F347033
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 234 | 174 | 211 | 277 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10119144|Ga0105245_101191442 |
| Length | 302 |
| Sequence | MGAGWSADQLVTDHPHPFTLENPMDHRYATNPQQLSTFDTAELRAQFLVENLFLPGKITACYTHHDRVVLGGAAPAGEPLPLTTFEELRAEFFLANRELGIVNVGGTGTVRAGGDTYTLPNGACLYVGRGTRDVVFSGVPDDQHTPGPQFYFFSAPAHTSYPIQLVLKGQGNALELGDQLTSNRRTLNQYIHPNGIRSCQIMMGVTELHPGSMWNTMPAHTHNRRTECYLYFDIPGDARVIHLLGEPTETRHLVVADRQAVISPSWSIHSGVGTAAYSFVWAMAGENQSFDDMDAAPVDSLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 2 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 3 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 4 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 5 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 6 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 7 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 8 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 9 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 10 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 11 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 12 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 13 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 14 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 15 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 16 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 17 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 18 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 19 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 20 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 21 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 22 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 23 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 24 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 25 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 26 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 99 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 100 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 101 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 102 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 103 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 104 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 105 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 106 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 107 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 108 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 109 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 110 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 111 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 112 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 113 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 114 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 115 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 116 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 117 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 118 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 119 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 120 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 121 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 122 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 123 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 124 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 125 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 126 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 127 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 128 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 138 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 139 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 142 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 143 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 144 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 145 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 146 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 147 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 148 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 166 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 169 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 170 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 171 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 172 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 173 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 174 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.46 |
| Metatranscriptomes | 1.28 |
| Isolates | 10.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.43 |
| Bulb | 0 |
| Endosphere | 5.13 |
| Nodule | 0.85 |
| Rhizoplane | 10.26 |
| Rhizosphere | 71.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10019117 | 3300001989 | Bacteria | 2455 |
| 2 | JGI25152J39213_1000238 | 3300002773 | Bacteria | 36981 |
| 3 | rootH1_10171724 | 3300003316 | Bacteria | 2167 |
| 4 | rootH1_10171724 | 3300003323 | Bacteria | 2796 |
| 5 | rootH1_10053382 | 3300003323 | Unclassified | 2730 |
| 6 | rootH1_10344087 | 3300003323 | Bacteria | 1381 |
| 7 | Ga0065714_10004509 | 3300005288 | Bacteria | 8398 |
| 8 | Ga0065707_10100867 | 3300005295 | Bacteria | 2899 |
| 9 | Ga0070683_100108881 | 3300005329 | Bacteria | 2613 |
| 10 | Ga0070670_100156445 | 3300005331 | Bacteria | 1974 |
| 11 | Ga0068869_100193711 | 3300005334 | Bacteria | 1600 |
| 12 | Ga0068869_100207378 | 3300005334 | Unclassified | 1548 |
| 13 | Ga0070682_100062290 | 3300005337 | Bacteria | 2362 |
| 14 | Ga0070660_100336749 | 3300005339 | Bacteria | 1241 |
| 15 | Ga0070674_100052983 | 3300005356 | Bacteria | 2800 |
| 16 | Ga0070673_100104341 | 3300005364 | Bacteria | 2340 |
| 17 | Ga0070701_10183738 | 3300005438 | Unclassified | 1226 |
| 18 | Ga0070705_100028293 | 3300005440 | Bacteria | 3068 |
| 19 | Ga0070685_10160190 | 3300005466 | Bacteria | 1433 |
| 20 | Ga0070698_100000195 | 3300005471 | Bacteria | 58013 |
| 21 | Ga0070698_100011431 | 3300005471 | Bacteria | 9418 |
| 22 | Ga0068853_100323469 | 3300005539 | Bacteria | 1430 |
| 23 | Ga0070686_100146755 | 3300005544 | Bacteria | 1648 |
| 24 | Ga0070696_100319272 | 3300005546 | Bacteria | 1195 |
| 25 | Ga0070693_100120119 | 3300005547 | Bacteria | 1629 |
| 26 | Ga0068856_100424242 | 3300005614 | Bacteria | 1350 |
| 27 | Ga0068852_100584799 | 3300005616 | Bacteria | 1120 |
| 28 | Ga0068859_100039542 | 3300005617 | Bacteria | 4732 |
| 29 | Ga0068859_100792619 | 3300005617 | Bacteria | 1035 |
| 30 | Ga0068861_100227326 | 3300005719 | Unclassified | 1580 |
| 31 | Ga0068863_100038628 | 3300005841 | Bacteria | 4541 |
| 32 | Ga0068863_100405683 | 3300005841 | Bacteria | 1334 |
| 33 | Ga0068858_100491160 | 3300005842 | Bacteria | 1185 |
| 34 | Ga0081455_10001155 | 3300005937 | Bacteria | 33093 |
| 35 | Ga0075364_10148570 | 3300006051 | Bacteria | 1579 |
| 36 | Ga0075366_10050396 | 3300006195 | Bacteria | 2472 |
| 37 | Ga0075366_10072536 | 3300006195 | Bacteria | 2051 |
| 38 | Ga0075428_100036101 | 3300006844 | Bacteria | 5446 |
| 39 | Ga0075429_100010148 | 3300006880 | Bacteria | 8158 |
| 40 | Ga0097620_100792592 | 3300006931 | Bacteria | 1035 |
| 41 | Ga0079104_1022867 | 3300006946 | Bacteria | 1674 |
| 42 | Ga0105245_10119144 | 3300009098 | Bacteria | 2464 |
| 43 | Ga0105243_10046289 | 3300009148 | Bacteria | 3421 |
| 44 | Ga0105243_10072744 | 3300009148 | Bacteria | 2783 |
| 45 | Ga0105242_10018251 | 3300009176 | Bacteria | 5483 |
| 46 | Ga0105249_10002170 | 3300009553 | Bacteria | 16996 |
| 47 | Ga0105249_10027554 | 3300009553 | Bacteria | 5127 |
| 48 | Ga0105249_10146310 | 3300009553 | Unclassified | 2271 |
| 49 | Ga0105249_10220070 | 3300009553 | Bacteria | 1868 |
| 50 | Ga0105249_10488493 | 3300009553 | Bacteria | 1275 |
| 51 | Ga0105239_10117548 | 3300010375 | Bacteria | 2951 |
| 52 | Ga0105246_10121395 | 3300011119 | Bacteria | 1937 |
| 53 | Ga0105246_10300032 | 3300011119 | Bacteria | 1296 |
| 54 | Ga0105246_10315691 | 3300011119 | Unclassified | 1268 |
| 55 | Ga0157370_10396767 | 3300013104 | Bacteria | 1270 |
| 56 | Ga0157369_10000337 | 3300013105 | Bacteria | 62293 |
| 57 | Ga0157369_10126375 | 3300013105 | Bacteria | 2711 |
| 58 | Ga0157369_10206662 | 3300013105 | Bacteria | 2059 |
| 59 | Ga0171462_1002 | 3300013250 | Bacteria | 1052134 |
| 60 | Ga0157378_10061969 | 3300013297 | Bacteria | 3340 |
| 61 | Ga0157378_10689909 | 3300013297 | Bacteria | 1040 |
| 62 | Ga0163162_10056056 | 3300013306 | Bacteria | 3970 |
| 63 | Ga0163162_10072204 | 3300013306 | Bacteria | 3506 |
| 64 | Ga0163162_10231636 | 3300013306 | Bacteria | 1977 |
| 65 | Ga0163162_10269067 | 3300013306 | Bacteria | 1836 |
| 66 | Ga0163162_10306845 | 3300013306 | Bacteria | 1719 |
| 67 | Ga0157372_10123819 | 3300013307 | Bacteria | 2972 |
| 68 | Ga0157375_10895130 | 3300013308 | Bacteria | 1032 |
| 69 | Ga0157380_10036878 | 3300014326 | Bacteria | 3786 |
| 70 | Ga0157380_10114738 | 3300014326 | Bacteria | 2271 |
| 71 | Ga0157380_10185086 | 3300014326 | Bacteria | 1833 |
| 72 | Ga0157380_10400458 | 3300014326 | Bacteria | 1302 |
| 73 | Ga0157377_10036919 | 3300014745 | Bacteria | 2690 |
| 74 | Ga0157376_10535257 | 3300014969 | Bacteria | 1157 |
| 75 | Ga0163161_10107457 | 3300017792 | Bacteria | 2083 |
| 76 | Ga0163161_10117693 | 3300017792 | Bacteria | 1993 |
| 77 | Ga0163161_10155574 | 3300017792 | Bacteria | 1740 |
| 78 | Ga0206351_10505233 | 3300020077 | Bacteria | 1748 |
| 79 | Ga0206353_10681359 | 3300020082 | Bacteria | 5643 |
| 80 | Ga0206353_11158319 | 3300020082 | Bacteria | 4137 |
| 81 | Ga0209677_101970 | 3300025253 | Bacteria | 8170 |
| 82 | Ga0209129_1000067 | 3300025258 | Bacteria | 219974 |
| 83 | Ga0209025_1000226 | 3300025294 | Bacteria | 132801 |
| 84 | Ga0207642_10044212 | 3300025899 | Bacteria | 1970 |
| 85 | Ga0207647_10002199 | 3300025904 | Bacteria | 14870 |
| 86 | Ga0207643_10014334 | 3300025908 | Bacteria | 4303 |
| 87 | Ga0207705_10104572 | 3300025909 | Bacteria | 2086 |
| 88 | Ga0207662_10011696 | 3300025918 | Bacteria | 4875 |
| 89 | Ga0207652_10186660 | 3300025921 | Bacteria | 1864 |
| 90 | Ga0207646_10479261 | 3300025922 | Bacteria | 1122 |
| 91 | Ga0207650_10085173 | 3300025925 | Bacteria | 2404 |
| 92 | Ga0207650_10155933 | 3300025925 | Bacteria | 1806 |
| 93 | Ga0207686_10000590 | 3300025934 | Bacteria | 22687 |
| 94 | Ga0207709_10035056 | 3300025935 | Bacteria | 2964 |
| 95 | Ga0207709_10060408 | 3300025935 | Bacteria | 2363 |
| 96 | Ga0207670_10136957 | 3300025936 | Bacteria | 1801 |
| 97 | Ga0207669_10042404 | 3300025937 | Bacteria | 2656 |
| 98 | Ga0207669_10260069 | 3300025937 | Bacteria | 1298 |
| 99 | Ga0207691_10117572 | 3300025940 | Bacteria | 2359 |
| 100 | Ga0207651_10146239 | 3300025960 | Bacteria | 1833 |
| 101 | Ga0207712_10032722 | 3300025961 | Bacteria | 3511 |
| 102 | Ga0207712_10215317 | 3300025961 | Bacteria | 1532 |
| 103 | Ga0207668_10245674 | 3300025972 | Bacteria | 1451 |
| 104 | Ga0207639_10210700 | 3300026041 | Bacteria | 1673 |
| 105 | Ga0207678_10050689 | 3300026067 | Bacteria | 3586 |
| 106 | Ga0207708_10040225 | 3300026075 | Bacteria | 3564 |
| 107 | Ga0207641_10000678 | 3300026088 | Bacteria | 36861 |
| 108 | Ga0209281_1014431 | 3300027111 | Bacteria | 1672 |
| 109 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 110 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 111 | Ga0307512_10227821 | 3300030522 | Bacteria | 963 |
| 112 | Ga0265327_10000159 | 3300031251 | Bacteria | 145537 |
| 113 | Ga0307408_100021010 | 3300031548 | Bacteria | 4413 |
| 114 | Ga0307408_100097795 | 3300031548 | Bacteria | 2230 |
| 115 | Ga0307408_100218251 | 3300031548 | Bacteria | 1555 |
| 116 | Ga0307408_100226765 | 3300031548 | Bacteria | 1528 |
| 117 | Ga0307405_10218668 | 3300031731 | Bacteria | 1396 |
| 118 | Ga0307405_10479650 | 3300031731 | Bacteria | 992 |
| 119 | Ga0307413_10010417 | 3300031824 | Bacteria | 4509 |
| 120 | Ga0307410_10009663 | 3300031852 | Bacteria | 5423 |
| 121 | Ga0307406_10072749 | 3300031901 | Bacteria | 2258 |
| 122 | Ga0307412_10011029 | 3300031911 | Bacteria | 5221 |
| 123 | Ga0307409_100130421 | 3300031995 | Bacteria | 2147 |
| 124 | Ga0307409_100175407 | 3300031995 | Bacteria | 1891 |
| 125 | Ga0307409_100290529 | 3300031995 | Bacteria | 1516 |
| 126 | Ga0307416_100005566 | 3300032002 | Bacteria | 7758 |
| 127 | Ga0307416_100011309 | 3300032002 | Bacteria | 5940 |
| 128 | Ga0307415_100233692 | 3300032126 | Bacteria | 1482 |
| 129 | Ga0316574_0185578 | 3300035398 | Bacteria | 1338 |
| 130 | Ga0395900_0054730 | 3300037418 | Bacteria | 4108 |
| 131 | Ga0395900_0249360 | 3300037418 | Bacteria | 1777 |
| 132 | Ga0395901_0306058 | 3300038443 | Bacteria | 1647 |
| 133 | Ga0451789_0188137 | 3300041443 | Bacteria | 2056 |
| 134 | Ga0451791_1825768 | 3300041451 | Bacteria | 3406 |
| 135 | Ga0451793_0256894 | 3300041452 | Bacteria | 17378 |
| 136 | Ga0451797_0766943 | 3300041453 | Bacteria | 4873 |
| 137 | Ga0451795_0029673 | 3300041456 | Bacteria | 3905 |
| 138 | Ga0451807_1349404 | 3300041486 | Bacteria | 2279 |
| 139 | Ga0451833_0630732 | 3300041491 | Bacteria | 1013 |
| 140 | Ga0451837_1599535 | 3300041494 | Bacteria | 1651 |
| 141 | Ga0451853_1272470 | 3300041512 | Bacteria | 1309 |
| 142 | Ga0451853_3259773 | 3300041512 | Bacteria | 1809 |
| 143 | Ga0439449_0004925 | 3300042007 | Bacteria | 5142 |
| 144 | Ga0439435_0042138 | 3300042436 | Bacteria | 1281 |
| 145 | Ga0453683_0283017 | 3300044673 | Bacteria | 1059 |
| 146 | Ga0466968_0007385 | 3300044735 | Bacteria | 4177 |
| 147 | Ga0451576_0028416 | 3300045051 | Bacteria | 5991 |
| 148 | Ga0495638_0027825 | 3300046460 | Bacteria | 3657 |
| 149 | Ga0495641_0040351 | 3300046461 | Bacteria | 2171 |
| 150 | Ga0495621_0015349 | 3300046539 | Bacteria | 2442 |
| 151 | Ga0495625_0235192 | 3300046660 | Bacteria | 1195 |
| 152 | Ga0495646_0195924 | 3300046680 | Bacteria | 1102 |
| 153 | Ga0495672_0004265 | 3300047320 | Bacteria | 11805 |
| 154 | Ga0495686_0017519 | 3300047472 | Bacteria | 4822 |
| 155 | Ga0495686_0054747 | 3300047472 | Bacteria | 2497 |
| 156 | Ga0495593_0142529 | 3300047673 | Bacteria | 1214 |
| 157 | Ga0496101_0104144 | 3300048904 | Bacteria | 2128 |
| 158 | Ga0496102_0002464 | 3300048905 | Bacteria | 15786 |
| 159 | Ga0496102_0215045 | 3300048905 | Bacteria | 1812 |
| 160 | Ga0496104_0022274 | 3300048907 | Bacteria | 5820 |
| 161 | Ga0496108_0043058 | 3300048911 | Bacteria | 3770 |
| 162 | Ga0496108_0520792 | 3300048911 | Bacteria | 1038 |
| 163 | Ga0496109_0038316 | 3300048912 | Bacteria | 4333 |
| 164 | Ga0496109_0134868 | 3300048912 | Bacteria | 2306 |
| 165 | Ga0496110_0030038 | 3300048913 | Bacteria | 4682 |
| 166 | Ga0496110_0053427 | 3300048913 | Bacteria | 3552 |
| 167 | Ga0496110_0209990 | 3300048913 | Bacteria | 1770 |
| 168 | Ga0496110_0595996 | 3300048913 | Bacteria | 1003 |
| 169 | Ga0496111_0002364 | 3300048914 | Bacteria | 11369 |
| 170 | Ga0496111_0126408 | 3300048914 | Bacteria | 1890 |
| 171 | Ga0496114_0037659 | 3300048917 | Bacteria | 4001 |
| 172 | Ga0496114_0062013 | 3300048917 | Bacteria | 3129 |
| 173 | Ga0496114_0075208 | 3300048917 | Bacteria | 2844 |
| 174 | Ga0496114_0283939 | 3300048917 | Bacteria | 1460 |
| 175 | Ga0496119_0001741 | 3300048922 | Bacteria | 25371 |
| 176 | Ga0496119_0062577 | 3300048922 | Bacteria | 2217 |
| 177 | Ga0496119_0211099 | 3300048922 | Bacteria | 999 |
| 178 | Ga0496122_0017441 | 3300048925 | Bacteria | 6712 |
| 179 | Ga0496123_0001442 | 3300048926 | Bacteria | 33141 |
| 180 | Ga0496124_0005102 | 3300048927 | Bacteria | 14954 |
| 181 | Ga0496124_0137590 | 3300048927 | Bacteria | 1931 |
| 182 | Ga0501032_0031532 | 3300049569 | Bacteria | 3634 |
| 183 | Ga0501033_0016764 | 3300049570 | Bacteria | 5542 |
| 184 | Ga0501034_0125540 | 3300049571 | Bacteria | 2551 |
| 185 | Ga0501034_0578367 | 3300049571 | Bacteria | 1030 |
| 186 | Ga0501036_0073237 | 3300049572 | Bacteria | 2896 |
| 187 | Ga0501037_0043755 | 3300049573 | Bacteria | 3290 |
| 188 | Ga0501038_0008148 | 3300049574 | Bacteria | 9645 |
| 189 | Ga0501038_0075014 | 3300049574 | Bacteria | 2860 |
| 190 | Ga0501039_0224053 | 3300049575 | Bacteria | 1478 |
| 191 | Ga0501043_0017701 | 3300049579 | Bacteria | 5588 |
| 192 | Ga0501046_0033490 | 3300049580 | Bacteria | 4151 |
| 193 | Ga0501047_0046575 | 3300049581 | Bacteria | 4190 |
| 194 | Ga0501047_0063945 | 3300049581 | Bacteria | 3549 |
| 195 | Ga0501067_0196206 | 3300049583 | Bacteria | 1124 |
| 196 | Ga0501068_0041192 | 3300049584 | Bacteria | 2775 |
| 197 | Ga0501070_0000730 | 3300049586 | Bacteria | 30031 |
| 198 | Ga0501070_0017798 | 3300049586 | Bacteria | 5967 |
| 199 | Ga0501071_0367659 | 3300049587 | Bacteria | 1096 |
| 200 | Ga0501071_0466061 | 3300049587 | Bacteria | 968 |
| 201 | Ga0501083_0088074 | 3300049744 | Unclassified | 2053 |
| 202 | Ga0501035_0167146 | 3300049822 | Bacteria | 1902 |
| 203 | Ga0501044_0085035 | 3300049823 | Bacteria | 3197 |
| 204 | Ga0501044_0321023 | 3300049823 | Bacteria | 1473 |
| 205 | nmdc:mga0k408_35763_c1 | 3300050493 | Bacteria | 2848 |
| 206 | nmdc:mga09592_178315_c1 | 3300050508 | Unclassified | 1838 |
| 207 | nmdc:mga08y16_229400_c1 | 3300050511 | Bacteria | 1920 |
| 208 | Ga0500654_118527 | 3300053099 | Bacteria | 1052 |
| 209 | Ga0500568_0001935 | 3300053139 | Bacteria | 12686 |
| 210 | Ga0500573_0137880 | 3300053140 | Bacteria | 1346 |
| 211 | Ga0500611_000020 | 3300053727 | Bacteria | 105250 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013105 | Ga0157369_10126375 | Ga0157369_101263752 | 229 |
| 2 | 3300013306 | Ga0163162_10072204 | Ga0163162_100722042 | 241 |
| 3 | 3300005339 | Ga0070660_100336749 | Ga0070660_1003367492 | 243 |
| 4 | 3300025921 | Ga0207652_10186660 | Ga0207652_101866601 | 243 |
| 5 | 3300026067 | Ga0207678_10050689 | Ga0207678_100506892 | 243 |
| 6 | 3300014326 | Ga0157380_10185086 | Ga0157380_101850863 | 246 |
| 7 | 3300046460 | Ga0495638_0027825 | Ga0495638_0027825_2859_3614 | 246 |
| 8 | 3300048913 | Ga0496110_0595996 | Ga0496110_0595996_60_893 | 246 |
| 9 | 3300049571 | Ga0501034_0125540 | Ga0501034_0125540_691_1554 | 253 |
| 10 | iso_pu_bacteria | 8056579771 | 8056579930 | 253 |
| 11 | 3300005356 | Ga0070674_100052983 | Ga0070674_1000529833 | 256 |
| 12 | 3300014326 | Ga0157380_10400458 | Ga0157380_104004582 | 256 |
| 13 | 3300048911 | Ga0496108_0520792 | Ga0496108_0520792_86_916 | 256 |
| 14 | 3300009148 | Ga0105243_10046289 | Ga0105243_100462892 | 257 |
| 15 | 3300009553 | Ga0105249_10027554 | Ga0105249_100275542 | 257 |
| 16 | 3300013297 | Ga0157378_10061969 | Ga0157378_100619693 | 257 |
| 17 | 3300028794 | Ga0307515_10000002 | Ga0307515_10000002713 | 257 |
| 18 | 3300053140 | Ga0500573_0137880 | Ga0500573_0137880_541_1326 | 258 |
| 19 | 3300006946 | Ga0079104_1022867 | Ga0079104_10228672 | 259 |
| 20 | 3300027111 | Ga0209281_1014431 | Ga0209281_10144312 | 259 |
| 21 | 3300017792 | Ga0163161_10117693 | Ga0163161_101176931 | 263 |
| 22 | iso_pu_bacteria | 2811994872 | 2812321948 | 265 |
| 23 | iso_pu_bacteria | 2857720070 | 2857722515 | 265 |
| 24 | iso_pu_bacteria | 2928090899 | 2928092909 | 265 |
| 25 | iso_pu_bacteria | 2984580707 | 2984583540 | 265 |
| 26 | 3300037418 | Ga0395900_0054730 | Ga0395900_0054730_2180_3025 | 266 |
| 27 | 3300038443 | Ga0395901_0306058 | Ga0395901_0306058_783_1628 | 266 |
| 28 | iso_pu_bacteria | 2643221694 | 2644525614 | 267 |
| 29 | iso_pu_bacteria | 2643221722 | 2644669685 | 267 |
| 30 | iso_pu_bacteria | 2758568522 | 2760304989 | 267 |
| 31 | iso_pu_bacteria | 2816332139 | 2816508143 | 267 |
| 32 | iso_pu_bacteria | 2939657138 | 2939659570 | 267 |
| 33 | iso_pu_bacteria | 2839986021 | 2839988847 | 268 |
| 34 | iso_pu_bacteria | 2852677369 | 2852678366 | 268 |
| 35 | iso_pu_bacteria | 2932431166 | 2932434058 | 268 |
| 36 | 3300005288 | Ga0065714_10004509 | Ga0065714_100045098 | 269 |
| 37 | 3300005614 | Ga0068856_100424242 | Ga0068856_1004242422 | 269 |
| 38 | 3300005937 | Ga0081455_10001155 | Ga0081455_1000115510 | 269 |
| 39 | 3300006051 | Ga0075364_10148570 | Ga0075364_101485702 | 269 |
| 40 | 3300013104 | Ga0157370_10396767 | Ga0157370_103967672 | 269 |
| 41 | 3300013250 | Ga0171462_1002 | Ga0171462_1002194 | 269 |
| 42 | 3300013306 | Ga0163162_10056056 | Ga0163162_100560561 | 269 |
| 43 | 3300020082 | Ga0206353_10681359 | Ga0206353_106813596 | 269 |
| 44 | 3300025253 | Ga0209677_101970 | Ga0209677_1019705 | 269 |
| 45 | 3300025909 | Ga0207705_10104572 | Ga0207705_101045722 | 269 |
| 46 | 3300031548 | Ga0307408_100218251 | Ga0307408_1002182511 | 269 |
| 47 | 3300037418 | Ga0395900_0249360 | Ga0395900_0249360_688_1518 | 269 |
| 48 | 3300041491 | Ga0451833_0630732 | Ga0451833_0630732_100_930 | 269 |
| 49 | 3300041494 | Ga0451837_1599535 | Ga0451837_1599535_257_1087 | 269 |
| 50 | 3300044735 | Ga0466968_0007385 | Ga0466968_0007385_2419_3264 | 269 |
| 51 | 3300048912 | Ga0496109_0134868 | Ga0496109_0134868_873_1703 | 269 |
| 52 | 3300048913 | Ga0496110_0053427 | Ga0496110_0053427_508_1338 | 269 |
| 53 | 3300048914 | Ga0496111_0126408 | Ga0496111_0126408_895_1725 | 269 |
| 54 | 3300048917 | Ga0496114_0075208 | Ga0496114_0075208_1419_2249 | 269 |
| 55 | 3300048922 | Ga0496119_0001741 | Ga0496119_0001741_5308_6153 | 269 |
| 56 | 3300048922 | Ga0496119_0062577 | Ga0496119_0062577_1156_1986 | 269 |
| 57 | 3300048927 | Ga0496124_0137590 | Ga0496124_0137590_277_1122 | 269 |
| 58 | 3300049571 | Ga0501034_0578367 | Ga0501034_0578367_178_1002 | 269 |
| 59 | 3300049574 | Ga0501038_0008148 | Ga0501038_0008148_8500_9324 | 269 |
| 60 | 3300049574 | Ga0501038_0075014 | Ga0501038_0075014_340_1179 | 269 |
| 61 | 3300049575 | Ga0501039_0224053 | Ga0501039_0224053_219_1064 | 269 |
| 62 | 3300049586 | Ga0501070_0000730 | Ga0501070_0000730_4286_5143 | 269 |
| 63 | 3300049586 | Ga0501070_0017798 | Ga0501070_0017798_1319_2143 | 269 |
| 64 | iso_pu_bacteria | 2939660829 | 2939661870 | 269 |
| 65 | iso_pu_bacteria | 2946033335 | 2946035915 | 269 |
| 66 | iso_pu_bacteria | 8045830549 | 8045833071 | 269 |
| 67 | 3300045051 | Ga0451576_0028416 | Ga0451576_0028416_503_1330 | 270 |
| 68 | 3300049581 | Ga0501047_0063945 | Ga0501047_0063945_2711_3535 | 270 |
| 69 | iso_pu_bacteria | 2837678835 | 2837680064 | 270 |
| 70 | iso_pu_bacteria | 2889790730 | 2889791413 | 270 |
| 71 | iso_pu_bacteria | 2889914905 | 2889920178 | 270 |
| 72 | iso_pu_bacteria | 8045864390 | 8045868004 | 270 |
| 73 | 3300003316 | rootH1_10171724 | rootH1_101717242 | 271 |
| 74 | 3300003323 | rootH1_10053382 | rootH1_100533822 | 271 |
| 75 | 3300003323 | rootH1_10344087 | rootH1_103440872 | 271 |
| 76 | 3300005295 | Ga0065707_10100867 | Ga0065707_101008674 | 271 |
| 77 | 3300005331 | Ga0070670_100156445 | Ga0070670_1001564453 | 271 |
| 78 | 3300005334 | Ga0068869_100193711 | Ga0068869_1001937112 | 271 |
| 79 | 3300005334 | Ga0068869_100207378 | Ga0068869_1002073782 | 271 |
| 80 | 3300005364 | Ga0070673_100104341 | Ga0070673_1001043412 | 271 |
| 81 | 3300005438 | Ga0070701_10183738 | Ga0070701_101837382 | 271 |
| 82 | 3300005440 | Ga0070705_100028293 | Ga0070705_1000282933 | 271 |
| 83 | 3300005466 | Ga0070685_10160190 | Ga0070685_101601901 | 271 |
| 84 | 3300005471 | Ga0070698_100000195 | Ga0070698_10000019515 | 271 |
| 85 | 3300005471 | Ga0070698_100011431 | Ga0070698_1000114311 | 271 |
| 86 | 3300005539 | Ga0068853_100323469 | Ga0068853_1003234692 | 271 |
| 87 | 3300005544 | Ga0070686_100146755 | Ga0070686_1001467551 | 271 |
| 88 | 3300005546 | Ga0070696_100319272 | Ga0070696_1003192722 | 271 |
| 89 | 3300005547 | Ga0070693_100120119 | Ga0070693_1001201192 | 271 |
| 90 | 3300005616 | Ga0068852_100584799 | Ga0068852_1005847991 | 271 |
| 91 | 3300005617 | Ga0068859_100039542 | Ga0068859_1000395425 | 271 |
| 92 | 3300005617 | Ga0068859_100792619 | Ga0068859_1007926192 | 271 |
| 93 | 3300005719 | Ga0068861_100227326 | Ga0068861_1002273262 | 271 |
| 94 | 3300005841 | Ga0068863_100038628 | Ga0068863_1000386283 | 271 |
| 95 | 3300005841 | Ga0068863_100405683 | Ga0068863_1004056832 | 271 |
| 96 | 3300005842 | Ga0068858_100491160 | Ga0068858_1004911602 | 271 |
| 97 | 3300006195 | Ga0075366_10050396 | Ga0075366_100503962 | 271 |
| 98 | 3300006195 | Ga0075366_10072536 | Ga0075366_100725362 | 271 |
| 99 | 3300006844 | Ga0075428_100036101 | Ga0075428_1000361017 | 271 |
| 100 | 3300006880 | Ga0075429_100010148 | Ga0075429_1000101487 | 271 |
| 101 | 3300006931 | Ga0097620_100792592 | Ga0097620_1007925922 | 271 |
| 102 | 3300009176 | Ga0105242_10018251 | Ga0105242_100182516 | 271 |
| 103 | 3300009553 | Ga0105249_10002170 | Ga0105249_100021703 | 271 |
| 104 | 3300009553 | Ga0105249_10146310 | Ga0105249_101463103 | 271 |
| 105 | 3300009553 | Ga0105249_10488493 | Ga0105249_104884932 | 271 |
| 106 | 3300013105 | Ga0157369_10000337 | Ga0157369_1000033757 | 271 |
| 107 | 3300013297 | Ga0157378_10689909 | Ga0157378_106899091 | 271 |
| 108 | 3300013306 | Ga0163162_10231636 | Ga0163162_102316362 | 271 |
| 109 | 3300013306 | Ga0163162_10269067 | Ga0163162_102690672 | 271 |
| 110 | 3300013308 | Ga0157375_10895130 | Ga0157375_108951302 | 271 |
| 111 | 3300014326 | Ga0157380_10114738 | Ga0157380_101147381 | 271 |
| 112 | 3300014745 | Ga0157377_10036919 | Ga0157377_100369192 | 271 |
| 113 | 3300017792 | Ga0163161_10107457 | Ga0163161_101074572 | 271 |
| 114 | 3300017792 | Ga0163161_10155574 | Ga0163161_101555741 | 271 |
| 115 | 3300020077 | Ga0206351_10505233 | Ga0206351_105052332 | 271 |
| 116 | 3300020082 | Ga0206353_11158319 | Ga0206353_111583193 | 271 |
| 117 | 3300025899 | Ga0207642_10044212 | Ga0207642_100442122 | 271 |
| 118 | 3300025908 | Ga0207643_10014334 | Ga0207643_100143343 | 271 |
| 119 | 3300025918 | Ga0207662_10011696 | Ga0207662_100116963 | 271 |
| 120 | 3300025922 | Ga0207646_10479261 | Ga0207646_104792612 | 271 |
| 121 | 3300025925 | Ga0207650_10085173 | Ga0207650_100851732 | 271 |
| 122 | 3300025925 | Ga0207650_10155933 | Ga0207650_101559333 | 271 |
| 123 | 3300025934 | Ga0207686_10000590 | Ga0207686_1000059021 | 271 |
| 124 | 3300025935 | Ga0207709_10035056 | Ga0207709_100350563 | 271 |
| 125 | 3300025936 | Ga0207670_10136957 | Ga0207670_101369572 | 271 |
| 126 | 3300025937 | Ga0207669_10042404 | Ga0207669_100424042 | 271 |
| 127 | 3300025937 | Ga0207669_10260069 | Ga0207669_102600691 | 271 |
| 128 | 3300025940 | Ga0207691_10117572 | Ga0207691_101175722 | 271 |
| 129 | 3300025960 | Ga0207651_10146239 | Ga0207651_101462392 | 271 |
| 130 | 3300025961 | Ga0207712_10032722 | Ga0207712_100327223 | 271 |
| 131 | 3300025972 | Ga0207668_10245674 | Ga0207668_102456742 | 271 |
| 132 | 3300026041 | Ga0207639_10210700 | Ga0207639_102107002 | 271 |
| 133 | 3300026075 | Ga0207708_10040225 | Ga0207708_100402253 | 271 |
| 134 | 3300026088 | Ga0207641_10000678 | Ga0207641_1000067834 | 271 |
| 135 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000011719 | 271 |
| 136 | 3300031251 | Ga0265327_10000159 | Ga0265327_1000015912 | 271 |
| 137 | 3300031548 | Ga0307408_100021010 | Ga0307408_1000210102 | 271 |
| 138 | 3300031548 | Ga0307408_100097795 | Ga0307408_1000977952 | 271 |
| 139 | 3300031548 | Ga0307408_100226765 | Ga0307408_1002267652 | 271 |
| 140 | 3300031731 | Ga0307405_10218668 | Ga0307405_102186682 | 271 |
| 141 | 3300031731 | Ga0307405_10479650 | Ga0307405_104796502 | 271 |
| 142 | 3300031824 | Ga0307413_10010417 | Ga0307413_100104174 | 271 |
| 143 | 3300031852 | Ga0307410_10009663 | Ga0307410_100096635 | 271 |
| 144 | 3300031911 | Ga0307412_10011029 | Ga0307412_100110294 | 271 |
| 145 | 3300031995 | Ga0307409_100130421 | Ga0307409_1001304211 | 271 |
| 146 | 3300031995 | Ga0307409_100290529 | Ga0307409_1002905292 | 271 |
| 147 | 3300032002 | Ga0307416_100005566 | Ga0307416_1000055666 | 271 |
| 148 | 3300032002 | Ga0307416_100011309 | Ga0307416_1000113095 | 271 |
| 149 | 3300035398 | Ga0316574_0185578 | Ga0316574_0185578_324_1148 | 271 |
| 150 | 3300041512 | Ga0451853_1272470 | Ga0451853_1272470_264_1109 | 271 |
| 151 | 3300042007 | Ga0439449_0004925 | Ga0439449_0004925_2918_3748 | 271 |
| 152 | 3300042436 | Ga0439435_0042138 | Ga0439435_0042138_50_880 | 271 |
| 153 | 3300044673 | Ga0453683_0283017 | Ga0453683_0283017_57_887 | 271 |
| 154 | 3300046539 | Ga0495621_0015349 | Ga0495621_0015349_1275_2105 | 271 |
| 155 | 3300047320 | Ga0495672_0004265 | Ga0495672_0004265_9047_9877 | 271 |
| 156 | 3300047472 | Ga0495686_0017519 | Ga0495686_0017519_1045_1875 | 271 |
| 157 | 3300047472 | Ga0495686_0054747 | Ga0495686_0054747_185_1015 | 271 |
| 158 | 3300048922 | Ga0496119_0211099 | Ga0496119_0211099_141_974 | 271 |
| 159 | 3300049587 | Ga0501071_0466061 | Ga0501071_0466061_97_921 | 271 |
| 160 | 3300049744 | Ga0501083_0088074 | Ga0501083_0088074_703_1533 | 271 |
| 161 | 3300050493 | nmdc:mga0k408_35763_c1 | nmdc:mga0k408_35763_c1_105_935 | 271 |
| 162 | 3300050508 | nmdc:mga09592_178315_c1 | nmdc:mga09592_178315_c1_914_1744 | 271 |
| 163 | 3300050511 | nmdc:mga08y16_229400_c1 | nmdc:mga08y16_229400_c1_608_1438 | 271 |
| 164 | 3300053727 | Ga0500611_000020 | Ga0500611_000020_58849_59679 | 271 |
| 165 | iso_pu_bacteria | 2833709550 | 2833712308 | 271 |
| 166 | 3300002773 | JGI25152J39213_1000238 | JGI25152J39213_100023825 | 272 |
| 167 | 3300005329 | Ga0070683_100108881 | Ga0070683_1001088813 | 272 |
| 168 | 3300005337 | Ga0070682_100062290 | Ga0070682_1000622902 | 272 |
| 169 | 3300009098 | Ga0105245_10119144 | Ga0105245_101191442 | 272 |
| 170 | 3300009148 | Ga0105243_10072744 | Ga0105243_100727442 | 272 |
| 171 | 3300011119 | Ga0105246_10121395 | Ga0105246_101213952 | 272 |
| 172 | 3300013306 | Ga0163162_10306845 | Ga0163162_103068452 | 272 |
| 173 | 3300014969 | Ga0157376_10535257 | Ga0157376_105352572 | 272 |
| 174 | 3300025258 | Ga0209129_1000067 | Ga0209129_1000067198 | 272 |
| 175 | 3300025294 | Ga0209025_1000226 | Ga0209025_1000226104 | 272 |
| 176 | 3300025935 | Ga0207709_10060408 | Ga0207709_100604082 | 272 |
| 177 | 3300031995 | Ga0307409_100175407 | Ga0307409_1001754073 | 272 |
| 178 | 3300032126 | Ga0307415_100233692 | Ga0307415_1002336921 | 272 |
| 179 | 3300046461 | Ga0495641_0040351 | Ga0495641_0040351_276_1115 | 272 |
| 180 | 3300046680 | Ga0495646_0195924 | Ga0495646_0195924_209_1048 | 272 |
| 181 | 3300047673 | Ga0495593_0142529 | Ga0495593_0142529_357_1196 | 272 |
| 182 | 3300048904 | Ga0496101_0104144 | Ga0496101_0104144_573_1412 | 272 |
| 183 | 3300048905 | Ga0496102_0002464 | Ga0496102_0002464_2145_2984 | 272 |
| 184 | 3300048905 | Ga0496102_0215045 | Ga0496102_0215045_625_1464 | 272 |
| 185 | 3300048907 | Ga0496104_0022274 | Ga0496104_0022274_3247_4086 | 272 |
| 186 | 3300048911 | Ga0496108_0043058 | Ga0496108_0043058_2680_3519 | 272 |
| 187 | 3300048912 | Ga0496109_0038316 | Ga0496109_0038316_771_1610 | 272 |
| 188 | 3300048913 | Ga0496110_0030038 | Ga0496110_0030038_1739_2578 | 272 |
| 189 | 3300048914 | Ga0496111_0002364 | Ga0496111_0002364_586_1425 | 272 |
| 190 | 3300048917 | Ga0496114_0037659 | Ga0496114_0037659_576_1415 | 272 |
| 191 | 3300048917 | Ga0496114_0062013 | Ga0496114_0062013_266_1105 | 272 |
| 192 | 3300048917 | Ga0496114_0283939 | Ga0496114_0283939_21_929 | 272 |
| 193 | 3300048925 | Ga0496122_0017441 | Ga0496122_0017441_1496_2365 | 272 |
| 194 | 3300048926 | Ga0496123_0001442 | Ga0496123_0001442_877_1746 | 272 |
| 195 | 3300048927 | Ga0496124_0005102 | Ga0496124_0005102_2718_3563 | 272 |
| 196 | 3300049569 | Ga0501032_0031532 | Ga0501032_0031532_1459_2319 | 272 |
| 197 | 3300049570 | Ga0501033_0016764 | Ga0501033_0016764_1568_2428 | 272 |
| 198 | 3300049572 | Ga0501036_0073237 | Ga0501036_0073237_1943_2803 | 272 |
| 199 | 3300049573 | Ga0501037_0043755 | Ga0501037_0043755_2308_3168 | 272 |
| 200 | 3300049579 | Ga0501043_0017701 | Ga0501043_0017701_4286_5146 | 272 |
| 201 | 3300049580 | Ga0501046_0033490 | Ga0501046_0033490_1690_2544 | 272 |
| 202 | 3300049581 | Ga0501047_0046575 | Ga0501047_0046575_312_1172 | 272 |
| 203 | 3300049583 | Ga0501067_0196206 | Ga0501067_0196206_78_938 | 272 |
| 204 | 3300049584 | Ga0501068_0041192 | Ga0501068_0041192_1325_2185 | 272 |
| 205 | 3300049587 | Ga0501071_0367659 | Ga0501071_0367659_15_875 | 272 |
| 206 | 3300049822 | Ga0501035_0167146 | Ga0501035_0167146_312_1172 | 272 |
| 207 | 3300049823 | Ga0501044_0085035 | Ga0501044_0085035_773_1633 | 272 |
| 208 | 3300053139 | Ga0500568_0001935 | Ga0500568_0001935_1146_1973 | 272 |
| 209 | iso_pu_bacteria | 2977264416 | 2977264490 | 272 |
| 210 | 3300011119 | Ga0105246_10315691 | Ga0105246_103156911 | 273 |
| 211 | 3300014326 | Ga0157380_10036878 | Ga0157380_100368781 | 273 |
| 212 | iso_pu_bacteria | 2905926851 | 2905930561 | 273 |
| 213 | 3300001989 | JGI24739J22299_10019117 | JGI24739J22299_100191172 | 274 |
| 214 | 3300009553 | Ga0105249_10220070 | Ga0105249_102200702 | 274 |
| 215 | 3300010375 | Ga0105239_10117548 | Ga0105239_101175482 | 274 |
| 216 | 3300011119 | Ga0105246_10300032 | Ga0105246_103000321 | 274 |
| 217 | 3300013105 | Ga0157369_10206662 | Ga0157369_102066622 | 274 |
| 218 | 3300013307 | Ga0157372_10123819 | Ga0157372_101238194 | 274 |
| 219 | 3300025904 | Ga0207647_10002199 | Ga0207647_100021999 | 274 |
| 220 | 3300025961 | Ga0207712_10215317 | Ga0207712_102153172 | 274 |
| 221 | 3300030522 | Ga0307512_10227821 | Ga0307512_102278211 | 274 |
| 222 | 3300031901 | Ga0307406_10072749 | Ga0307406_100727492 | 274 |
| 223 | 3300041443 | Ga0451789_0188137 | Ga0451789_0188137_993_1892 | 274 |
| 224 | 3300041451 | Ga0451791_1825768 | Ga0451791_1825768_2268_3167 | 274 |
| 225 | 3300041452 | Ga0451793_0256894 | Ga0451793_0256894_5563_6462 | 274 |
| 226 | 3300041453 | Ga0451797_0766943 | Ga0451797_0766943_1152_2051 | 274 |
| 227 | 3300041456 | Ga0451795_0029673 | Ga0451795_0029673_137_1036 | 274 |
| 228 | 3300041486 | Ga0451807_1349404 | Ga0451807_1349404_895_1794 | 274 |
| 229 | 3300041512 | Ga0451853_3259773 | Ga0451853_3259773_691_1590 | 274 |
| 230 | 3300046660 | Ga0495625_0235192 | Ga0495625_0235192_339_1163 | 274 |
| 231 | 3300048913 | Ga0496110_0209990 | Ga0496110_0209990_765_1664 | 274 |
| 232 | 3300049823 | Ga0501044_0321023 | Ga0501044_0321023_91_915 | 274 |
| 233 | 3300053099 | Ga0500654_118527 | Ga0500654_118527_176_1015 | 274 |
| 234 | iso_pu_bacteria | 2816332119 | 2816424633 | 274 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xru-assembly1.cif.gz_A | crystal structure of 5-keto-4-deoxyuronate isomerase from eschericia coli | 0.9672 | 3 | 274 |
| 7ye3-assembly1.cif.gz_C | crystal structure of lactobacillus rhamnosus 4-deoxy-l-threo-5-hexosulose-uronate ketol-isomerase kdui complexed with mes | 0.9663 | 1 | 269 |
| 1xru-assembly1.cif.gz_A | crystal structure of 5-keto-4-deoxyuronate isomerase from eschericia coli | 0.9568 | 3 | 274 |
| 1ywk-assembly6.cif.gz_F | crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from enterococcus faecalis | 0.9555 | 3 | 258 |
| 7yrs-assembly4.cif.gz_D | crystal structure of lactobacillus rhamnosus 4-deoxy-l-threo-5-hexosulose-uronate ketol-isomerase kdui complexed with mops | 0.9548 | 1 | 259 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q46938_25_265_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9699 | 28 | 261 | 2.60.120.10 |
| 1x8mA02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9572 | 138 | 262 | 2.60.120.10 |
| 1ywkB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9488 | 1 | 258 | 2.60.120.10 |
| 1ywkB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9452 | 1 | 258 | 2.60.120.10 |
| af_Q46938_25_265_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9384 | 28 | 261 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R8CG22-F1-model_v4 | 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase (EC 5.3.1.17) (5-keto-4-deoxyuronate isomerase) (DKI isomerase) | 0.9971 | 1 | 274 |
GO:0008270
GO:0008697 GO:0019698 GO:0042840 GO:0045490 |
| AF-A0A4R4Q430-F1-model_v4 | 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase (EC 5.3.1.17) (5-keto-4-deoxyuronate isomerase) (DKI isomerase) | 0.9969 | 1 | 274 |
GO:0008270
GO:0008697 GO:0019698 GO:0042840 GO:0045490 |
| AF-A0A2T0Y886-F1-model_v4 | 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase (EC 5.3.1.17) (5-keto-4-deoxyuronate isomerase) (DKI isomerase) | 0.9961 | 4 | 274 |
GO:0008270
GO:0008697 GO:0019698 GO:0042840 GO:0045490 |
| AF-A0A147F2W7-F1-model_v4 | 5-dehydro-4-deoxy-D-glucuronate isomerase (EC 5.3.1.17) | 0.995 | 57 | 274 |
GO:0008697
GO:0019698 GO:0042840 GO:0045490 GO:0046872 |
| AF-A0A4Y8K5T7-F1-model_v4 | 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase (EC 5.3.1.17) (5-keto-4-deoxyuronate isomerase) (DKI isomerase) | 0.9936 | 4 | 274 |
GO:0008270
GO:0008697 GO:0019698 GO:0042840 GO:0045490 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar