F347033

General Info

Members Datasets Scaffolds Average Seq Length
234 174 211 277

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10119144|Ga0105245_101191442
Length 302
Sequence MGAGWSADQLVTDHPHPFTLENPMDHRYATNPQQLSTFDTAELRAQFLVENLFLPGKITACYTHHDRVVLGGAAPAGEPLPLTTFEELRAEFFLANRELGIVNVGGTGTVRAGGDTYTLPNGACLYVGRGTRDVVFSGVPDDQHTPGPQFYFFSAPAHTSYPIQLVLKGQGNALELGDQLTSNRRTLNQYIHPNGIRSCQIMMGVTELHPGSMWNTMPAHTHNRRTECYLYFDIPGDARVIHLLGEPTETRHLVVADRQAVISPSWSIHSGVGTAAYSFVWAMAGENQSFDDMDAAPVDSLR

Samples

Sample ID Description Type Environment
1 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
2 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
3 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
4 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
5 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
6 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
7 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
8 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
9 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
10 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
11 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
12 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
13 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
14 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
15 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
16 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
17 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
18 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
19 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
20 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
21 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
115 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
116 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
117 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
118 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
119 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
120 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
121 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
124 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
146 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
169 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
170 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
171 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
172 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
173 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
174 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.46
Metatranscriptomes 1.28
Isolates 10.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 5.13
Nodule 0.85
Rhizoplane 10.26
Rhizosphere 71.37
Stem 0
Stem Tuber 0
Unclassified 11.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10019117 3300001989 Bacteria 2455
2 JGI25152J39213_1000238 3300002773 Bacteria 36981
3 rootH1_10171724 3300003316 Bacteria 2167
4 rootH1_10171724 3300003323 Bacteria 2796
5 rootH1_10053382 3300003323 Unclassified 2730
6 rootH1_10344087 3300003323 Bacteria 1381
7 Ga0065714_10004509 3300005288 Bacteria 8398
8 Ga0065707_10100867 3300005295 Bacteria 2899
9 Ga0070683_100108881 3300005329 Bacteria 2613
10 Ga0070670_100156445 3300005331 Bacteria 1974
11 Ga0068869_100193711 3300005334 Bacteria 1600
12 Ga0068869_100207378 3300005334 Unclassified 1548
13 Ga0070682_100062290 3300005337 Bacteria 2362
14 Ga0070660_100336749 3300005339 Bacteria 1241
15 Ga0070674_100052983 3300005356 Bacteria 2800
16 Ga0070673_100104341 3300005364 Bacteria 2340
17 Ga0070701_10183738 3300005438 Unclassified 1226
18 Ga0070705_100028293 3300005440 Bacteria 3068
19 Ga0070685_10160190 3300005466 Bacteria 1433
20 Ga0070698_100000195 3300005471 Bacteria 58013
21 Ga0070698_100011431 3300005471 Bacteria 9418
22 Ga0068853_100323469 3300005539 Bacteria 1430
23 Ga0070686_100146755 3300005544 Bacteria 1648
24 Ga0070696_100319272 3300005546 Bacteria 1195
25 Ga0070693_100120119 3300005547 Bacteria 1629
26 Ga0068856_100424242 3300005614 Bacteria 1350
27 Ga0068852_100584799 3300005616 Bacteria 1120
28 Ga0068859_100039542 3300005617 Bacteria 4732
29 Ga0068859_100792619 3300005617 Bacteria 1035
30 Ga0068861_100227326 3300005719 Unclassified 1580
31 Ga0068863_100038628 3300005841 Bacteria 4541
32 Ga0068863_100405683 3300005841 Bacteria 1334
33 Ga0068858_100491160 3300005842 Bacteria 1185
34 Ga0081455_10001155 3300005937 Bacteria 33093
35 Ga0075364_10148570 3300006051 Bacteria 1579
36 Ga0075366_10050396 3300006195 Bacteria 2472
37 Ga0075366_10072536 3300006195 Bacteria 2051
38 Ga0075428_100036101 3300006844 Bacteria 5446
39 Ga0075429_100010148 3300006880 Bacteria 8158
40 Ga0097620_100792592 3300006931 Bacteria 1035
41 Ga0079104_1022867 3300006946 Bacteria 1674
42 Ga0105245_10119144 3300009098 Bacteria 2464
43 Ga0105243_10046289 3300009148 Bacteria 3421
44 Ga0105243_10072744 3300009148 Bacteria 2783
45 Ga0105242_10018251 3300009176 Bacteria 5483
46 Ga0105249_10002170 3300009553 Bacteria 16996
47 Ga0105249_10027554 3300009553 Bacteria 5127
48 Ga0105249_10146310 3300009553 Unclassified 2271
49 Ga0105249_10220070 3300009553 Bacteria 1868
50 Ga0105249_10488493 3300009553 Bacteria 1275
51 Ga0105239_10117548 3300010375 Bacteria 2951
52 Ga0105246_10121395 3300011119 Bacteria 1937
53 Ga0105246_10300032 3300011119 Bacteria 1296
54 Ga0105246_10315691 3300011119 Unclassified 1268
55 Ga0157370_10396767 3300013104 Bacteria 1270
56 Ga0157369_10000337 3300013105 Bacteria 62293
57 Ga0157369_10126375 3300013105 Bacteria 2711
58 Ga0157369_10206662 3300013105 Bacteria 2059
59 Ga0171462_1002 3300013250 Bacteria 1052134
60 Ga0157378_10061969 3300013297 Bacteria 3340
61 Ga0157378_10689909 3300013297 Bacteria 1040
62 Ga0163162_10056056 3300013306 Bacteria 3970
63 Ga0163162_10072204 3300013306 Bacteria 3506
64 Ga0163162_10231636 3300013306 Bacteria 1977
65 Ga0163162_10269067 3300013306 Bacteria 1836
66 Ga0163162_10306845 3300013306 Bacteria 1719
67 Ga0157372_10123819 3300013307 Bacteria 2972
68 Ga0157375_10895130 3300013308 Bacteria 1032
69 Ga0157380_10036878 3300014326 Bacteria 3786
70 Ga0157380_10114738 3300014326 Bacteria 2271
71 Ga0157380_10185086 3300014326 Bacteria 1833
72 Ga0157380_10400458 3300014326 Bacteria 1302
73 Ga0157377_10036919 3300014745 Bacteria 2690
74 Ga0157376_10535257 3300014969 Bacteria 1157
75 Ga0163161_10107457 3300017792 Bacteria 2083
76 Ga0163161_10117693 3300017792 Bacteria 1993
77 Ga0163161_10155574 3300017792 Bacteria 1740
78 Ga0206351_10505233 3300020077 Bacteria 1748
79 Ga0206353_10681359 3300020082 Bacteria 5643
80 Ga0206353_11158319 3300020082 Bacteria 4137
81 Ga0209677_101970 3300025253 Bacteria 8170
82 Ga0209129_1000067 3300025258 Bacteria 219974
83 Ga0209025_1000226 3300025294 Bacteria 132801
84 Ga0207642_10044212 3300025899 Bacteria 1970
85 Ga0207647_10002199 3300025904 Bacteria 14870
86 Ga0207643_10014334 3300025908 Bacteria 4303
87 Ga0207705_10104572 3300025909 Bacteria 2086
88 Ga0207662_10011696 3300025918 Bacteria 4875
89 Ga0207652_10186660 3300025921 Bacteria 1864
90 Ga0207646_10479261 3300025922 Bacteria 1122
91 Ga0207650_10085173 3300025925 Bacteria 2404
92 Ga0207650_10155933 3300025925 Bacteria 1806
93 Ga0207686_10000590 3300025934 Bacteria 22687
94 Ga0207709_10035056 3300025935 Bacteria 2964
95 Ga0207709_10060408 3300025935 Bacteria 2363
96 Ga0207670_10136957 3300025936 Bacteria 1801
97 Ga0207669_10042404 3300025937 Bacteria 2656
98 Ga0207669_10260069 3300025937 Bacteria 1298
99 Ga0207691_10117572 3300025940 Bacteria 2359
100 Ga0207651_10146239 3300025960 Bacteria 1833
101 Ga0207712_10032722 3300025961 Bacteria 3511
102 Ga0207712_10215317 3300025961 Bacteria 1532
103 Ga0207668_10245674 3300025972 Bacteria 1451
104 Ga0207639_10210700 3300026041 Bacteria 1673
105 Ga0207678_10050689 3300026067 Bacteria 3586
106 Ga0207708_10040225 3300026075 Bacteria 3564
107 Ga0207641_10000678 3300026088 Bacteria 36861
108 Ga0209281_1014431 3300027111 Bacteria 1672
109 Ga0307515_10000001 3300028794 Bacteria 4259510
110 Ga0307515_10000002 3300028794 Bacteria 1231751
111 Ga0307512_10227821 3300030522 Bacteria 963
112 Ga0265327_10000159 3300031251 Bacteria 145537
113 Ga0307408_100021010 3300031548 Bacteria 4413
114 Ga0307408_100097795 3300031548 Bacteria 2230
115 Ga0307408_100218251 3300031548 Bacteria 1555
116 Ga0307408_100226765 3300031548 Bacteria 1528
117 Ga0307405_10218668 3300031731 Bacteria 1396
118 Ga0307405_10479650 3300031731 Bacteria 992
119 Ga0307413_10010417 3300031824 Bacteria 4509
120 Ga0307410_10009663 3300031852 Bacteria 5423
121 Ga0307406_10072749 3300031901 Bacteria 2258
122 Ga0307412_10011029 3300031911 Bacteria 5221
123 Ga0307409_100130421 3300031995 Bacteria 2147
124 Ga0307409_100175407 3300031995 Bacteria 1891
125 Ga0307409_100290529 3300031995 Bacteria 1516
126 Ga0307416_100005566 3300032002 Bacteria 7758
127 Ga0307416_100011309 3300032002 Bacteria 5940
128 Ga0307415_100233692 3300032126 Bacteria 1482
129 Ga0316574_0185578 3300035398 Bacteria 1338
130 Ga0395900_0054730 3300037418 Bacteria 4108
131 Ga0395900_0249360 3300037418 Bacteria 1777
132 Ga0395901_0306058 3300038443 Bacteria 1647
133 Ga0451789_0188137 3300041443 Bacteria 2056
134 Ga0451791_1825768 3300041451 Bacteria 3406
135 Ga0451793_0256894 3300041452 Bacteria 17378
136 Ga0451797_0766943 3300041453 Bacteria 4873
137 Ga0451795_0029673 3300041456 Bacteria 3905
138 Ga0451807_1349404 3300041486 Bacteria 2279
139 Ga0451833_0630732 3300041491 Bacteria 1013
140 Ga0451837_1599535 3300041494 Bacteria 1651
141 Ga0451853_1272470 3300041512 Bacteria 1309
142 Ga0451853_3259773 3300041512 Bacteria 1809
143 Ga0439449_0004925 3300042007 Bacteria 5142
144 Ga0439435_0042138 3300042436 Bacteria 1281
145 Ga0453683_0283017 3300044673 Bacteria 1059
146 Ga0466968_0007385 3300044735 Bacteria 4177
147 Ga0451576_0028416 3300045051 Bacteria 5991
148 Ga0495638_0027825 3300046460 Bacteria 3657
149 Ga0495641_0040351 3300046461 Bacteria 2171
150 Ga0495621_0015349 3300046539 Bacteria 2442
151 Ga0495625_0235192 3300046660 Bacteria 1195
152 Ga0495646_0195924 3300046680 Bacteria 1102
153 Ga0495672_0004265 3300047320 Bacteria 11805
154 Ga0495686_0017519 3300047472 Bacteria 4822
155 Ga0495686_0054747 3300047472 Bacteria 2497
156 Ga0495593_0142529 3300047673 Bacteria 1214
157 Ga0496101_0104144 3300048904 Bacteria 2128
158 Ga0496102_0002464 3300048905 Bacteria 15786
159 Ga0496102_0215045 3300048905 Bacteria 1812
160 Ga0496104_0022274 3300048907 Bacteria 5820
161 Ga0496108_0043058 3300048911 Bacteria 3770
162 Ga0496108_0520792 3300048911 Bacteria 1038
163 Ga0496109_0038316 3300048912 Bacteria 4333
164 Ga0496109_0134868 3300048912 Bacteria 2306
165 Ga0496110_0030038 3300048913 Bacteria 4682
166 Ga0496110_0053427 3300048913 Bacteria 3552
167 Ga0496110_0209990 3300048913 Bacteria 1770
168 Ga0496110_0595996 3300048913 Bacteria 1003
169 Ga0496111_0002364 3300048914 Bacteria 11369
170 Ga0496111_0126408 3300048914 Bacteria 1890
171 Ga0496114_0037659 3300048917 Bacteria 4001
172 Ga0496114_0062013 3300048917 Bacteria 3129
173 Ga0496114_0075208 3300048917 Bacteria 2844
174 Ga0496114_0283939 3300048917 Bacteria 1460
175 Ga0496119_0001741 3300048922 Bacteria 25371
176 Ga0496119_0062577 3300048922 Bacteria 2217
177 Ga0496119_0211099 3300048922 Bacteria 999
178 Ga0496122_0017441 3300048925 Bacteria 6712
179 Ga0496123_0001442 3300048926 Bacteria 33141
180 Ga0496124_0005102 3300048927 Bacteria 14954
181 Ga0496124_0137590 3300048927 Bacteria 1931
182 Ga0501032_0031532 3300049569 Bacteria 3634
183 Ga0501033_0016764 3300049570 Bacteria 5542
184 Ga0501034_0125540 3300049571 Bacteria 2551
185 Ga0501034_0578367 3300049571 Bacteria 1030
186 Ga0501036_0073237 3300049572 Bacteria 2896
187 Ga0501037_0043755 3300049573 Bacteria 3290
188 Ga0501038_0008148 3300049574 Bacteria 9645
189 Ga0501038_0075014 3300049574 Bacteria 2860
190 Ga0501039_0224053 3300049575 Bacteria 1478
191 Ga0501043_0017701 3300049579 Bacteria 5588
192 Ga0501046_0033490 3300049580 Bacteria 4151
193 Ga0501047_0046575 3300049581 Bacteria 4190
194 Ga0501047_0063945 3300049581 Bacteria 3549
195 Ga0501067_0196206 3300049583 Bacteria 1124
196 Ga0501068_0041192 3300049584 Bacteria 2775
197 Ga0501070_0000730 3300049586 Bacteria 30031
198 Ga0501070_0017798 3300049586 Bacteria 5967
199 Ga0501071_0367659 3300049587 Bacteria 1096
200 Ga0501071_0466061 3300049587 Bacteria 968
201 Ga0501083_0088074 3300049744 Unclassified 2053
202 Ga0501035_0167146 3300049822 Bacteria 1902
203 Ga0501044_0085035 3300049823 Bacteria 3197
204 Ga0501044_0321023 3300049823 Bacteria 1473
205 nmdc:mga0k408_35763_c1 3300050493 Bacteria 2848
206 nmdc:mga09592_178315_c1 3300050508 Unclassified 1838
207 nmdc:mga08y16_229400_c1 3300050511 Bacteria 1920
208 Ga0500654_118527 3300053099 Bacteria 1052
209 Ga0500568_0001935 3300053139 Bacteria 12686
210 Ga0500573_0137880 3300053140 Bacteria 1346
211 Ga0500611_000020 3300053727 Bacteria 105250

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_10126375 Ga0157369_101263752 229
2 3300013306 Ga0163162_10072204 Ga0163162_100722042 241
3 3300005339 Ga0070660_100336749 Ga0070660_1003367492 243
4 3300025921 Ga0207652_10186660 Ga0207652_101866601 243
5 3300026067 Ga0207678_10050689 Ga0207678_100506892 243
6 3300014326 Ga0157380_10185086 Ga0157380_101850863 246
7 3300046460 Ga0495638_0027825 Ga0495638_0027825_2859_3614 246
8 3300048913 Ga0496110_0595996 Ga0496110_0595996_60_893 246
9 3300049571 Ga0501034_0125540 Ga0501034_0125540_691_1554 253
10 iso_pu_bacteria 8056579771 8056579930 253
11 3300005356 Ga0070674_100052983 Ga0070674_1000529833 256
12 3300014326 Ga0157380_10400458 Ga0157380_104004582 256
13 3300048911 Ga0496108_0520792 Ga0496108_0520792_86_916 256
14 3300009148 Ga0105243_10046289 Ga0105243_100462892 257
15 3300009553 Ga0105249_10027554 Ga0105249_100275542 257
16 3300013297 Ga0157378_10061969 Ga0157378_100619693 257
17 3300028794 Ga0307515_10000002 Ga0307515_10000002713 257
18 3300053140 Ga0500573_0137880 Ga0500573_0137880_541_1326 258
19 3300006946 Ga0079104_1022867 Ga0079104_10228672 259
20 3300027111 Ga0209281_1014431 Ga0209281_10144312 259
21 3300017792 Ga0163161_10117693 Ga0163161_101176931 263
22 iso_pu_bacteria 2811994872 2812321948 265
23 iso_pu_bacteria 2857720070 2857722515 265
24 iso_pu_bacteria 2928090899 2928092909 265
25 iso_pu_bacteria 2984580707 2984583540 265
26 3300037418 Ga0395900_0054730 Ga0395900_0054730_2180_3025 266
27 3300038443 Ga0395901_0306058 Ga0395901_0306058_783_1628 266
28 iso_pu_bacteria 2643221694 2644525614 267
29 iso_pu_bacteria 2643221722 2644669685 267
30 iso_pu_bacteria 2758568522 2760304989 267
31 iso_pu_bacteria 2816332139 2816508143 267
32 iso_pu_bacteria 2939657138 2939659570 267
33 iso_pu_bacteria 2839986021 2839988847 268
34 iso_pu_bacteria 2852677369 2852678366 268
35 iso_pu_bacteria 2932431166 2932434058 268
36 3300005288 Ga0065714_10004509 Ga0065714_100045098 269
37 3300005614 Ga0068856_100424242 Ga0068856_1004242422 269
38 3300005937 Ga0081455_10001155 Ga0081455_1000115510 269
39 3300006051 Ga0075364_10148570 Ga0075364_101485702 269
40 3300013104 Ga0157370_10396767 Ga0157370_103967672 269
41 3300013250 Ga0171462_1002 Ga0171462_1002194 269
42 3300013306 Ga0163162_10056056 Ga0163162_100560561 269
43 3300020082 Ga0206353_10681359 Ga0206353_106813596 269
44 3300025253 Ga0209677_101970 Ga0209677_1019705 269
45 3300025909 Ga0207705_10104572 Ga0207705_101045722 269
46 3300031548 Ga0307408_100218251 Ga0307408_1002182511 269
47 3300037418 Ga0395900_0249360 Ga0395900_0249360_688_1518 269
48 3300041491 Ga0451833_0630732 Ga0451833_0630732_100_930 269
49 3300041494 Ga0451837_1599535 Ga0451837_1599535_257_1087 269
50 3300044735 Ga0466968_0007385 Ga0466968_0007385_2419_3264 269
51 3300048912 Ga0496109_0134868 Ga0496109_0134868_873_1703 269
52 3300048913 Ga0496110_0053427 Ga0496110_0053427_508_1338 269
53 3300048914 Ga0496111_0126408 Ga0496111_0126408_895_1725 269
54 3300048917 Ga0496114_0075208 Ga0496114_0075208_1419_2249 269
55 3300048922 Ga0496119_0001741 Ga0496119_0001741_5308_6153 269
56 3300048922 Ga0496119_0062577 Ga0496119_0062577_1156_1986 269
57 3300048927 Ga0496124_0137590 Ga0496124_0137590_277_1122 269
58 3300049571 Ga0501034_0578367 Ga0501034_0578367_178_1002 269
59 3300049574 Ga0501038_0008148 Ga0501038_0008148_8500_9324 269
60 3300049574 Ga0501038_0075014 Ga0501038_0075014_340_1179 269
61 3300049575 Ga0501039_0224053 Ga0501039_0224053_219_1064 269
62 3300049586 Ga0501070_0000730 Ga0501070_0000730_4286_5143 269
63 3300049586 Ga0501070_0017798 Ga0501070_0017798_1319_2143 269
64 iso_pu_bacteria 2939660829 2939661870 269
65 iso_pu_bacteria 2946033335 2946035915 269
66 iso_pu_bacteria 8045830549 8045833071 269
67 3300045051 Ga0451576_0028416 Ga0451576_0028416_503_1330 270
68 3300049581 Ga0501047_0063945 Ga0501047_0063945_2711_3535 270
69 iso_pu_bacteria 2837678835 2837680064 270
70 iso_pu_bacteria 2889790730 2889791413 270
71 iso_pu_bacteria 2889914905 2889920178 270
72 iso_pu_bacteria 8045864390 8045868004 270
73 3300003316 rootH1_10171724 rootH1_101717242 271
74 3300003323 rootH1_10053382 rootH1_100533822 271
75 3300003323 rootH1_10344087 rootH1_103440872 271
76 3300005295 Ga0065707_10100867 Ga0065707_101008674 271
77 3300005331 Ga0070670_100156445 Ga0070670_1001564453 271
78 3300005334 Ga0068869_100193711 Ga0068869_1001937112 271
79 3300005334 Ga0068869_100207378 Ga0068869_1002073782 271
80 3300005364 Ga0070673_100104341 Ga0070673_1001043412 271
81 3300005438 Ga0070701_10183738 Ga0070701_101837382 271
82 3300005440 Ga0070705_100028293 Ga0070705_1000282933 271
83 3300005466 Ga0070685_10160190 Ga0070685_101601901 271
84 3300005471 Ga0070698_100000195 Ga0070698_10000019515 271
85 3300005471 Ga0070698_100011431 Ga0070698_1000114311 271
86 3300005539 Ga0068853_100323469 Ga0068853_1003234692 271
87 3300005544 Ga0070686_100146755 Ga0070686_1001467551 271
88 3300005546 Ga0070696_100319272 Ga0070696_1003192722 271
89 3300005547 Ga0070693_100120119 Ga0070693_1001201192 271
90 3300005616 Ga0068852_100584799 Ga0068852_1005847991 271
91 3300005617 Ga0068859_100039542 Ga0068859_1000395425 271
92 3300005617 Ga0068859_100792619 Ga0068859_1007926192 271
93 3300005719 Ga0068861_100227326 Ga0068861_1002273262 271
94 3300005841 Ga0068863_100038628 Ga0068863_1000386283 271
95 3300005841 Ga0068863_100405683 Ga0068863_1004056832 271
96 3300005842 Ga0068858_100491160 Ga0068858_1004911602 271
97 3300006195 Ga0075366_10050396 Ga0075366_100503962 271
98 3300006195 Ga0075366_10072536 Ga0075366_100725362 271
99 3300006844 Ga0075428_100036101 Ga0075428_1000361017 271
100 3300006880 Ga0075429_100010148 Ga0075429_1000101487 271
101 3300006931 Ga0097620_100792592 Ga0097620_1007925922 271
102 3300009176 Ga0105242_10018251 Ga0105242_100182516 271
103 3300009553 Ga0105249_10002170 Ga0105249_100021703 271
104 3300009553 Ga0105249_10146310 Ga0105249_101463103 271
105 3300009553 Ga0105249_10488493 Ga0105249_104884932 271
106 3300013105 Ga0157369_10000337 Ga0157369_1000033757 271
107 3300013297 Ga0157378_10689909 Ga0157378_106899091 271
108 3300013306 Ga0163162_10231636 Ga0163162_102316362 271
109 3300013306 Ga0163162_10269067 Ga0163162_102690672 271
110 3300013308 Ga0157375_10895130 Ga0157375_108951302 271
111 3300014326 Ga0157380_10114738 Ga0157380_101147381 271
112 3300014745 Ga0157377_10036919 Ga0157377_100369192 271
113 3300017792 Ga0163161_10107457 Ga0163161_101074572 271
114 3300017792 Ga0163161_10155574 Ga0163161_101555741 271
115 3300020077 Ga0206351_10505233 Ga0206351_105052332 271
116 3300020082 Ga0206353_11158319 Ga0206353_111583193 271
117 3300025899 Ga0207642_10044212 Ga0207642_100442122 271
118 3300025908 Ga0207643_10014334 Ga0207643_100143343 271
119 3300025918 Ga0207662_10011696 Ga0207662_100116963 271
120 3300025922 Ga0207646_10479261 Ga0207646_104792612 271
121 3300025925 Ga0207650_10085173 Ga0207650_100851732 271
122 3300025925 Ga0207650_10155933 Ga0207650_101559333 271
123 3300025934 Ga0207686_10000590 Ga0207686_1000059021 271
124 3300025935 Ga0207709_10035056 Ga0207709_100350563 271
125 3300025936 Ga0207670_10136957 Ga0207670_101369572 271
126 3300025937 Ga0207669_10042404 Ga0207669_100424042 271
127 3300025937 Ga0207669_10260069 Ga0207669_102600691 271
128 3300025940 Ga0207691_10117572 Ga0207691_101175722 271
129 3300025960 Ga0207651_10146239 Ga0207651_101462392 271
130 3300025961 Ga0207712_10032722 Ga0207712_100327223 271
131 3300025972 Ga0207668_10245674 Ga0207668_102456742 271
132 3300026041 Ga0207639_10210700 Ga0207639_102107002 271
133 3300026075 Ga0207708_10040225 Ga0207708_100402253 271
134 3300026088 Ga0207641_10000678 Ga0207641_1000067834 271
135 3300028794 Ga0307515_10000001 Ga0307515_100000011719 271
136 3300031251 Ga0265327_10000159 Ga0265327_1000015912 271
137 3300031548 Ga0307408_100021010 Ga0307408_1000210102 271
138 3300031548 Ga0307408_100097795 Ga0307408_1000977952 271
139 3300031548 Ga0307408_100226765 Ga0307408_1002267652 271
140 3300031731 Ga0307405_10218668 Ga0307405_102186682 271
141 3300031731 Ga0307405_10479650 Ga0307405_104796502 271
142 3300031824 Ga0307413_10010417 Ga0307413_100104174 271
143 3300031852 Ga0307410_10009663 Ga0307410_100096635 271
144 3300031911 Ga0307412_10011029 Ga0307412_100110294 271
145 3300031995 Ga0307409_100130421 Ga0307409_1001304211 271
146 3300031995 Ga0307409_100290529 Ga0307409_1002905292 271
147 3300032002 Ga0307416_100005566 Ga0307416_1000055666 271
148 3300032002 Ga0307416_100011309 Ga0307416_1000113095 271
149 3300035398 Ga0316574_0185578 Ga0316574_0185578_324_1148 271
150 3300041512 Ga0451853_1272470 Ga0451853_1272470_264_1109 271
151 3300042007 Ga0439449_0004925 Ga0439449_0004925_2918_3748 271
152 3300042436 Ga0439435_0042138 Ga0439435_0042138_50_880 271
153 3300044673 Ga0453683_0283017 Ga0453683_0283017_57_887 271
154 3300046539 Ga0495621_0015349 Ga0495621_0015349_1275_2105 271
155 3300047320 Ga0495672_0004265 Ga0495672_0004265_9047_9877 271
156 3300047472 Ga0495686_0017519 Ga0495686_0017519_1045_1875 271
157 3300047472 Ga0495686_0054747 Ga0495686_0054747_185_1015 271
158 3300048922 Ga0496119_0211099 Ga0496119_0211099_141_974 271
159 3300049587 Ga0501071_0466061 Ga0501071_0466061_97_921 271
160 3300049744 Ga0501083_0088074 Ga0501083_0088074_703_1533 271
161 3300050493 nmdc:mga0k408_35763_c1 nmdc:mga0k408_35763_c1_105_935 271
162 3300050508 nmdc:mga09592_178315_c1 nmdc:mga09592_178315_c1_914_1744 271
163 3300050511 nmdc:mga08y16_229400_c1 nmdc:mga08y16_229400_c1_608_1438 271
164 3300053727 Ga0500611_000020 Ga0500611_000020_58849_59679 271
165 iso_pu_bacteria 2833709550 2833712308 271
166 3300002773 JGI25152J39213_1000238 JGI25152J39213_100023825 272
167 3300005329 Ga0070683_100108881 Ga0070683_1001088813 272
168 3300005337 Ga0070682_100062290 Ga0070682_1000622902 272
169 3300009098 Ga0105245_10119144 Ga0105245_101191442 272
170 3300009148 Ga0105243_10072744 Ga0105243_100727442 272
171 3300011119 Ga0105246_10121395 Ga0105246_101213952 272
172 3300013306 Ga0163162_10306845 Ga0163162_103068452 272
173 3300014969 Ga0157376_10535257 Ga0157376_105352572 272
174 3300025258 Ga0209129_1000067 Ga0209129_1000067198 272
175 3300025294 Ga0209025_1000226 Ga0209025_1000226104 272
176 3300025935 Ga0207709_10060408 Ga0207709_100604082 272
177 3300031995 Ga0307409_100175407 Ga0307409_1001754073 272
178 3300032126 Ga0307415_100233692 Ga0307415_1002336921 272
179 3300046461 Ga0495641_0040351 Ga0495641_0040351_276_1115 272
180 3300046680 Ga0495646_0195924 Ga0495646_0195924_209_1048 272
181 3300047673 Ga0495593_0142529 Ga0495593_0142529_357_1196 272
182 3300048904 Ga0496101_0104144 Ga0496101_0104144_573_1412 272
183 3300048905 Ga0496102_0002464 Ga0496102_0002464_2145_2984 272
184 3300048905 Ga0496102_0215045 Ga0496102_0215045_625_1464 272
185 3300048907 Ga0496104_0022274 Ga0496104_0022274_3247_4086 272
186 3300048911 Ga0496108_0043058 Ga0496108_0043058_2680_3519 272
187 3300048912 Ga0496109_0038316 Ga0496109_0038316_771_1610 272
188 3300048913 Ga0496110_0030038 Ga0496110_0030038_1739_2578 272
189 3300048914 Ga0496111_0002364 Ga0496111_0002364_586_1425 272
190 3300048917 Ga0496114_0037659 Ga0496114_0037659_576_1415 272
191 3300048917 Ga0496114_0062013 Ga0496114_0062013_266_1105 272
192 3300048917 Ga0496114_0283939 Ga0496114_0283939_21_929 272
193 3300048925 Ga0496122_0017441 Ga0496122_0017441_1496_2365 272
194 3300048926 Ga0496123_0001442 Ga0496123_0001442_877_1746 272
195 3300048927 Ga0496124_0005102 Ga0496124_0005102_2718_3563 272
196 3300049569 Ga0501032_0031532 Ga0501032_0031532_1459_2319 272
197 3300049570 Ga0501033_0016764 Ga0501033_0016764_1568_2428 272
198 3300049572 Ga0501036_0073237 Ga0501036_0073237_1943_2803 272
199 3300049573 Ga0501037_0043755 Ga0501037_0043755_2308_3168 272
200 3300049579 Ga0501043_0017701 Ga0501043_0017701_4286_5146 272
201 3300049580 Ga0501046_0033490 Ga0501046_0033490_1690_2544 272
202 3300049581 Ga0501047_0046575 Ga0501047_0046575_312_1172 272
203 3300049583 Ga0501067_0196206 Ga0501067_0196206_78_938 272
204 3300049584 Ga0501068_0041192 Ga0501068_0041192_1325_2185 272
205 3300049587 Ga0501071_0367659 Ga0501071_0367659_15_875 272
206 3300049822 Ga0501035_0167146 Ga0501035_0167146_312_1172 272
207 3300049823 Ga0501044_0085035 Ga0501044_0085035_773_1633 272
208 3300053139 Ga0500568_0001935 Ga0500568_0001935_1146_1973 272
209 iso_pu_bacteria 2977264416 2977264490 272
210 3300011119 Ga0105246_10315691 Ga0105246_103156911 273
211 3300014326 Ga0157380_10036878 Ga0157380_100368781 273
212 iso_pu_bacteria 2905926851 2905930561 273
213 3300001989 JGI24739J22299_10019117 JGI24739J22299_100191172 274
214 3300009553 Ga0105249_10220070 Ga0105249_102200702 274
215 3300010375 Ga0105239_10117548 Ga0105239_101175482 274
216 3300011119 Ga0105246_10300032 Ga0105246_103000321 274
217 3300013105 Ga0157369_10206662 Ga0157369_102066622 274
218 3300013307 Ga0157372_10123819 Ga0157372_101238194 274
219 3300025904 Ga0207647_10002199 Ga0207647_100021999 274
220 3300025961 Ga0207712_10215317 Ga0207712_102153172 274
221 3300030522 Ga0307512_10227821 Ga0307512_102278211 274
222 3300031901 Ga0307406_10072749 Ga0307406_100727492 274
223 3300041443 Ga0451789_0188137 Ga0451789_0188137_993_1892 274
224 3300041451 Ga0451791_1825768 Ga0451791_1825768_2268_3167 274
225 3300041452 Ga0451793_0256894 Ga0451793_0256894_5563_6462 274
226 3300041453 Ga0451797_0766943 Ga0451797_0766943_1152_2051 274
227 3300041456 Ga0451795_0029673 Ga0451795_0029673_137_1036 274
228 3300041486 Ga0451807_1349404 Ga0451807_1349404_895_1794 274
229 3300041512 Ga0451853_3259773 Ga0451853_3259773_691_1590 274
230 3300046660 Ga0495625_0235192 Ga0495625_0235192_339_1163 274
231 3300048913 Ga0496110_0209990 Ga0496110_0209990_765_1664 274
232 3300049823 Ga0501044_0321023 Ga0501044_0321023_91_915 274
233 3300053099 Ga0500654_118527 Ga0500654_118527_176_1015 274
234 iso_pu_bacteria 2816332119 2816424633 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04962

KduI

KduI/IolB family

53

298

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xru-assembly1.cif.gz_A crystal structure of 5-keto-4-deoxyuronate isomerase from eschericia coli 0.9672 3 274
7ye3-assembly1.cif.gz_C crystal structure of lactobacillus rhamnosus 4-deoxy-l-threo-5-hexosulose-uronate ketol-isomerase kdui complexed with mes 0.9663 1 269
1xru-assembly1.cif.gz_A crystal structure of 5-keto-4-deoxyuronate isomerase from eschericia coli 0.9568 3 274
1ywk-assembly6.cif.gz_F crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from enterococcus faecalis 0.9555 3 258
7yrs-assembly4.cif.gz_D crystal structure of lactobacillus rhamnosus 4-deoxy-l-threo-5-hexosulose-uronate ketol-isomerase kdui complexed with mops 0.9548 1 259
ID Description Score Start End Superfamily
af_Q46938_25_265_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9699 28 261 2.60.120.10
1x8mA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9572 138 262 2.60.120.10
1ywkB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9488 1 258 2.60.120.10
1ywkB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9452 1 258 2.60.120.10
af_Q46938_25_265_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9384 28 261 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4R8CG22-F1-model_v4 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase (EC 5.3.1.17) (5-keto-4-deoxyuronate isomerase) (DKI isomerase) 0.9971 1 274 GO:0008270
GO:0008697
GO:0019698
GO:0042840
GO:0045490
AF-A0A4R4Q430-F1-model_v4 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase (EC 5.3.1.17) (5-keto-4-deoxyuronate isomerase) (DKI isomerase) 0.9969 1 274 GO:0008270
GO:0008697
GO:0019698
GO:0042840
GO:0045490
AF-A0A2T0Y886-F1-model_v4 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase (EC 5.3.1.17) (5-keto-4-deoxyuronate isomerase) (DKI isomerase) 0.9961 4 274 GO:0008270
GO:0008697
GO:0019698
GO:0042840
GO:0045490
AF-A0A147F2W7-F1-model_v4 5-dehydro-4-deoxy-D-glucuronate isomerase (EC 5.3.1.17) 0.995 57 274 GO:0008697
GO:0019698
GO:0042840
GO:0045490
GO:0046872
AF-A0A4Y8K5T7-F1-model_v4 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase (EC 5.3.1.17) (5-keto-4-deoxyuronate isomerase) (DKI isomerase) 0.9936 4 274 GO:0008270
GO:0008697
GO:0019698
GO:0042840
GO:0045490

Feature Viewer

pLDDT pTM Quality
94.29 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map