F346894

General Info

Members Datasets Scaffolds Average Seq Length
234 178 468 304

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100114191|Ga0070672_1001141913
Length 329
Sequence MGRNPAPRALPDRWSKMSALPIVDAHQHFWDLHRNYYPWLSDAAPANFRYGDTAPLRRNYLPPDYHADCAAHRVVASVHVEAEWDPRDPVGETRWLAELRQQSGFPTAAIGQAWFDRDDIAQVLAGHAQFDFLRGVRQKPKTAASPAAVVAGAPGTMSDPRWRDGYALLERHGLSYDLQAPWWHMAEAAALARDFPRTPVIINHTALPADRSDEALAGWRSALEMVAAQPNVTLKISGLGIRRERWSAGRNAAIVRDAIRIFGADRCMFASNFPVDRLVGSFDTIFTGFKAIVADMAENEQRMLFHDNAVRVYRLDVACAAHEADVLPR

Samples

Sample ID Description Type Environment
1 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
50 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
91 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
103 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
104 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
107 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
108 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
111 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
112 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
113 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
119 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
120 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
156 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
157 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
158 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
159 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
163 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
164 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
165 2643221733 Bosea sp. Root381 Isolate Unclassified
166 2643221736 Bosea sp. Root483D1 Isolate Unclassified
167 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
168 2841760612 Bosea sp. Tri-49 Isolate Nodule
169 2842733646 Variovorax sp. R-72446 Isolate Unclassified
170 2844104063 Bosea sp. Tri-39 Isolate Nodule
171 2851182111 Bosea sp. Tri-44 Isolate Nodule
172 2851246043 Bosea sp. Tri-54 Isolate Nodule
173 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
174 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
175 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
176 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
177 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
178 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.16
Metatranscriptomes 0
Isolates 6.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.12
Nodule 3.42
Rhizoplane 1.28
Rhizosphere 80.77
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070672_100114191 3300005543 Bacteria 2205
2 JGI25159J45721_1010185 3300002987 Bacteria 2419
3 JGI25151J46595_10037560 3300003187 Bacteria 1815
4 Ga0055526_1000318 3300003771 Bacteria 40039
5 Ga0065165_1000393 3300005262 Bacteria 71081
6 Ga0070683_100554791 3300005329 Bacteria 1099
7 Ga0070666_10028256 3300005335 Bacteria 3679
8 Ga0070680_100018043 3300005336 Bacteria 5573
9 Ga0070680_100230859 3300005336 Bacteria 1563
10 Ga0070689_100193239 3300005340 Bacteria 1658
11 Ga0070668_100125534 3300005347 Unclassified 2055
12 Ga0070668_100489750 3300005347 Bacteria 1063
13 Ga0070669_100062753 3300005353 Bacteria 2733
14 Ga0070669_100063614 3300005353 Bacteria 2716
15 Ga0070674_100027282 3300005356 Bacteria 3741
16 Ga0070667_100109313 3300005367 Bacteria 2396
17 Ga0070700_100130239 3300005441 Bacteria 1697
18 Ga0070662_100122501 3300005457 Bacteria 1995
19 Ga0070681_10185480 3300005458 Unclassified 2001
20 Ga0070679_100048250 3300005530 Bacteria 4243
21 Ga0070679_100049307 3300005530 Bacteria 4193
22 Ga0070679_100113521 3300005530 Bacteria 2694
23 Ga0070684_100405485 3300005535 Bacteria 1257
24 Ga0068853_100241682 3300005539 Bacteria 1655
25 Ga0070672_100048129 3300005543 Bacteria 3311
26 Ga0070665_100009625 3300005548 Bacteria 9776
27 Ga0070704_100053773 3300005549 Bacteria 2847
28 Ga0068855_100003702 3300005563 Bacteria 18692
29 Ga0068856_100253571 3300005614 Bacteria 1774
30 Ga0068852_100106176 3300005616 Bacteria 2545
31 Ga0068859_100566754 3300005617 Bacteria 1230
32 Ga0068864_100540716 3300005618 Bacteria 1125
33 Ga0068866_10233905 3300005718 Bacteria 1116
34 Ga0075366_10066220 3300006195 Bacteria 2149
35 Ga0075428_100008113 3300006844 Bacteria 11659
36 Ga0075433_10058623 3300006852 Bacteria 3367
37 Ga0075434_100043357 3300006871 Bacteria 4462
38 Ga0097620_100566769 3300006931 Bacteria 1230
39 Ga0075435_100020635 3300007076 Bacteria 5054
40 Ga0105240_10007910 3300009093 Bacteria 15335
41 Ga0111539_10007150 3300009094 Bacteria 14309
42 Ga0111539_10064333 3300009094 Bacteria 4339
43 Ga0114129_10170551 3300009147 Bacteria 2967
44 Ga0114129_10607175 3300009147 Bacteria 1417
45 Ga0114129_10733438 3300009147 Bacteria 1266
46 Ga0105248_10014517 3300009177 Bacteria 8671
47 Ga0105249_10069792 3300009553 Bacteria 3243
48 Ga0105249_10239884 3300009553 Bacteria 1792
49 Ga0157373_10109575 3300013100 Bacteria 1941
50 Ga0157374_10040219 3300013296 Bacteria 4305
51 Ga0157378_10052479 3300013297 Bacteria 3628
52 Ga0163162_10002505 3300013306 Bacteria 17372
53 Ga0163162_10012723 3300013306 Bacteria 8218
54 Ga0157372_10178275 3300013307 Bacteria 2460
55 Ga0157375_10001566 3300013308 Bacteria 19708
56 Ga0157380_10286897 3300014326 Bacteria 1509
57 Ga0182008_10000219 3300014497 Bacteria 44976
58 Ga0163161_10007504 3300017792 Bacteria 7537
59 Ga0213875_10001045 3300021388 Bacteria 19483
60 Ga0209129_1001343 3300025258 Bacteria 13905
61 Ga0209130_1000061 3300025284 Bacteria 200990
62 Ga0209025_1000029 3300025294 Bacteria 488571
63 Ga0209025_1000291 3300025294 Bacteria 112755
64 Ga0209025_1002869 3300025294 Bacteria 17281
65 Ga0209025_1012618 3300025294 Bacteria 5398
66 Ga0209025_1062702 3300025294 Bacteria 1377
67 Ga0207426_1041851 3300025302 Bacteria 1417
68 Ga0207642_10043254 3300025899 Bacteria 1985
69 Ga0207680_10010704 3300025903 Bacteria 4601
70 Ga0207705_10001339 3300025909 Bacteria 19735
71 Ga0207705_10008788 3300025909 Bacteria 7363
72 Ga0207705_10037764 3300025909 Bacteria 3456
73 Ga0207654_10037457 3300025911 Bacteria 2715
74 Ga0207707_10048121 3300025912 Bacteria 3714
75 Ga0207707_10090287 3300025912 Unclassified 2677
76 Ga0207707_10181504 3300025912 Bacteria 1837
77 Ga0207695_10159374 3300025913 Bacteria 2189
78 Ga0207671_10340916 3300025914 Bacteria 1187
79 Ga0207660_10049579 3300025917 Bacteria 2978
80 Ga0207660_10087145 3300025917 Unclassified 2306
81 Ga0207662_10198812 3300025918 Bacteria 1297
82 Ga0207657_10134969 3300025919 Bacteria 2020
83 Ga0207681_10025483 3300025923 Bacteria 3805
84 Ga0207681_10273737 3300025923 Bacteria 1326
85 Ga0207659_10170927 3300025926 Bacteria 1715
86 Ga0207706_10040991 3300025933 Bacteria 4105
87 Ga0207686_10199463 3300025934 Bacteria 1432
88 Ga0207704_10130389 3300025938 Bacteria 1740
89 Ga0207665_10347801 3300025939 Bacteria 1119
90 Ga0207691_10021327 3300025940 Bacteria 6118
91 Ga0207711_10019013 3300025941 Bacteria 5717
92 Ga0207689_10091614 3300025942 Bacteria 2497
93 Ga0207661_10291292 3300025944 Bacteria 1461
94 Ga0207667_10022599 3300025949 Bacteria 6941
95 Ga0207667_10064803 3300025949 Bacteria 3813
96 Ga0207651_10136786 3300025960 Bacteria 1886
97 Ga0207712_10039266 3300025961 Bacteria 3242
98 Ga0207712_10079249 3300025961 Bacteria 2385
99 Ga0207668_10269903 3300025972 Bacteria 1390
100 Ga0207703_10309817 3300026035 Unclassified 1443
101 Ga0207678_10155213 3300026067 Bacteria 1954
102 Ga0207708_10041900 3300026075 Bacteria 3490
103 Ga0207702_10200856 3300026078 Bacteria 1848
104 Ga0207674_10234134 3300026116 Bacteria 1784
105 Ga0207428_10314959 3300027907 Bacteria 1156
106 Ga0268266_10000975 3300028379 Bacteria 36323
107 Ga0268265_10231647 3300028380 Bacteria 1624
108 Ga0307515_10000208 3300028794 Bacteria 144484
109 Ga0307515_10092149 3300028794 Bacteria 3775
110 Ga0307513_10141436 3300031456 Bacteria 2332
111 Ga0265342_10001132 3300031712 Bacteria 25514
112 Ga0307410_10122858 3300031852 Bacteria 1896
113 Ga0307414_10006866 3300032004 Bacteria 6369
114 Ga0373940_0050445 3300035088 Bacteria 1168
115 Ga0373941_0007776 3300035115 Bacteria 2637
116 Ga0373931_0001720 3300035691 Bacteria 9496
117 Ga0395900_0031546 3300037418 Bacteria 5447
118 Ga0395898_0476104 3300037466 Bacteria 1188
119 Ga0395905_0000160 3300037471 Bacteria 111265
120 Ga0395905_0175396 3300037471 Bacteria 2013
121 Ga0436364_0121966 3300037853 Bacteria 57474
122 Ga0436364_0340180 3300037853 Bacteria 2662
123 Ga0395901_0044420 3300038443 Bacteria 4609
124 Ga0395901_0142955 3300038443 Bacteria 2515
125 Ga0466963_0118106 3300044694 Bacteria 1824
126 Ga0495603_0110960 3300046455 Unclassified 1600
127 Ga0495638_0004784 3300046460 Bacteria 10205
128 Ga0495638_0028454 3300046460 Bacteria 3609
129 Ga0495580_0186615 3300046472 Bacteria 1431
130 Ga0495605_0013400 3300046474 Bacteria 4519
131 Ga0495584_0117737 3300046491 Bacteria 1345
132 Ga0495585_0008635 3300046492 Bacteria 6165
133 Ga0495606_0020929 3300046507 Bacteria 4804
134 Ga0495631_0000042 3300046518 Bacteria 78766
135 Ga0495637_0007319 3300046520 Bacteria 5483
136 Ga0495611_0095783 3300046648 Bacteria 1374
137 Ga0495625_0012889 3300046660 Bacteria 6755
138 Ga0495669_0002744 3300046684 Bacteria 7224
139 Ga0495670_0074850 3300046691 Bacteria 1718
140 Ga0495649_0092292 3300046694 Bacteria 1613
141 Ga0495589_0002056 3300046794 Bacteria 11389
142 Ga0495674_0040458 3300047319 Bacteria 4169
143 Ga0496100_0073232 3300048903 Bacteria 2292
144 Ga0496102_0006865 3300048905 Bacteria 9717
145 Ga0496114_0393203 3300048917 Bacteria 1228
146 Ga0496118_0215919 3300048921 Bacteria 1121
147 Ga0496122_0000531 3300048925 Bacteria 79144
148 Ga0496123_0000108 3300048926 Bacteria 166102
149 Ga0501032_0003106 3300049569 Bacteria 12808
150 Ga0501033_0018997 3300049570 Bacteria 5195
151 Ga0501033_0207665 3300049570 Bacteria 1397
152 Ga0501034_0000182 3300049571 Bacteria 117605
153 Ga0501034_0001431 3300049571 Bacteria 31849
154 Ga0501034_0010425 3300049571 Bacteria 9682
155 Ga0501034_0040220 3300049571 Bacteria 4734
156 Ga0501036_0001003 3300049572 Bacteria 21331
157 Ga0501037_0003891 3300049573 Bacteria 10835
158 Ga0501038_0064344 3300049574 Bacteria 3127
159 Ga0501038_0066646 3300049574 Bacteria 3065
160 Ga0501038_0114811 3300049574 Bacteria 2227
161 Ga0501039_0019304 3300049575 Bacteria 5226
162 Ga0501042_0047022 3300049578 Bacteria 3076
163 Ga0501042_0218600 3300049578 Bacteria 1374
164 Ga0501043_0031048 3300049579 Bacteria 4200
165 Ga0501043_0212464 3300049579 Bacteria 1499
166 Ga0501046_0005484 3300049580 Bacteria 11336
167 Ga0501046_0045594 3300049580 Bacteria 3483
168 Ga0501046_0192811 3300049580 Bacteria 1519
169 Ga0501047_0028607 3300049581 Bacteria 5374
170 Ga0501067_0012508 3300049583 Bacteria 4707
171 Ga0501068_0019555 3300049584 Bacteria 3935
172 Ga0501069_0002800 3300049585 Bacteria 8920
173 Ga0501070_0111738 3300049586 Bacteria 2258
174 Ga0501071_0088009 3300049587 Bacteria 2279
175 Ga0501072_0007539 3300049588 Bacteria 8259
176 Ga0501072_0154586 3300049588 Bacteria 1829
177 Ga0501073_0008373 3300049589 Bacteria 7671
178 Ga0501073_0022035 3300049589 Bacteria 4591
179 Ga0501074_0026302 3300049590 Bacteria 4218
180 Ga0501074_0095336 3300049590 Bacteria 2131
181 Ga0501074_0113739 3300049590 Bacteria 1936
182 Ga0501075_0027452 3300049591 Bacteria 4195
183 Ga0501076_0079238 3300049592 Bacteria 2636
184 Ga0501077_0031026 3300049593 Bacteria 3400
185 Ga0501077_0136596 3300049593 Bacteria 1555
186 Ga0501079_0002158 3300049741 Bacteria 14169
187 Ga0501079_0045238 3300049741 Bacteria 3397
188 Ga0501080_0116663 3300049742 Bacteria 2474
189 Ga0501081_0033858 3300049743 Bacteria 3473
190 Ga0501083_0008704 3300049744 Bacteria 7158
191 Ga0501083_0022780 3300049744 Bacteria 4347
192 Ga0501083_0238431 3300049744 Unclassified 1184
193 Ga0501035_0054967 3300049822 Bacteria 3555
194 Ga0501035_0075003 3300049822 Bacteria 2991
195 Ga0501035_0144125 3300049822 Bacteria 2070
196 Ga0501044_0001510 3300049823 Bacteria 27272
197 Ga0501044_0115329 3300049823 Bacteria 2691
198 Ga0501044_0160360 3300049823 Bacteria 2226
199 nmdc:mga0k408_50743_c1 3300050493 Bacteria 2402
200 nmdc:mga05p37_293895_c1 3300050507 Bacteria 1933
201 nmdc:mga05p37_647184_c1 3300050507 Bacteria 1184
202 nmdc:mga08y16_40757_c1 3300050511 Bacteria 4866
203 nmdc:mga08y16_432298_c1 3300050511 Bacteria 1344
204 nmdc:mga08y16_46362_c1 3300050511 Bacteria 4550
205 nmdc:mga0n895_24826_c1 3300050512 Bacteria 5655
206 nmdc:mga0n895_37731_c1 3300050512 Bacteria 4676
207 nmdc:mga0n895_409368_c1 3300050512 Bacteria 1371
208 nmdc:mga0rr50_12591_c1 3300050513 Bacteria 5475
209 nmdc:mga0a205_121963_c1 3300050515 Bacteria 2506
210 Ga0500610_0000161 3300053079 Bacteria 19927
211 Ga0500644_0004217 3300053088 Bacteria 3591
212 Ga0500594_0000710 3300053118 Bacteria 7098
213 Ga0500559_0002102 3300053136 Bacteria 10617
214 Ga0500577_0042926 3300053142 Bacteria 1658
215 Ga0501084_0050907 3300054114 Bacteria 3465
216 Ga0501084_0206315 3300054114 Bacteria 1658
217 Ga0501082_0031047 3300060353 Bacteria 4605
218 Ga0530510_0014262 3300061734 Bacteria 5603
219 2509076842 2508501114 Bacteria 7082538
220 2513955237 2513237150 Bacteria 6553639
221 2644728562 2643221733 Bacteria 5690728
222 2644746891 2643221736 Bacteria 6608466
223 2687577186 2687453129 Bacteria 4387428
224 2841762366 2841760612 Bacteria 6454112
225 2842737489 2842733646 Bacteria 5716726
226 2844109904 2844104063 Bacteria 6440972
227 2851186933 2851182111 Bacteria 6047226
228 2851248379 2851246043 Bacteria 6439203
229 2883826656 2883821847 Bacteria 5121194
230 2904545652 2904541872 Bacteria 8915136
231 2929168295 2929160207 Bacteria 9075316
232 644747958 644736347 Bacteria 6476522
233 8054566784 8054563764 Bacteria 5592885
234 8057535481 8057529695 Bacteria 6306553
235 Ga0070672_100114191
236 JGI25159J45721_1010185
237 JGI25151J46595_10037560
238 Ga0055526_1000318
239 Ga0065165_1000393
240 Ga0070683_100554791
241 Ga0070666_10028256
242 Ga0070680_100018043
243 Ga0070680_100230859
244 Ga0070689_100193239
245 Ga0070668_100125534
246 Ga0070668_100489750
247 Ga0070669_100062753
248 Ga0070669_100063614
249 Ga0070674_100027282
250 Ga0070667_100109313
251 Ga0070700_100130239
252 Ga0070662_100122501
253 Ga0070681_10185480
254 Ga0070679_100048250
255 Ga0070679_100049307
256 Ga0070679_100113521
257 Ga0070684_100405485
258 Ga0068853_100241682
259 Ga0070672_100048129
260 Ga0070665_100009625
261 Ga0070704_100053773
262 Ga0068855_100003702
263 Ga0068856_100253571
264 Ga0068852_100106176
265 Ga0068859_100566754
266 Ga0068864_100540716
267 Ga0068866_10233905
268 Ga0075366_10066220
269 Ga0075428_100008113
270 Ga0075433_10058623
271 Ga0075434_100043357
272 Ga0097620_100566769
273 Ga0075435_100020635
274 Ga0105240_10007910
275 Ga0111539_10007150
276 Ga0111539_10064333
277 Ga0114129_10170551
278 Ga0114129_10607175
279 Ga0114129_10733438
280 Ga0105248_10014517
281 Ga0105249_10069792
282 Ga0105249_10239884
283 Ga0157373_10109575
284 Ga0157374_10040219
285 Ga0157378_10052479
286 Ga0163162_10002505
287 Ga0163162_10012723
288 Ga0157372_10178275
289 Ga0157375_10001566
290 Ga0157380_10286897
291 Ga0182008_10000219
292 Ga0163161_10007504
293 Ga0213875_10001045
294 Ga0209129_1001343
295 Ga0209130_1000061
296 Ga0209025_1000029
297 Ga0209025_1000291
298 Ga0209025_1002869
299 Ga0209025_1012618
300 Ga0209025_1062702
301 Ga0207426_1041851
302 Ga0207642_10043254
303 Ga0207680_10010704
304 Ga0207705_10001339
305 Ga0207705_10008788
306 Ga0207705_10037764
307 Ga0207654_10037457
308 Ga0207707_10048121
309 Ga0207707_10090287
310 Ga0207707_10181504
311 Ga0207695_10159374
312 Ga0207671_10340916
313 Ga0207660_10049579
314 Ga0207660_10087145
315 Ga0207662_10198812
316 Ga0207657_10134969
317 Ga0207681_10025483
318 Ga0207681_10273737
319 Ga0207659_10170927
320 Ga0207706_10040991
321 Ga0207686_10199463
322 Ga0207704_10130389
323 Ga0207665_10347801
324 Ga0207691_10021327
325 Ga0207711_10019013
326 Ga0207689_10091614
327 Ga0207661_10291292
328 Ga0207667_10022599
329 Ga0207667_10064803
330 Ga0207651_10136786
331 Ga0207712_10039266
332 Ga0207712_10079249
333 Ga0207668_10269903
334 Ga0207703_10309817
335 Ga0207678_10155213
336 Ga0207708_10041900
337 Ga0207702_10200856
338 Ga0207674_10234134
339 Ga0207428_10314959
340 Ga0268266_10000975
341 Ga0268265_10231647
342 Ga0307515_10000208
343 Ga0307515_10092149
344 Ga0307513_10141436
345 Ga0265342_10001132
346 Ga0307410_10122858
347 Ga0307414_10006866
348 Ga0373940_0050445
349 Ga0373941_0007776
350 Ga0373931_0001720
351 Ga0395900_0031546
352 Ga0395898_0476104
353 Ga0395905_0000160
354 Ga0395905_0175396
355 Ga0436364_0121966
356 Ga0436364_0340180
357 Ga0395901_0044420
358 Ga0395901_0142955
359 Ga0466963_0118106
360 Ga0495603_0110960
361 Ga0495638_0004784
362 Ga0495638_0028454
363 Ga0495580_0186615
364 Ga0495605_0013400
365 Ga0495584_0117737
366 Ga0495585_0008635
367 Ga0495606_0020929
368 Ga0495631_0000042
369 Ga0495637_0007319
370 Ga0495611_0095783
371 Ga0495625_0012889
372 Ga0495669_0002744
373 Ga0495670_0074850
374 Ga0495649_0092292
375 Ga0495589_0002056
376 Ga0495674_0040458
377 Ga0496100_0073232
378 Ga0496102_0006865
379 Ga0496114_0393203
380 Ga0496118_0215919
381 Ga0496122_0000531
382 Ga0496123_0000108
383 Ga0501032_0003106
384 Ga0501033_0018997
385 Ga0501033_0207665
386 Ga0501034_0000182
387 Ga0501034_0001431
388 Ga0501034_0010425
389 Ga0501034_0040220
390 Ga0501036_0001003
391 Ga0501037_0003891
392 Ga0501038_0064344
393 Ga0501038_0066646
394 Ga0501038_0114811
395 Ga0501039_0019304
396 Ga0501042_0047022
397 Ga0501042_0218600
398 Ga0501043_0031048
399 Ga0501043_0212464
400 Ga0501046_0005484
401 Ga0501046_0045594
402 Ga0501046_0192811
403 Ga0501047_0028607
404 Ga0501067_0012508
405 Ga0501068_0019555
406 Ga0501069_0002800
407 Ga0501070_0111738
408 Ga0501071_0088009
409 Ga0501072_0007539
410 Ga0501072_0154586
411 Ga0501073_0008373
412 Ga0501073_0022035
413 Ga0501074_0026302
414 Ga0501074_0095336
415 Ga0501074_0113739
416 Ga0501075_0027452
417 Ga0501076_0079238
418 Ga0501077_0031026
419 Ga0501077_0136596
420 Ga0501079_0002158
421 Ga0501079_0045238
422 Ga0501080_0116663
423 Ga0501081_0033858
424 Ga0501083_0008704
425 Ga0501083_0022780
426 Ga0501083_0238431
427 Ga0501035_0054967
428 Ga0501035_0075003
429 Ga0501035_0144125
430 Ga0501044_0001510
431 Ga0501044_0115329
432 Ga0501044_0160360
433 nmdc:mga0k408_50743_c1
434 nmdc:mga05p37_293895_c1
435 nmdc:mga05p37_647184_c1
436 nmdc:mga08y16_40757_c1
437 nmdc:mga08y16_432298_c1
438 nmdc:mga08y16_46362_c1
439 nmdc:mga0n895_24826_c1
440 nmdc:mga0n895_37731_c1
441 nmdc:mga0n895_409368_c1
442 nmdc:mga0rr50_12591_c1
443 nmdc:mga0a205_121963_c1
444 Ga0500610_0000161
445 Ga0500644_0004217
446 Ga0500594_0000710
447 Ga0500559_0002102
448 Ga0500577_0042926
449 Ga0501084_0050907
450 Ga0501084_0206315
451 Ga0501082_0031047
452 Ga0530510_0014262
453 2509076842
454 2513955237
455 2644728562
456 2644746891
457 2687577186
458 2841762366
459 2842737489
460 2844109904
461 2851186933
462 2851248379
463 2883826656
464 2904545652
465 2929168295
466 644747958
467 8054566784
468 8057535481

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

23

315

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4do7-assembly2.cif.gz_B crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 0.8521 22 314
6uvz-assembly4.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8506 20 316
6uvz-assembly4.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8443 20 316
4dnm-assembly1.cif.gz_A crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 0.8407 22 314
4do7-assembly2.cif.gz_B crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 0.8379 22 314
ID Description Score Start End Superfamily
4do7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8521 22 314 3.20.20.140
4do7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8379 22 314 3.20.20.140
4i6kA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7993 22 314 3.20.20.140
af_A0A0R0KUU2_4_202_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7916 93 300 3.20.20.140
4i6kA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7885 22 314 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A158B707-F1-model_v4 Amidohydrolase 0.9885 6 314 GO:0016787
AF-A0A160VNU9-F1-model_v4 deleted 0.9863 190 317
AF-A0A315EPH9-F1-model_v4 Thioesterase 0.9851 20 314 GO:0016787
AF-A0A158DWB4-F1-model_v4 Amidohydrolase 2 0.9847 92 313 GO:0016787
AF-A0A6N1VIB5-F1-model_v4 Amidohydrolase family protein 0.9828 20 314 GO:0016787

Map