_0069141 Ga0495656_0069141_285_1244 319
7 3300036647 Ga0316582_0054957 Ga0316582_0054957_106_1074 321
8 3300042876 Ga0451577_0031737 Ga0451577_0031737_2648_3613 321
9 3300049741 Ga0501079_0031227 Ga0501079_0031227_980_1960 323
10 3300005546 Ga0070696_100162763 Ga0070696_1001627631 324
11 3300009177 Ga0105248_10231560 Ga0105248_102315602 335
12 3300036401 Ga0373937_0078655 Ga0373937_0078655_1634_2719 338
13 3300047317 Ga0495604_0003865 Ga0495604_0003865_1405_2424 339
14 3300048913 Ga0496110_0249701 Ga0496110_0249701_460_1560 340
15 3300046678 Ga0495599_0008806 Ga0495599_0008806_4168_5253 341
16 3300013297 Ga0157378_10035469 Ga0157378_100354695 342
17 3300031239 Ga0265328_10008905 Ga0265328_100089052 343
18 3300031251 Ga0265327_10000512 Ga0265327_1000051234 343
19 3300036401 Ga0373937_0000868 Ga0373937_0000868_19244_20329 343
20 3300037068 Ga0373925_0024457 Ga0373925_0024457_1655_2740 343
21 3300046516 Ga0495628_0050165 Ga0495628_0050165_22_1107 343
22 3300038726 Ga0400490_19194 Ga0400490_19194_9054_10127 345
23 3300038741 Ga0400488_01902 Ga0400488_01902_4834_5919 346
24 3300035172 Ga0373955_0239349 Ga0373955_0239349_19_1068 347
25 3300031728 Ga0316578_10105811 Ga0316578_101058111 348
26 3300035398 Ga0316574_0021065 Ga0316574_0021065_1743_2837 348
27 3300039062 Ga0400483_263075 Ga0400483_263075_2913_3995 349
28 3300049590 Ga0501074_0066839 Ga0501074_0066839_1477_2547 350
29 3300054114 Ga0501084_0137884 Ga0501084_0137884_404_1474 350
30 3300021361 Ga0213872_10002051 Ga0213872_100020517 353
31 3300039447 Ga0436361_0210067 Ga0436361_0210067_3638_4714 353
32 3300005456 Ga0070678_100149444 Ga0070678_1001494442 354
33 3300006175 Ga0070712_100003787 Ga0070712_1000037874 354
34 3300026121 Ga0207683_10054600 Ga0207683_100546003 354
35 3300038726 Ga0400490_05485 Ga0400490_05485_29469_30539 354
36 3300039062 Ga0400483_108103 Ga0400483_108103_10019_11089 354
37 3300039062 Ga0400483_180179 Ga0400483_180179_25682_26752 354
38 3300044712 Ga0453684_0000341 Ga0453684_0000341_160292_161383 354
39 3300005435 Ga0070714_100350319 Ga0070714_1003503191 355
40 3300005436 Ga0070713_100008625 Ga0070713_1000086254 355
41 3300025915 Ga0207693_10005537 Ga0207693_100055376 355
42 3300025929 Ga0207664_10045356 Ga0207664_100453562 355
43 3300031665 Ga0316575_10012260 Ga0316575_100122603 355
44 3300031728 Ga0316578_10046893 Ga0316578_100468932 355
45 3300035086 Ga0373934_0055424 Ga0373934_0055424_233_1321 355
46 3300035119 Ga0373956_0022646 Ga0373956_0022646_1380_2468 355
47 3300035398 Ga0316574_0060755 Ga0316574_0060755_940_2025 355
48 3300035692 Ga0373935_0106692 Ga0373935_0106692_445_1533 355
49 3300035724 Ga0373933_0002044 Ga0373933_0002044_9893_10981 355
50 3300036401 Ga0373937_0008787 Ga0373937_0008787_144_1211 355
51 3300036647 Ga0316582_0006869 Ga0316582_0006869_1387_2472 355
52 3300036647 Ga0316582_0026994 Ga0316582_0026994_98_1180 355
53 3300037588 Ga0316581_0009727 Ga0316581_0009727_315_1400 355
54 3300038735 Ga0400485_16880 Ga0400485_16880_9798_10871 355
55 3300038741 Ga0400488_16067 Ga0400488_16067_995_2068 355
56 3300038741 Ga0400488_39297 Ga0400488_39297_289_1362 355
57 3300038742 Ga0400486_15402 Ga0400486_15402_13676_14749 355
58 3300039062 Ga0400483_198090 Ga0400483_198090_819_1892 355
59 3300039110 Ga0400487_03158 Ga0400487_03158_3249_4322 355
60 3300042876 Ga0451577_0016302 Ga0451577_0016302_5417_6517 355
61 3300044706 Ga0466964_0027379 Ga0466964_0027379_579_1655 355
62 3300046454 Ga0495592_0033667 Ga0495592_0033667_1808_2875 355
63 3300046454 Ga0495592_0122551 Ga0495592_0122551_712_1800 355
64 3300046463 Ga0495653_0137756 Ga0495653_0137756_308_1396 355
65 3300046511 Ga0495608_0005156 Ga0495608_0005156_15_1091 355
66 3300046511 Ga0495608_0067552 Ga0495608_0067552_660_1748 355
67 3300046514 Ga0495618_0051585 Ga0495618_0051585_1381_2448 355
68 3300046516 Ga0495628_0092956 Ga0495628_0092956_629_1717 355
69 3300046529 Ga0495652_0033430 Ga0495652_0033430_1132_2220 355
70 3300046533 Ga0495640_0026962 Ga0495640_0026962_3040_4128 355
71 3300046536 Ga0495587_0021075 Ga0495587_0021075_2163_3251 355
72 3300046536 Ga0495587_0051618 Ga0495587_0051618_878_1945 355
73 3300046543 Ga0495645_0002431 Ga0495645_0002431_8324_9412 355
74 3300046559 Ga0495667_0006307 Ga0495667_0006307_3112_4200 355
75 3300046559 Ga0495667_0052984 Ga0495667_0052984_1234_2322 355
76 3300046615 Ga0495656_0016923 Ga0495656_0016923_184_1260 355
77 3300046642 Ga0495634_0002869 Ga0495634_0002869_13023_14090 355
78 3300046663 Ga0495635_0156720 Ga0495635_0156720_377_1465 355
79 3300046678 Ga0495599_0016189 Ga0495599_0016189_1813_2880 355
80 3300046683 Ga0495658_0004009 Ga0495658_0004009_3526_4593 355
81 3300046690 Ga0495624_0023452 Ga0495624_0023452_2418_3485 355
82 3300046809 Ga0495600_0005281 Ga0495600_0005281_4805_5872 355
83 3300046809 Ga0495600_0036389 Ga0495600_0036389_794_1882 355
84 3300047317 Ga0495604_0113117 Ga0495604_0113117_830_1918 355
85 3300047322 Ga0495680_0000735 Ga0495680_0000735_3274_4341 355
86 3300047322 Ga0495680_0142851 Ga0495680_0142851_596_1684 355
87 3300047444 Ga0495675_0018691 Ga0495675_0018691_3116_4204 355
88 3300047471 Ga0495684_0060588 Ga0495684_0060588_1757_2845 355
89 3300047673 Ga0495593_0033904 Ga0495593_0033904_180_1247 355
90 3300048088 Ga0495602_0000963 Ga0495602_0000963_7657_8745 355
91 3300049649 Ga0501198_000037 Ga0501198_000037_14244_15320 355
92 3300049662 Ga0501222_000094 Ga0501222_000094_14244_15320 355
93 3300053077 Ga0495601_0002833 Ga0495601_0002833_4465_5553 355
94 3300053078 Ga0495612_0000660 Ga0495612_0000660_8329_9417 355
95 3300053084 Ga0495595_0013280 Ga0495595_0013280_1504_2592 355
96 3300005331 Ga0070670_100131068 Ga0070670_1001310682 356
97 3300005347 Ga0070668_100015146 Ga0070668_1000151461 356
98 3300005719 Ga0068861_100375293 Ga0068861_1003752931 356
99 3300005841 Ga0068863_100104500 Ga0068863_1001045002 356
100 3300005843 Ga0068860_100043743 Ga0068860_1000437435 356
101 3300005844 Ga0068862_100128747 Ga0068862_1001287473 356
102 3300006914 Ga0075436_100030924 Ga0075436_1000309244 356
103 3300009147 Ga0114129_10090478 Ga0114129_100904783 356
104 3300025925 Ga0207650_10245256 Ga0207650_102452562 356
105 3300025940 Ga0207691_10335890 Ga0207691_103358901 356
106 3300026088 Ga0207641_10091998 Ga0207641_100919982 356
107 3300026095 Ga0207676_10031407 Ga0207676_100314074 356
108 3300028380 Ga0268265_10300384 Ga0268265_103003842 356
109 3300031251 Ga0265327_10025794 Ga0265327_100257942 356
110 3300032133 Ga0316583_10010547 Ga0316583_100105474 356
111 3300049568 Ga0501031_0062801 Ga0501031_0062801_1309_2382 356
112 3300050507 nmdc:mga05p37_241211_c1 nmdc:mga05p37_241211_c1_489_1562 356
113 3300050514 nmdc:mga08x19_97489_c1 nmdc:mga08x19_97489_c1_406_1479 356
114 3300005293 Ga0065715_10142158 Ga0065715_101421582 357
115 3300005331 Ga0070670_100000274 Ga0070670_10000027440 357
116 3300005331 Ga0070670_100078294 Ga0070670_1000782943 357
117 3300005334 Ga0068869_100002759 Ga0068869_1000027592 357
118 3300005334 Ga0068869_100004100 Ga0068869_1000041009 357
119 3300005335 Ga0070666_10217156 Ga0070666_102171562 357
120 3300005347 Ga0070668_100013298 Ga0070668_1000132985 357
121 3300005347 Ga0070668_100014299 Ga0070668_1000142995 357
122 3300005353 Ga0070669_100038278 Ga0070669_1000382782 357
123 3300005353 Ga0070669_100042306 Ga0070669_1000423064 357
124 3300005354 Ga0070675_100005416 Ga0070675_1000054166 357
125 3300005354 Ga0070675_100099672 Ga0070675_1000996722 357
126 3300005364 Ga0070673_100002101 Ga0070673_1000021015 357
127 3300005364 Ga0070673_100126808 Ga0070673_1001268081 357
128 3300005367 Ga0070667_100009280 Ga0070667_10000928010 357
129 3300005367 Ga0070667_100062715 Ga0070667_1000627152 357
130 3300005457 Ga0070662_100150962 Ga0070662_1001509622 357
131 3300005459 Ga0068867_100034470 Ga0068867_1000344704 357
132 3300005467 Ga0070706_100000988 Ga0070706_10000098820 357
133 3300005468 Ga0070707_100000931 Ga0070707_10000093120 357
134 3300005563 Ga0068855_100044952 Ga0068855_1000449523 357
135 3300005577 Ga0068857_100003534 Ga0068857_1000035346 357
136 3300005616 Ga0068852_100479757 Ga0068852_1004797572 357
137 3300005617 Ga0068859_100002792 Ga0068859_10000279215 357
138 3300005617 Ga0068859_100149608 Ga0068859_1001496082 357
139 3300005617 Ga0068859_100346276 Ga0068859_1003462762 357
140 3300005618 Ga0068864_100008382 Ga0068864_1000083826 357
141 3300005719 Ga0068861_100004435 Ga0068861_1000044353 357
142 3300005840 Ga0068870_10026170 Ga0068870_100261703 357
143 3300005841 Ga0068863_100002691 Ga0068863_10000269118 357
144 3300005842 Ga0068858_100000345 Ga0068858_10000034532 357
145 3300005842 Ga0068858_100126493 Ga0068858_1001264932 357
146 3300005843 Ga0068860_100001723 Ga0068860_10000172320 357
147 3300005844 Ga0068862_100008744 Ga0068862_1000087444 357
148 3300006173 Ga0070716_100053519 Ga0070716_1000535192 357
149 3300006195 Ga0075366_10041794 Ga0075366_100417943 357
150 3300006358 Ga0068871_100040809 Ga0068871_1000408093 357
151 3300006846 Ga0075430_100238410 Ga0075430_1002384101 357
152 3300006931 Ga0097620_100002792 Ga0097620_1000027924 357
153 3300006931 Ga0097620_100149601 Ga0097620_1001496012 357
154 3300006931 Ga0097620_100346262 Ga0097620_1003462622 357
155 3300009101 Ga0105247_10032173 Ga0105247_100321733 357
156 3300009177 Ga0105248_10035918 Ga0105248_100359184 357
157 3300009177 Ga0105248_10437125 Ga0105248_104371252 357
158 3300011119 Ga0105246_10163691 Ga0105246_101636912 357
159 3300013296 Ga0157374_10358161 Ga0157374_103581612 357
160 3300013306 Ga0163162_10067799 Ga0163162_100677991 357
161 3300013308 Ga0157375_10016898 Ga0157375_100168984 357
162 3300013308 Ga0157375_10043527 Ga0157375_100435272 357
163 3300014325 Ga0163163_10002386 Ga0163163_1000238611 357
164 3300014325 Ga0163163_10179598 Ga0163163_101795982 357
165 3300014968 Ga0157379_10000443 Ga0157379_100004435 357
166 3300014969 Ga0157376_10022624 Ga0157376_100226248 357
167 3300025321 Ga0207656_10052565 Ga0207656_100525652 357
168 3300025899 Ga0207642_10090814 Ga0207642_100908141 357
169 3300025910 Ga0207684_10000507 Ga0207684_1000050719 357
170 3300025923 Ga0207681_10000026 Ga0207681_1000002658 357
171 3300025923 Ga0207681_10007147 Ga0207681_100071475 357
172 3300025923 Ga0207681_10043114 Ga0207681_100431142 357
173 3300025925 Ga0207650_10005657 Ga0207650_100056576 357
174 3300025926 Ga0207659_10005626 Ga0207659_100056264 357
175 3300025941 Ga0207711_10002732 Ga0207711_100027324 357
176 3300025941 Ga0207711_10236473 Ga0207711_102364732 357
177 3300025942 Ga0207689_10003883 Ga0207689_1000388316 357
178 3300025942 Ga0207689_10008166 Ga0207689_100081669 357
179 3300025949 Ga0207667_10168277 Ga0207667_101682773 357
180 3300025960 Ga0207651_10056461 Ga0207651_100564612 357
181 3300025972 Ga0207668_10001594 Ga0207668_100015944 357
182 3300025972 Ga0207668_10046516 Ga0207668_100465164 357
183 3300025986 Ga0207658_10004916 Ga0207658_100049166 357
184 3300025986 Ga0207658_10198610 Ga0207658_101986102 357
185 3300026023 Ga0207677_10277685 Ga0207677_102776851 357
186 3300026035 Ga0207703_10000292 Ga0207703_1000029211 357
187 3300026035 Ga0207703_10227027 Ga0207703_102270272 357
188 3300026088 Ga0207641_10001774 Ga0207641_100017743 357
189 3300026088 Ga0207641_10125129 Ga0207641_101251293 357
190 3300026089 Ga0207648_10007170 Ga0207648_1000717010 357
191 3300026089 Ga0207648_10025374 Ga0207648_100253743 357
192 3300026095 Ga0207676_10001693 Ga0207676_100016937 357
193 3300026116 Ga0207674_10007473 Ga0207674_1000747310 357
194 3300026118 Ga0207675_100001077 Ga0207675_10000107714 357
195 3300027695 Ga0209966_1007653 Ga0209966_10076532 357
196 3300028381 Ga0268264_10000862 Ga0268264_1000086214 357
197 3300028381 Ga0268264_10100830 Ga0268264_101008302 357
198 3300031250 Ga0265331_10000109 Ga0265331_1000010974 357
199 3300031251 Ga0265327_10000243 Ga0265327_1000024323 357
200 3300031548 Ga0307408_100024130 Ga0307408_1000241304 357
201 3300031665 Ga0316575_10001724 Ga0316575_100017249 357
202 3300031728 Ga0316578_10030192 Ga0316578_100301923 357
203 3300031731 Ga0307405_10000758 Ga0307405_1000075810 357
204 3300031733 Ga0316577_10029203 Ga0316577_100292032 357
205 3300031733 Ga0316577_10136563 Ga0316577_101365631 357
206 3300031852 Ga0307410_10013716 Ga0307410_100137162 357
207 3300031901 Ga0307406_10008674 Ga0307406_100086742 357
208 3300031903 Ga0307407_10000533 Ga0307407_100005332 357
209 3300031911 Ga0307412_10003563 Ga0307412_100035632 357
210 3300031995 Ga0307409_100000533 Ga0307409_1000005331 357
211 3300032002 Ga0307416_100000164 Ga0307416_10000016439 357
212 3300032004 Ga0307414_10023267 Ga0307414_100232673 357
213 3300032005 Ga0307411_10001297 Ga0307411_100012973 357
214 3300032126 Ga0307415_100001532 Ga0307415_1000015324 357
215 3300032133 Ga0316583_10000202 Ga0316583_1000020214 357
216 3300035398 Ga0316574_0000300 Ga0316574_0000300_3275_4369 357
217 3300036647 Ga0316582_0034132 Ga0316582_0034132_1916_3010 357
218 3300036647 Ga0316582_0048964 Ga0316582_0048964_173_1267 357
219 3300036712 Ga0316584_0014484 Ga0316584_0014484_1405_2499 357
220 3300036712 Ga0316584_0140749 Ga0316584_0140749_418_1512 357
221 3300038726 Ga0400490_02841 Ga0400490_02841_5158_6237 357
222 3300038735 Ga0400485_07884 Ga0400485_07884_40154_41245 357
223 3300038741 Ga0400488_62074 Ga0400488_62074_5123_6214 357
224 3300038742 Ga0400486_28685 Ga0400486_28685_81848_82939 357
225 3300039110 Ga0400487_27243 Ga0400487_27243_12181_13272 357
226 3300045051 Ga0451576_0220014 Ga0451576_0220014_646_1728 357
227 3300048905 Ga0496102_0064381 Ga0496102_0064381_1407_2492 357
228 3300048911 Ga0496108_0031826 Ga0496108_0031826_2362_3447 357
229 3300048912 Ga0496109_0010882 Ga0496109_0010882_5678_6763 357
230 3300049575 Ga0501039_0091569 Ga0501039_0091569_144_1262 357
231 3300050493 nmdc:mga0k408_18791_c1 nmdc:mga0k408_18791_c1_1480_2559 357
232 3300050509 nmdc:mga0qj67_61842_c1 nmdc:mga0qj67_61842_c1_505_1614 357
233 3300050512 nmdc:mga0n895_30931_c1 nmdc:mga0n895_30931_c1_57_1196 357
234 iso_pu_bacteria 2920107658 2920108518 357

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

82

147

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3can-assembly1.cif.gz_A-2 crystal structure of a domain of pyruvate-formate lyase-activating enzyme from bacteroides vulgatus atcc 8482 0.8899 124 289
3can-assembly1.cif.gz_A-2 crystal structure of a domain of pyruvate-formate lyase-activating enzyme from bacteroides vulgatus atcc 8482 0.8746 124 289
8fsi-assembly1.cif.gz_A the structure of a crystallizable variant of e. coli pyruvate formate-lyase activating enzyme bound to sam 0.8219 72 285
3cb8-assembly1.cif.gz_A 4fe-4s-pyruvate formate-lyase activating enzyme in complex with adomet and a peptide substrate 0.8029 51 286
3cb8-assembly1.cif.gz_A 4fe-4s-pyruvate formate-lyase activating enzyme in complex with adomet and a peptide substrate 0.7757 51 286
ID Description Score Start End Superfamily
af_P95188_67_289_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9565 64 285 3.20.20.70
af_P95188_67_289_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9482 64 285 3.20.20.70
af_Q58218_60_281_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9176 62 286 3.20.20.70
af_Q58218_60_281_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9097 62 286 3.20.20.70
3canA00 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;pyruvate-formate lyase- activating enzyme 0.8759 124 289 3.80.30.10
ID Description Score Start End GO Terms
AF-A0A1V3XT04-F1-model_v4 Putative pYRUVATE FORMATE LYASE ACTIVATING PROTEIN PFLA 0.9981 158 272 GO:0016829
GO:0046872
GO:0051539
AF-A0A6I7WCS7-F1-model_v4 Radical SAM protein 0.9968 205 306 GO:0046872
GO:0051539
AF-A7BUD1-F1-model_v4 deleted 0.9872 143 355
AF-A0A7X6UPZ0-F1-model_v4 Radical SAM protein 0.9826 157 336 GO:0046872
GO:0051539
AF-A0A533YLT6-F1-model_v4 AmmeMemoRadiSam system radical SAM enzyme 0.9819 180 353 GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
89.97 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map